F368028
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 145 | 249 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10001259|Ga0105240_1000125918 |
| Length | 229 |
| Sequence | LGADEEFLTSPCTLQGVGLNILMFKHSLYFNINFKMQQLVFATNNAHKLEEVAAKIAGKIKLLSLDDIGCHDDIEETGTTFNENASIKSHFIYHKYQLNCFGDDSGLEIDALNGEPGVYSSRYAGEYGNHAANMDRVLEKLNGATNRSARFRTVISLIWEGKEHFFEGTVEGTIRHERSGTAGFGYDPIFEPMGYNITFAEMSMEEKNSISHRAKAVEKLVEFLAPFTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 3 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 4 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 5 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 6 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 7 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 8 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 9 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 54 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 55 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 77 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 78 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 82 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 83 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 84 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 85 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 86 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 87 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 88 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 89 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 90 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 91 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 92 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 93 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 94 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 95 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 96 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 97 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 98 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 99 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 100 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 101 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 102 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 103 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 104 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 105 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 108 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 109 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 110 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 140 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 141 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 142 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 143 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 144 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 145 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.12 |
| Metatranscriptomes | 0 |
| Isolates | 3.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.53 |
| Nodule | 0 |
| Rhizoplane | 0.39 |
| Rhizosphere | 83.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10022858 | 3300001979 | Bacteria | 2145 |
| 2 | JGI24737J22298_10001296 | 3300001990 | Bacteria | 8857 |
| 3 | JGI24735J21928_10000017 | 3300002067 | Bacteria | 114440 |
| 4 | JGI24735J21928_10042150 | 3300002067 | Bacteria | 1329 |
| 5 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 6 | JGI25162J39368_1001222 | 3300002737 | Bacteria | 14893 |
| 7 | JGI25164J39214_1000686 | 3300002772 | Bacteria | 13360 |
| 8 | JGI25165J46597_1000937 | 3300003214 | Bacteria | 19984 |
| 9 | rootH1_10087025 | 3300003316 | Bacteria | 3693 |
| 10 | rootH1_10087025 | 3300003323 | Bacteria | 14602 |
| 11 | rootH1_10117319 | 3300003316 | Bacteria | 3424 |
| 12 | rootH2_10092263 | 3300003320 | Bacteria | 3195 |
| 13 | rootH2_10157637 | 3300003320 | Unclassified | 1358 |
| 14 | rootH2_10209483 | 3300003320 | Bacteria | 1267 |
| 15 | rootL2_10054585 | 3300003322 | Bacteria | 1565 |
| 16 | rootH1_10032009 | 3300003323 | Bacteria | 20379 |
| 17 | rootH1_10372142 | 3300003323 | Bacteria | 1252 |
| 18 | Ga0065714_10019616 | 3300005288 | Bacteria | 1877 |
| 19 | Ga0065714_10215123 | 3300005288 | Bacteria | 856 |
| 20 | Ga0065714_10257942 | 3300005288 | Unclassified | 762 |
| 21 | Ga0070677_10307349 | 3300005333 | Unclassified | 808 |
| 22 | Ga0070680_100634175 | 3300005336 | Unclassified | 918 |
| 23 | Ga0070675_100774899 | 3300005354 | Unclassified | 876 |
| 24 | Ga0070674_100202127 | 3300005356 | Unclassified | 1535 |
| 25 | Ga0070659_100002505 | 3300005366 | Bacteria | 13046 |
| 26 | Ga0070663_100011963 | 3300005455 | Bacteria | 5474 |
| 27 | Ga0070678_100561557 | 3300005456 | Bacteria | 1014 |
| 28 | Ga0070681_10474763 | 3300005458 | Bacteria | 1163 |
| 29 | Ga0070679_100020182 | 3300005530 | Bacteria | 6494 |
| 30 | Ga0070679_100266389 | 3300005530 | Unclassified | 1668 |
| 31 | Ga0070665_100683475 | 3300005548 | Bacteria | 1039 |
| 32 | Ga0068855_100066159 | 3300005563 | Bacteria | 4214 |
| 33 | Ga0068855_100084130 | 3300005563 | Bacteria | 3684 |
| 34 | Ga0068855_100974386 | 3300005563 | Unclassified | 892 |
| 35 | Ga0068857_100023240 | 3300005577 | Bacteria | 5456 |
| 36 | Ga0068857_100051831 | 3300005577 | Bacteria | 3641 |
| 37 | Ga0068854_100020002 | 3300005578 | Bacteria | 4520 |
| 38 | Ga0068856_100000006 | 3300005614 | Bacteria | 223827 |
| 39 | Ga0068856_100041952 | 3300005614 | Bacteria | 4499 |
| 40 | Ga0068852_100081077 | 3300005616 | Bacteria | 2879 |
| 41 | Ga0068864_100789975 | 3300005618 | Bacteria | 932 |
| 42 | Ga0068858_100065168 | 3300005842 | Bacteria | 3371 |
| 43 | Ga0075366_10000026 | 3300006195 | Bacteria | 51752 |
| 44 | Ga0075366_10003461 | 3300006195 | Bacteria | 8333 |
| 45 | Ga0075366_10282707 | 3300006195 | Bacteria | 1014 |
| 46 | Ga0105240_10001259 | 3300009093 | Bacteria | 43960 |
| 47 | Ga0105240_10053510 | 3300009093 | Bacteria | 5067 |
| 48 | Ga0105240_10110774 | 3300009093 | Bacteria | 3322 |
| 49 | Ga0105240_10353426 | 3300009093 | Bacteria | 1667 |
| 50 | Ga0114129_11170666 | 3300009147 | Bacteria | 959 |
| 51 | Ga0105241_10006368 | 3300009174 | Bacteria | 8695 |
| 52 | Ga0105241_10136328 | 3300009174 | Bacteria | 1993 |
| 53 | Ga0105241_10183845 | 3300009174 | Bacteria | 1736 |
| 54 | Ga0105241_10537924 | 3300009174 | Unclassified | 1047 |
| 55 | Ga0105237_10002006 | 3300009545 | Bacteria | 25906 |
| 56 | Ga0105237_10004787 | 3300009545 | Bacteria | 15556 |
| 57 | Ga0105237_10011689 | 3300009545 | Bacteria | 9287 |
| 58 | Ga0105237_10033449 | 3300009545 | Bacteria | 5207 |
| 59 | Ga0105237_10074538 | 3300009545 | Bacteria | 3386 |
| 60 | Ga0105237_10266421 | 3300009545 | Bacteria | 1716 |
| 61 | Ga0105237_10533318 | 3300009545 | Unclassified | 1180 |
| 62 | Ga0105238_10057690 | 3300009551 | Bacteria | 3892 |
| 63 | Ga0105238_10259315 | 3300009551 | Bacteria | 1718 |
| 64 | Ga0105239_10000016 | 3300010375 | Bacteria | 293142 |
| 65 | Ga0105239_10000045 | 3300010375 | Bacteria | 186314 |
| 66 | Ga0105239_10000955 | 3300010375 | Bacteria | 40720 |
| 67 | Ga0105239_10016398 | 3300010375 | Bacteria | 8194 |
| 68 | Ga0105239_10033293 | 3300010375 | Bacteria | 5660 |
| 69 | Ga0105239_10318841 | 3300010375 | Bacteria | 1752 |
| 70 | Ga0105239_11632129 | 3300010375 | Bacteria | 746 |
| 71 | Ga0157373_10001194 | 3300013100 | Bacteria | 19864 |
| 72 | Ga0157371_10000571 | 3300013102 | Bacteria | 43698 |
| 73 | Ga0157371_10001025 | 3300013102 | Bacteria | 30579 |
| 74 | Ga0157371_10068883 | 3300013102 | Bacteria | 2505 |
| 75 | Ga0157370_10256201 | 3300013104 | Bacteria | 1618 |
| 76 | Ga0157370_11240977 | 3300013104 | Bacteria | 672 |
| 77 | Ga0157369_10002452 | 3300013105 | Bacteria | 22259 |
| 78 | Ga0157369_10109159 | 3300013105 | Bacteria | 2942 |
| 79 | Ga0157369_10484246 | 3300013105 | Bacteria | 1280 |
| 80 | Ga0157378_10001635 | 3300013297 | Bacteria | 20269 |
| 81 | Ga0157378_10034996 | 3300013297 | Unclassified | 4441 |
| 82 | Ga0157378_11837683 | 3300013297 | Unclassified | 654 |
| 83 | Ga0163162_10001672 | 3300013306 | Bacteria | 20806 |
| 84 | Ga0163162_10001761 | 3300013306 | Bacteria | 20290 |
| 85 | Ga0157372_10000077 | 3300013307 | Bacteria | 102192 |
| 86 | Ga0157372_10001739 | 3300013307 | Bacteria | 23620 |
| 87 | Ga0157372_10005470 | 3300013307 | Bacteria | 13496 |
| 88 | Ga0157372_10508796 | 3300013307 | Bacteria | 1404 |
| 89 | Ga0157372_11967680 | 3300013307 | Unclassified | 672 |
| 90 | Ga0157375_10032705 | 3300013308 | Bacteria | 4935 |
| 91 | Ga0213872_10172327 | 3300021361 | Bacteria | 937 |
| 92 | Ga0213871_10000428 | 3300021441 | Bacteria | 5634 |
| 93 | Ga0207427_100109 | 3300025231 | Bacteria | 116061 |
| 94 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 95 | Ga0209437_100096 | 3300025233 | Bacteria | 233558 |
| 96 | Ga0209026_1001779 | 3300025250 | Bacteria | 8908 |
| 97 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 98 | Ga0209233_1011719 | 3300025261 | Bacteria | 2575 |
| 99 | Ga0209233_1026836 | 3300025261 | Bacteria | 1402 |
| 100 | Ga0209455_1008394 | 3300025272 | Bacteria | 2811 |
| 101 | Ga0207647_10000080 | 3300025904 | Bacteria | 71854 |
| 102 | Ga0207647_10100698 | 3300025904 | Unclassified | 1715 |
| 103 | Ga0207654_10008230 | 3300025911 | Bacteria | 5264 |
| 104 | Ga0207654_10287224 | 3300025911 | Unclassified | 1114 |
| 105 | Ga0207695_10000183 | 3300025913 | Bacteria | 181350 |
| 106 | Ga0207695_10062538 | 3300025913 | Bacteria | 3842 |
| 107 | Ga0207695_10132090 | 3300025913 | Bacteria | 2453 |
| 108 | Ga0207695_10324414 | 3300025913 | Bacteria | 1429 |
| 109 | Ga0207671_10000477 | 3300025914 | Bacteria | 54330 |
| 110 | Ga0207671_10001595 | 3300025914 | Bacteria | 25763 |
| 111 | Ga0207671_10010947 | 3300025914 | Bacteria | 7431 |
| 112 | Ga0207671_10021230 | 3300025914 | Bacteria | 4931 |
| 113 | Ga0207671_10098241 | 3300025914 | Unclassified | 2214 |
| 114 | Ga0207660_10603612 | 3300025917 | Unclassified | 894 |
| 115 | Ga0207652_10857765 | 3300025921 | Unclassified | 804 |
| 116 | Ga0207694_10062003 | 3300025924 | Bacteria | 2911 |
| 117 | Ga0207669_10201516 | 3300025937 | Unclassified | 1445 |
| 118 | Ga0207667_10031440 | 3300025949 | Bacteria | 5731 |
| 119 | Ga0207667_10832494 | 3300025949 | Bacteria | 918 |
| 120 | Ga0207640_10064909 | 3300025981 | Bacteria | 2434 |
| 121 | Ga0207678_10039081 | 3300026067 | Unclassified | 4119 |
| 122 | Ga0207702_10000023 | 3300026078 | Bacteria | 189234 |
| 123 | Ga0207702_10030047 | 3300026078 | Bacteria | 4527 |
| 124 | Ga0207702_10297212 | 3300026078 | Bacteria | 1531 |
| 125 | Ga0207674_10062939 | 3300026116 | Bacteria | 3746 |
| 126 | Ga0207683_10606104 | 3300026121 | Bacteria | 1014 |
| 127 | Ga0207698_10063300 | 3300026142 | Bacteria | 2894 |
| 128 | Ga0268266_10833414 | 3300028379 | Bacteria | 891 |
| 129 | Ga0265326_10061883 | 3300028558 | Bacteria | 1059 |
| 130 | Ga0307517_10234451 | 3300028786 | Bacteria | 1097 |
| 131 | Ga0307515_10000133 | 3300028794 | Bacteria | 176091 |
| 132 | Ga0307515_10000318 | 3300028794 | Bacteria | 118891 |
| 133 | Ga0265338_10044564 | 3300028800 | Bacteria | 4094 |
| 134 | Ga0265338_10180661 | 3300028800 | Bacteria | 1609 |
| 135 | Ga0265320_10018351 | 3300031240 | Bacteria | 3855 |
| 136 | Ga0265316_10116733 | 3300031344 | Bacteria | 2017 |
| 137 | Ga0307509_10046347 | 3300031507 | Bacteria | 4681 |
| 138 | Ga0307408_100000527 | 3300031548 | Bacteria | 33024 |
| 139 | Ga0307514_10006049 | 3300031649 | Bacteria | 10638 |
| 140 | Ga0316575_10154957 | 3300031665 | Bacteria | 946 |
| 141 | Ga0265342_10146730 | 3300031712 | Bacteria | 1313 |
| 142 | Ga0316576_10156700 | 3300031727 | Bacteria | 1717 |
| 143 | Ga0307412_10241112 | 3300031911 | Bacteria | 1398 |
| 144 | Ga0307412_10823058 | 3300031911 | Unclassified | 808 |
| 145 | Ga0307414_10005227 | 3300032004 | Bacteria | 7132 |
| 146 | Ga0307414_10070835 | 3300032004 | Bacteria | 2512 |
| 147 | Ga0307414_10404270 | 3300032004 | Bacteria | 1187 |
| 148 | Ga0307507_10000111 | 3300033179 | Bacteria | 134722 |
| 149 | Ga0373941_0032627 | 3300035115 | Bacteria | 1560 |
| 150 | Ga0316574_0000575 | 3300035398 | Bacteria | 15159 |
| 151 | Ga0373947_0463547 | 3300035725 | Bacteria | 859 |
| 152 | Ga0316582_0052575 | 3300036647 | Bacteria | 2589 |
| 153 | Ga0316584_0075628 | 3300036712 | Bacteria | 2524 |
| 154 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 155 | Ga0395899_0000152 | 3300037312 | Bacteria | 105233 |
| 156 | Ga0395900_0001123 | 3300037418 | Bacteria | 33875 |
| 157 | Ga0395900_0211427 | 3300037418 | Unclassified | 1958 |
| 158 | Ga0395900_0639906 | 3300037418 | Bacteria | 1001 |
| 159 | Ga0316581_0013982 | 3300037588 | Bacteria | 2282 |
| 160 | Ga0395901_0213337 | 3300038443 | Bacteria | 2020 |
| 161 | Ga0395901_0537426 | 3300038443 | Unclassified | 1186 |
| 162 | Ga0400483_219863 | 3300039062 | Bacteria | 173210 |
| 163 | Ga0436360_0638428 | 3300039438 | Bacteria | 11768 |
| 164 | Ga0451855_1610876 | 3300041511 | Bacteria | 795 |
| 165 | Ga0451577_0000004 | 3300042876 | Bacteria | 816743 |
| 166 | Ga0451577_0015793 | 3300042876 | Bacteria | 7008 |
| 167 | Ga0451577_0037718 | 3300042876 | Unclassified | 4350 |
| 168 | Ga0451577_0051137 | 3300042876 | Bacteria | 3689 |
| 169 | Ga0451577_0172773 | 3300042876 | Bacteria | 1947 |
| 170 | Ga0451577_0196953 | 3300042876 | Bacteria | 1818 |
| 171 | Ga0451577_0839673 | 3300042876 | Bacteria | 829 |
| 172 | Ga0466969_0141218 | 3300044656 | Bacteria | 1113 |
| 173 | Ga0453683_0000004 | 3300044673 | Bacteria | 759456 |
| 174 | Ga0453683_0007576 | 3300044673 | Bacteria | 7355 |
| 175 | Ga0453683_0608530 | 3300044673 | Bacteria | 713 |
| 176 | Ga0466966_0008903 | 3300044684 | Bacteria | 6649 |
| 177 | Ga0453684_0000025 | 3300044712 | Bacteria | 818638 |
| 178 | Ga0453684_0001027 | 3300044712 | Bacteria | 89253 |
| 179 | Ga0453684_0006764 | 3300044712 | Bacteria | 21578 |
| 180 | Ga0453684_0019690 | 3300044712 | Bacteria | 10248 |
| 181 | Ga0453684_0020661 | 3300044712 | Bacteria | 9909 |
| 182 | Ga0453684_0058220 | 3300044712 | Bacteria | 4992 |
| 183 | Ga0453684_0062544 | 3300044712 | Bacteria | 4767 |
| 184 | Ga0453684_0064424 | 3300044712 | Bacteria | 4682 |
| 185 | Ga0453684_0096037 | 3300044712 | Bacteria | 3642 |
| 186 | Ga0451576_0000005 | 3300045051 | Bacteria | 1294643 |
| 187 | Ga0451576_0000253 | 3300045051 | Bacteria | 131961 |
| 188 | Ga0451576_0006198 | 3300045051 | Bacteria | 14724 |
| 189 | Ga0451576_0101979 | 3300045051 | Bacteria | 2985 |
| 190 | Ga0466958_0283446 | 3300045836 | Bacteria | 1062 |
| 191 | Ga0495638_0025314 | 3300046460 | Bacteria | 3860 |
| 192 | Ga0495638_0050836 | 3300046460 | Bacteria | 2588 |
| 193 | Ga0495651_0332221 | 3300046462 | Bacteria | 1010 |
| 194 | Ga0495650_0000050 | 3300046471 | Bacteria | 318894 |
| 195 | Ga0495650_0092345 | 3300046471 | Bacteria | 1149 |
| 196 | Ga0495585_0000560 | 3300046492 | Bacteria | 35150 |
| 197 | Ga0495585_0000785 | 3300046492 | Bacteria | 28010 |
| 198 | Ga0495583_0007344 | 3300046506 | Bacteria | 6945 |
| 199 | Ga0495583_0040496 | 3300046506 | Bacteria | 2189 |
| 200 | Ga0495606_0000581 | 3300046507 | Bacteria | 58129 |
| 201 | Ga0495606_0003600 | 3300046507 | Bacteria | 16307 |
| 202 | Ga0495606_0003924 | 3300046507 | Bacteria | 15309 |
| 203 | Ga0495606_0033601 | 3300046507 | Bacteria | 3536 |
| 204 | Ga0495606_0084153 | 3300046507 | Bacteria | 1971 |
| 205 | Ga0495610_0002203 | 3300046512 | Bacteria | 16495 |
| 206 | Ga0495616_0000296 | 3300046513 | Bacteria | 40157 |
| 207 | Ga0495616_0001541 | 3300046513 | Bacteria | 15901 |
| 208 | Ga0495616_0194745 | 3300046513 | Bacteria | 894 |
| 209 | Ga0495637_0032721 | 3300046520 | Bacteria | 2289 |
| 210 | Ga0495648_0013917 | 3300046524 | Bacteria | 5922 |
| 211 | Ga0495648_0035819 | 3300046524 | Bacteria | 3212 |
| 212 | Ga0495652_0443098 | 3300046529 | Unclassified | 911 |
| 213 | Ga0495609_0002045 | 3300046538 | Bacteria | 12713 |
| 214 | Ga0495633_0007257 | 3300046558 | Bacteria | 6412 |
| 215 | Ga0495668_0000011 | 3300046616 | Bacteria | 472186 |
| 216 | Ga0495668_0156282 | 3300046616 | Unclassified | 1249 |
| 217 | Ga0495611_0043818 | 3300046648 | Bacteria | 2001 |
| 218 | Ga0495625_0000077 | 3300046660 | Bacteria | 163166 |
| 219 | Ga0495625_0001500 | 3300046660 | Bacteria | 28046 |
| 220 | Ga0495625_0004941 | 3300046660 | Bacteria | 12391 |
| 221 | Ga0495625_0023665 | 3300046660 | Bacteria | 4688 |
| 222 | Ga0495625_0049572 | 3300046660 | Bacteria | 3017 |
| 223 | Ga0495625_0052001 | 3300046660 | Bacteria | 2935 |
| 224 | Ga0495625_0542349 | 3300046660 | Bacteria | 705 |
| 225 | Ga0495661_0001682 | 3300046665 | Bacteria | 18011 |
| 226 | Ga0495661_0002867 | 3300046665 | Bacteria | 13039 |
| 227 | Ga0495670_0279165 | 3300046691 | Unclassified | 893 |
| 228 | Ga0495649_0000011 | 3300046694 | Bacteria | 416695 |
| 229 | Ga0495660_0001898 | 3300046810 | Bacteria | 13688 |
| 230 | Ga0495687_093811 | 3300047443 | Bacteria | 1142 |
| 231 | Ga0495687_093818 | 3300047443 | Bacteria | 1142 |
| 232 | Ga0495673_0087121 | 3300047469 | Bacteria | 1282 |
| 233 | Ga0495686_0011708 | 3300047472 | Bacteria | 6177 |
| 234 | Ga0495686_0148446 | 3300047472 | Bacteria | 1378 |
| 235 | Ga0495686_0229540 | 3300047472 | Bacteria | 1052 |
| 236 | Ga0495614_0015447 | 3300048089 | Bacteria | 3328 |
| 237 | Ga0495678_002338 | 3300049459 | Bacteria | 13039 |
| 238 | Ga0495682_0013224 | 3300049460 | Bacteria | 3146 |
| 239 | Ga0501034_0000098 | 3300049571 | Bacteria | 160770 |
| 240 | Ga0501036_0179198 | 3300049572 | Bacteria | 1784 |
| 241 | Ga0501038_0151805 | 3300049574 | Bacteria | 1888 |
| 242 | nmdc:mga0k408_17060_c1 | 3300050493 | Bacteria | 4038 |
| 243 | nmdc:mga0k408_217361_c1 | 3300050493 | Bacteria | 1141 |
| 244 | nmdc:mga0k408_26_c4 | 3300050493 | Bacteria | 51744 |
| 245 | Ga0500635_0000392 | 3300053080 | Bacteria | 13382 |
| 246 | Ga0500618_000021 | 3300053125 | Bacteria | 160813 |
| 247 | Ga0500616_0021660 | 3300053153 | Bacteria | 3600 |
| 248 | Ga0500622_0017198 | 3300053156 | Bacteria | 3851 |
| 249 | Ga0500624_000168 | 3300053157 | Bacteria | 26458 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005458 | Ga0070681_10474763 | Ga0070681_104747631 | 172 |
| 2 | 3300013307 | Ga0157372_10508796 | Ga0157372_105087962 | 176 |
| 3 | 3300042876 | Ga0451577_0015793 | Ga0451577_0015793_3691_4314 | 184 |
| 4 | 3300044673 | Ga0453683_0000004 | Ga0453683_0000004_607754_608377 | 184 |
| 5 | 3300044712 | Ga0453684_0096037 | Ga0453684_0096037_1218_1841 | 184 |
| 6 | 3300045051 | Ga0451576_0000005 | Ga0451576_0000005_607754_608377 | 184 |
| 7 | iso_pu_bacteria | 2833640130 | 2833643072 | 186 |
| 8 | 3300031665 | Ga0316575_10154957 | Ga0316575_101549571 | 187 |
| 9 | 3300031727 | Ga0316576_10156700 | Ga0316576_101567002 | 187 |
| 10 | 3300035398 | Ga0316574_0000575 | Ga0316574_0000575_10908_11498 | 187 |
| 11 | 3300005333 | Ga0070677_10307349 | Ga0070677_103073491 | 188 |
| 12 | 3300005354 | Ga0070675_100774899 | Ga0070675_1007748991 | 188 |
| 13 | iso_pu_bacteria | 2911138879 | 2911139935 | 188 |
| 14 | iso_pu_bacteria | 8036736890 | 8036737580 | 188 |
| 15 | 3300032004 | Ga0307414_10070835 | Ga0307414_100708354 | 189 |
| 16 | iso_pu_bacteria | 2599185184 | 2599480706 | 189 |
| 17 | iso_pu_bacteria | 2852623160 | 2852625948 | 189 |
| 18 | iso_pu_bacteria | 2884933994 | 2884935583 | 189 |
| 19 | iso_pu_bacteria | 2928147474 | 2928150372 | 189 |
| 20 | 3300003320 | rootH2_10157637 | rootH2_101576371 | 190 |
| 21 | 3300003323 | rootH1_10372142 | rootH1_103721422 | 190 |
| 22 | 3300025261 | Ga0209233_1026836 | Ga0209233_10268362 | 190 |
| 23 | 3300031911 | Ga0307412_10823058 | Ga0307412_108230582 | 190 |
| 24 | 3300032004 | Ga0307414_10005227 | Ga0307414_100052273 | 190 |
| 25 | 3300036647 | Ga0316582_0052575 | Ga0316582_0052575_1439_2035 | 190 |
| 26 | 3300037588 | Ga0316581_0013982 | Ga0316581_0013982_572_1168 | 190 |
| 27 | 3300046660 | Ga0495625_0542349 | Ga0495625_0542349_108_683 | 190 |
| 28 | iso_pu_bacteria | 2919437846 | 2919439873 | 190 |
| 29 | iso_pu_bacteria | 2928078545 | 2928081599 | 190 |
| 30 | iso_pu_bacteria | 2932082852 | 2932085197 | 190 |
| 31 | 3300002067 | JGI24735J21928_10042150 | JGI24735J21928_100421502 | 191 |
| 32 | 3300002737 | JGI25162J39368_1001222 | JGI25162J39368_10012228 | 191 |
| 33 | 3300002772 | JGI25164J39214_1000686 | JGI25164J39214_100068613 | 191 |
| 34 | 3300003214 | JGI25165J46597_1000937 | JGI25165J46597_10009377 | 191 |
| 35 | 3300003320 | rootH2_10092263 | rootH2_100922631 | 191 |
| 36 | 3300003323 | rootH1_10032009 | rootH1_100320094 | 191 |
| 37 | 3300005288 | Ga0065714_10215123 | Ga0065714_102151232 | 191 |
| 38 | 3300005356 | Ga0070674_100202127 | Ga0070674_1002021272 | 191 |
| 39 | 3300005366 | Ga0070659_100002505 | Ga0070659_1000025055 | 191 |
| 40 | 3300005456 | Ga0070678_100561557 | Ga0070678_1005615572 | 191 |
| 41 | 3300005530 | Ga0070679_100020182 | Ga0070679_1000201822 | 191 |
| 42 | 3300005530 | Ga0070679_100266389 | Ga0070679_1002663891 | 191 |
| 43 | 3300005548 | Ga0070665_100683475 | Ga0070665_1006834752 | 191 |
| 44 | 3300005577 | Ga0068857_100023240 | Ga0068857_1000232403 | 191 |
| 45 | 3300005614 | Ga0068856_100041952 | Ga0068856_1000419523 | 191 |
| 46 | 3300005616 | Ga0068852_100081077 | Ga0068852_1000810772 | 191 |
| 47 | 3300005618 | Ga0068864_100789975 | Ga0068864_1007899751 | 191 |
| 48 | 3300005842 | Ga0068858_100065168 | Ga0068858_1000651682 | 191 |
| 49 | 3300006195 | Ga0075366_10000026 | Ga0075366_1000002647 | 191 |
| 50 | 3300009093 | Ga0105240_10053510 | Ga0105240_100535104 | 191 |
| 51 | 3300009093 | Ga0105240_10110774 | Ga0105240_101107742 | 191 |
| 52 | 3300009093 | Ga0105240_10353426 | Ga0105240_103534262 | 191 |
| 53 | 3300009147 | Ga0114129_11170666 | Ga0114129_111706661 | 191 |
| 54 | 3300009174 | Ga0105241_10537924 | Ga0105241_105379241 | 191 |
| 55 | 3300009545 | Ga0105237_10002006 | Ga0105237_1000200623 | 191 |
| 56 | 3300009545 | Ga0105237_10533318 | Ga0105237_105333182 | 191 |
| 57 | 3300009551 | Ga0105238_10057690 | Ga0105238_100576903 | 191 |
| 58 | 3300010375 | Ga0105239_10000045 | Ga0105239_1000004598 | 191 |
| 59 | 3300010375 | Ga0105239_10016398 | Ga0105239_100163986 | 191 |
| 60 | 3300013100 | Ga0157373_10001194 | Ga0157373_100011944 | 191 |
| 61 | 3300013102 | Ga0157371_10000571 | Ga0157371_100005713 | 191 |
| 62 | 3300013105 | Ga0157369_10484246 | Ga0157369_104842462 | 191 |
| 63 | 3300013297 | Ga0157378_10034996 | Ga0157378_100349962 | 191 |
| 64 | 3300013297 | Ga0157378_11837683 | Ga0157378_118376831 | 191 |
| 65 | 3300013306 | Ga0163162_10001672 | Ga0163162_1000167212 | 191 |
| 66 | 3300013307 | Ga0157372_10001739 | Ga0157372_1000173915 | 191 |
| 67 | 3300021361 | Ga0213872_10172327 | Ga0213872_101723272 | 191 |
| 68 | 3300021441 | Ga0213871_10000428 | Ga0213871_100004282 | 191 |
| 69 | 3300025231 | Ga0207427_100109 | Ga0207427_10010969 | 191 |
| 70 | 3300025233 | Ga0209437_100096 | Ga0209437_100096176 | 191 |
| 71 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029552 | 191 |
| 72 | 3300025261 | Ga0209233_1011719 | Ga0209233_10117192 | 191 |
| 73 | 3300025272 | Ga0209455_1008394 | Ga0209455_10083942 | 191 |
| 74 | 3300025904 | Ga0207647_10000080 | Ga0207647_1000008047 | 191 |
| 75 | 3300025904 | Ga0207647_10100698 | Ga0207647_101006982 | 191 |
| 76 | 3300025911 | Ga0207654_10287224 | Ga0207654_102872242 | 191 |
| 77 | 3300025913 | Ga0207695_10062538 | Ga0207695_100625383 | 191 |
| 78 | 3300025913 | Ga0207695_10132090 | Ga0207695_101320902 | 191 |
| 79 | 3300025913 | Ga0207695_10324414 | Ga0207695_103244142 | 191 |
| 80 | 3300025914 | Ga0207671_10001595 | Ga0207671_1000159515 | 191 |
| 81 | 3300025921 | Ga0207652_10857765 | Ga0207652_108577652 | 191 |
| 82 | 3300025924 | Ga0207694_10062003 | Ga0207694_100620032 | 191 |
| 83 | 3300025937 | Ga0207669_10201516 | Ga0207669_102015161 | 191 |
| 84 | 3300026078 | Ga0207702_10030047 | Ga0207702_100300473 | 191 |
| 85 | 3300026078 | Ga0207702_10297212 | Ga0207702_102972122 | 191 |
| 86 | 3300026121 | Ga0207683_10606104 | Ga0207683_106061042 | 191 |
| 87 | 3300026142 | Ga0207698_10063300 | Ga0207698_100633001 | 191 |
| 88 | 3300028379 | Ga0268266_10833414 | Ga0268266_108334142 | 191 |
| 89 | 3300028786 | Ga0307517_10234451 | Ga0307517_102344511 | 191 |
| 90 | 3300028794 | Ga0307515_10000318 | Ga0307515_100003185 | 191 |
| 91 | 3300031507 | Ga0307509_10046347 | Ga0307509_100463472 | 191 |
| 92 | 3300031548 | Ga0307408_100000527 | Ga0307408_10000052710 | 191 |
| 93 | 3300033179 | Ga0307507_10000111 | Ga0307507_1000011176 | 191 |
| 94 | 3300035725 | Ga0373947_0463547 | Ga0373947_0463547_151_729 | 191 |
| 95 | 3300037418 | Ga0395900_0639906 | Ga0395900_0639906_373_951 | 191 |
| 96 | 3300038443 | Ga0395901_0213337 | Ga0395901_0213337_164_742 | 191 |
| 97 | 3300039062 | Ga0400483_219863 | Ga0400483_219863_60165_60788 | 191 |
| 98 | 3300039438 | Ga0436360_0638428 | Ga0436360_0638428_5240_5860 | 191 |
| 99 | 3300041511 | Ga0451855_1610876 | Ga0451855_1610876_59_640 | 191 |
| 100 | 3300044673 | Ga0453683_0007576 | Ga0453683_0007576_2753_3352 | 191 |
| 101 | 3300044712 | Ga0453684_0019690 | Ga0453684_0019690_6897_7517 | 191 |
| 102 | 3300044712 | Ga0453684_0062544 | Ga0453684_0062544_3584_4201 | 191 |
| 103 | 3300045051 | Ga0451576_0000253 | Ga0451576_0000253_10157_10756 | 191 |
| 104 | 3300046462 | Ga0495651_0332221 | Ga0495651_0332221_168_746 | 191 |
| 105 | 3300046492 | Ga0495585_0000785 | Ga0495585_0000785_15975_16553 | 191 |
| 106 | 3300046506 | Ga0495583_0040496 | Ga0495583_0040496_1229_1810 | 191 |
| 107 | 3300046507 | Ga0495606_0033601 | Ga0495606_0033601_817_1398 | 191 |
| 108 | 3300046513 | Ga0495616_0194745 | Ga0495616_0194745_240_818 | 191 |
| 109 | 3300046524 | Ga0495648_0013917 | Ga0495648_0013917_3177_3755 | 191 |
| 110 | 3300046529 | Ga0495652_0443098 | Ga0495652_0443098_319_897 | 191 |
| 111 | 3300046538 | Ga0495609_0002045 | Ga0495609_0002045_8549_9127 | 191 |
| 112 | 3300046616 | Ga0495668_0000011 | Ga0495668_0000011_407586_408164 | 191 |
| 113 | 3300046660 | Ga0495625_0001500 | Ga0495625_0001500_23552_24130 | 191 |
| 114 | 3300046660 | Ga0495625_0023665 | Ga0495625_0023665_858_1436 | 191 |
| 115 | 3300048089 | Ga0495614_0015447 | Ga0495614_0015447_2496_3074 | 191 |
| 116 | 3300049460 | Ga0495682_0013224 | Ga0495682_0013224_1475_2053 | 191 |
| 117 | 3300050493 | nmdc:mga0k408_26_c4 | nmdc:mga0k408_26_c4_44284_44937 | 191 |
| 118 | 3300053080 | Ga0500635_0000392 | Ga0500635_0000392_3025_3603 | 191 |
| 119 | 3300053157 | Ga0500624_000168 | Ga0500624_000168_81_659 | 191 |
| 120 | 3300002737 | JGI25162J39368_1000008 | JGI25162J39368_1000008148 | 192 |
| 121 | 3300005336 | Ga0070680_100634175 | Ga0070680_1006341752 | 192 |
| 122 | 3300005455 | Ga0070663_100011963 | Ga0070663_1000119634 | 192 |
| 123 | 3300005614 | Ga0068856_100000006 | Ga0068856_10000000695 | 192 |
| 124 | 3300006195 | Ga0075366_10282707 | Ga0075366_102827072 | 192 |
| 125 | 3300009174 | Ga0105241_10136328 | Ga0105241_101363282 | 192 |
| 126 | 3300009174 | Ga0105241_10183845 | Ga0105241_101838452 | 192 |
| 127 | 3300009545 | Ga0105237_10004787 | Ga0105237_100047877 | 192 |
| 128 | 3300010375 | Ga0105239_10000016 | Ga0105239_10000016112 | 192 |
| 129 | 3300010375 | Ga0105239_10033293 | Ga0105239_100332932 | 192 |
| 130 | 3300013102 | Ga0157371_10001025 | Ga0157371_1000102525 | 192 |
| 131 | 3300013104 | Ga0157370_10256201 | Ga0157370_102562011 | 192 |
| 132 | 3300013105 | Ga0157369_10002452 | Ga0157369_100024526 | 192 |
| 133 | 3300013307 | Ga0157372_10000077 | Ga0157372_1000007778 | 192 |
| 134 | 3300025233 | Ga0209437_100030 | Ga0209437_100030241 | 192 |
| 135 | 3300025914 | Ga0207671_10010947 | Ga0207671_100109474 | 192 |
| 136 | 3300025917 | Ga0207660_10603612 | Ga0207660_106036121 | 192 |
| 137 | 3300026067 | Ga0207678_10039081 | Ga0207678_100390812 | 192 |
| 138 | 3300026078 | Ga0207702_10000023 | Ga0207702_1000002379 | 192 |
| 139 | 3300028800 | Ga0265338_10044564 | Ga0265338_100445642 | 192 |
| 140 | 3300028800 | Ga0265338_10180661 | Ga0265338_101806612 | 192 |
| 141 | 3300032004 | Ga0307414_10404270 | Ga0307414_104042702 | 192 |
| 142 | 3300036712 | Ga0316584_0075628 | Ga0316584_0075628_22_687 | 192 |
| 143 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_29068_29649 | 192 |
| 144 | 3300037312 | Ga0395899_0000152 | Ga0395899_0000152_94837_95418 | 192 |
| 145 | 3300037418 | Ga0395900_0211427 | Ga0395900_0211427_992_1573 | 192 |
| 146 | 3300038443 | Ga0395901_0537426 | Ga0395901_0537426_109_690 | 192 |
| 147 | 3300042876 | Ga0451577_0000004 | Ga0451577_0000004_533128_533733 | 192 |
| 148 | 3300042876 | Ga0451577_0037718 | Ga0451577_0037718_2476_3060 | 192 |
| 149 | 3300044656 | Ga0466969_0141218 | Ga0466969_0141218_131_712 | 192 |
| 150 | 3300044684 | Ga0466966_0008903 | Ga0466966_0008903_3778_4359 | 192 |
| 151 | 3300044712 | Ga0453684_0000025 | Ga0453684_0000025_533156_533761 | 192 |
| 152 | 3300044712 | Ga0453684_0006764 | Ga0453684_0006764_2680_3264 | 192 |
| 153 | 3300045836 | Ga0466958_0283446 | Ga0466958_0283446_39_647 | 192 |
| 154 | 3300046460 | Ga0495638_0050836 | Ga0495638_0050836_489_1070 | 192 |
| 155 | 3300046471 | Ga0495650_0092345 | Ga0495650_0092345_67_651 | 192 |
| 156 | 3300046507 | Ga0495606_0003600 | Ga0495606_0003600_6921_7505 | 192 |
| 157 | 3300046507 | Ga0495606_0003924 | Ga0495606_0003924_11040_11621 | 192 |
| 158 | 3300046513 | Ga0495616_0001541 | Ga0495616_0001541_10782_11363 | 192 |
| 159 | 3300046616 | Ga0495668_0156282 | Ga0495668_0156282_148_738 | 192 |
| 160 | 3300046660 | Ga0495625_0049572 | Ga0495625_0049572_261_842 | 192 |
| 161 | 3300046691 | Ga0495670_0279165 | Ga0495670_0279165_233_823 | 192 |
| 162 | 3300046810 | Ga0495660_0001898 | Ga0495660_0001898_11147_11728 | 192 |
| 163 | 3300047472 | Ga0495686_0011708 | Ga0495686_0011708_378_962 | 192 |
| 164 | 3300049459 | Ga0495678_002338 | Ga0495678_002338_4041_4622 | 192 |
| 165 | 3300050493 | nmdc:mga0k408_217361_c1 | nmdc:mga0k408_217361_c1_365_946 | 192 |
| 166 | 3300053125 | Ga0500618_000021 | Ga0500618_000021_43190_43774 | 192 |
| 167 | 3300053153 | Ga0500616_0021660 | Ga0500616_0021660_2497_3081 | 192 |
| 168 | 3300001979 | JGI24740J21852_10022858 | JGI24740J21852_100228581 | 193 |
| 169 | 3300001990 | JGI24737J22298_10001296 | JGI24737J22298_100012961 | 193 |
| 170 | 3300002067 | JGI24735J21928_10000017 | JGI24735J21928_1000001763 | 193 |
| 171 | 3300003316 | rootH1_10087025 | rootH1_100870252 | 193 |
| 172 | 3300003316 | rootH1_10117319 | rootH1_101173192 | 193 |
| 173 | 3300003320 | rootH2_10209483 | rootH2_102094831 | 193 |
| 174 | 3300003322 | rootL2_10054585 | rootL2_100545852 | 193 |
| 175 | 3300005288 | Ga0065714_10019616 | Ga0065714_100196161 | 193 |
| 176 | 3300005288 | Ga0065714_10257942 | Ga0065714_102579422 | 193 |
| 177 | 3300005563 | Ga0068855_100066159 | Ga0068855_1000661593 | 193 |
| 178 | 3300005563 | Ga0068855_100084130 | Ga0068855_1000841304 | 193 |
| 179 | 3300005563 | Ga0068855_100974386 | Ga0068855_1009743862 | 193 |
| 180 | 3300005577 | Ga0068857_100051831 | Ga0068857_1000518313 | 193 |
| 181 | 3300005578 | Ga0068854_100020002 | Ga0068854_1000200023 | 193 |
| 182 | 3300006195 | Ga0075366_10003461 | Ga0075366_100034617 | 193 |
| 183 | 3300009093 | Ga0105240_10001259 | Ga0105240_1000125918 | 193 |
| 184 | 3300009174 | Ga0105241_10006368 | Ga0105241_100063682 | 193 |
| 185 | 3300009545 | Ga0105237_10011689 | Ga0105237_100116893 | 193 |
| 186 | 3300009545 | Ga0105237_10033449 | Ga0105237_100334493 | 193 |
| 187 | 3300009545 | Ga0105237_10074538 | Ga0105237_100745382 | 193 |
| 188 | 3300009545 | Ga0105237_10266421 | Ga0105237_102664212 | 193 |
| 189 | 3300009551 | Ga0105238_10259315 | Ga0105238_102593152 | 193 |
| 190 | 3300010375 | Ga0105239_10000955 | Ga0105239_1000095536 | 193 |
| 191 | 3300010375 | Ga0105239_10318841 | Ga0105239_103188411 | 193 |
| 192 | 3300010375 | Ga0105239_11632129 | Ga0105239_116321291 | 193 |
| 193 | 3300013102 | Ga0157371_10068883 | Ga0157371_100688832 | 193 |
| 194 | 3300013104 | Ga0157370_11240977 | Ga0157370_112409771 | 193 |
| 195 | 3300013105 | Ga0157369_10109159 | Ga0157369_101091594 | 193 |
| 196 | 3300013297 | Ga0157378_10001635 | Ga0157378_1000163518 | 193 |
| 197 | 3300013306 | Ga0163162_10001761 | Ga0163162_100017619 | 193 |
| 198 | 3300013307 | Ga0157372_10005470 | Ga0157372_100054707 | 193 |
| 199 | 3300013307 | Ga0157372_11967680 | Ga0157372_119676801 | 193 |
| 200 | 3300013308 | Ga0157375_10032705 | Ga0157375_100327052 | 193 |
| 201 | 3300025250 | Ga0209026_1001779 | Ga0209026_10017791 | 193 |
| 202 | 3300025911 | Ga0207654_10008230 | Ga0207654_100082303 | 193 |
| 203 | 3300025913 | Ga0207695_10000183 | Ga0207695_10000183141 | 193 |
| 204 | 3300025914 | Ga0207671_10000477 | Ga0207671_1000047730 | 193 |
| 205 | 3300025914 | Ga0207671_10021230 | Ga0207671_100212305 | 193 |
| 206 | 3300025914 | Ga0207671_10098241 | Ga0207671_100982412 | 193 |
| 207 | 3300025949 | Ga0207667_10031440 | Ga0207667_100314401 | 193 |
| 208 | 3300025949 | Ga0207667_10832494 | Ga0207667_108324942 | 193 |
| 209 | 3300025981 | Ga0207640_10064909 | Ga0207640_100649093 | 193 |
| 210 | 3300026116 | Ga0207674_10062939 | Ga0207674_100629394 | 193 |
| 211 | 3300028558 | Ga0265326_10061883 | Ga0265326_100618832 | 193 |
| 212 | 3300028794 | Ga0307515_10000133 | Ga0307515_1000013398 | 193 |
| 213 | 3300031240 | Ga0265320_10018351 | Ga0265320_100183512 | 193 |
| 214 | 3300031344 | Ga0265316_10116733 | Ga0265316_101167332 | 193 |
| 215 | 3300031649 | Ga0307514_10006049 | Ga0307514_1000604910 | 193 |
| 216 | 3300031712 | Ga0265342_10146730 | Ga0265342_101467302 | 193 |
| 217 | 3300031911 | Ga0307412_10241112 | Ga0307412_102411122 | 193 |
| 218 | 3300035115 | Ga0373941_0032627 | Ga0373941_0032627_939_1526 | 193 |
| 219 | 3300037418 | Ga0395900_0001123 | Ga0395900_0001123_20354_20944 | 193 |
| 220 | 3300042876 | Ga0451577_0051137 | Ga0451577_0051137_1628_2245 | 193 |
| 221 | 3300042876 | Ga0451577_0172773 | Ga0451577_0172773_1143_1763 | 193 |
| 222 | 3300042876 | Ga0451577_0196953 | Ga0451577_0196953_235_849 | 193 |
| 223 | 3300042876 | Ga0451577_0839673 | Ga0451577_0839673_107_730 | 193 |
| 224 | 3300044673 | Ga0453683_0608530 | Ga0453683_0608530_48_647 | 193 |
| 225 | 3300044712 | Ga0453684_0001027 | Ga0453684_0001027_70737_71354 | 193 |
| 226 | 3300044712 | Ga0453684_0020661 | Ga0453684_0020661_278_892 | 193 |
| 227 | 3300044712 | Ga0453684_0058220 | Ga0453684_0058220_1389_1988 | 193 |
| 228 | 3300044712 | Ga0453684_0064424 | Ga0453684_0064424_3797_4417 | 193 |
| 229 | 3300045051 | Ga0451576_0006198 | Ga0451576_0006198_7710_8330 | 193 |
| 230 | 3300045051 | Ga0451576_0101979 | Ga0451576_0101979_1764_2363 | 193 |
| 231 | 3300046460 | Ga0495638_0025314 | Ga0495638_0025314_441_1025 | 193 |
| 232 | 3300046471 | Ga0495650_0000050 | Ga0495650_0000050_201271_201855 | 193 |
| 233 | 3300046492 | Ga0495585_0000560 | Ga0495585_0000560_10305_10889 | 193 |
| 234 | 3300046506 | Ga0495583_0007344 | Ga0495583_0007344_785_1369 | 193 |
| 235 | 3300046507 | Ga0495606_0000581 | Ga0495606_0000581_51336_51920 | 193 |
| 236 | 3300046507 | Ga0495606_0084153 | Ga0495606_0084153_600_1187 | 193 |
| 237 | 3300046512 | Ga0495610_0002203 | Ga0495610_0002203_5816_6400 | 193 |
| 238 | 3300046513 | Ga0495616_0000296 | Ga0495616_0000296_18723_19307 | 193 |
| 239 | 3300046520 | Ga0495637_0032721 | Ga0495637_0032721_1669_2253 | 193 |
| 240 | 3300046524 | Ga0495648_0035819 | Ga0495648_0035819_1858_2442 | 193 |
| 241 | 3300046558 | Ga0495633_0007257 | Ga0495633_0007257_955_1539 | 193 |
| 242 | 3300046648 | Ga0495611_0043818 | Ga0495611_0043818_165_752 | 193 |
| 243 | 3300046660 | Ga0495625_0000077 | Ga0495625_0000077_66855_67439 | 193 |
| 244 | 3300046660 | Ga0495625_0004941 | Ga0495625_0004941_6741_7328 | 193 |
| 245 | 3300046660 | Ga0495625_0052001 | Ga0495625_0052001_2078_2680 | 193 |
| 246 | 3300046665 | Ga0495661_0001682 | Ga0495661_0001682_7440_8030 | 193 |
| 247 | 3300046665 | Ga0495661_0002867 | Ga0495661_0002867_8157_8741 | 193 |
| 248 | 3300046694 | Ga0495649_0000011 | Ga0495649_0000011_159883_160467 | 193 |
| 249 | 3300047443 | Ga0495687_093811 | Ga0495687_093811_241_828 | 193 |
| 250 | 3300047443 | Ga0495687_093818 | Ga0495687_093818_241_828 | 193 |
| 251 | 3300047469 | Ga0495673_0087121 | Ga0495673_0087121_194_778 | 193 |
| 252 | 3300047472 | Ga0495686_0148446 | Ga0495686_0148446_743_1327 | 193 |
| 253 | 3300047472 | Ga0495686_0229540 | Ga0495686_0229540_382_1014 | 193 |
| 254 | 3300049571 | Ga0501034_0000098 | Ga0501034_0000098_35014_35655 | 193 |
| 255 | 3300049572 | Ga0501036_0179198 | Ga0501036_0179198_230_871 | 193 |
| 256 | 3300049574 | Ga0501038_0151805 | Ga0501038_0151805_52_693 | 193 |
| 257 | 3300050493 | nmdc:mga0k408_17060_c1 | nmdc:mga0k408_17060_c1_942_1523 | 193 |
| 258 | 3300053156 | Ga0500622_0017198 | Ga0500622_0017198_1621_2250 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q16-assembly1.cif.gz_B | structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp | 0.9384 | 3 | 188 |
| 3s86-assembly1.cif.gz_D | crystal structure of tm0159 with bound imp | 0.9368 | 1 | 190 |
| 2dvn-assembly1.cif.gz_A | structure of ph1917 protein with the complex of imp from pyrococcus horikoshii | 0.9278 | 1 | 189 |
| 3tqu-assembly2.cif.gz_D | structure of a ham1 protein from coxiella burnetii | 0.9225 | 1 | 190 |
| 3s86-assembly1.cif.gz_D | crystal structure of tm0159 with bound imp | 0.9177 | 1 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZC5_1_195_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9468 | 2 | 189 | 3.90.950.10 |
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9425 | 1 | 190 | 3.90.950.10 |
| 3s86D00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9368 | 1 | 190 | 3.90.950.10 |
| af_Q9UU89_2_186_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9325 | 2 | 190 | 3.90.950.10 |
| af_P9WMR7_2_201_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9301 | 1 | 190 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A426H7E2-F1-model_v4 | deleted | 0.9975 | 39 | 190 |
|
| AF-A0A1M6UMJ1-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.995 | 1 | 190 |
GO:0000166
GO:0005886 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A838ZR09-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9925 | 1 | 190 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0046872 GO:0047429 |
| AF-A0A2X2JAL2-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.992 | 1 | 190 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A2T4HLC6-F1-model_v4 | deleted | 0.992 | 1 | 191 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar