F368028

General Info

Members Datasets Scaffolds Average Seq Length
258 145 249 196

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001259|Ga0105240_1000125918
Length 229
Sequence LGADEEFLTSPCTLQGVGLNILMFKHSLYFNINFKMQQLVFATNNAHKLEEVAAKIAGKIKLLSLDDIGCHDDIEETGTTFNENASIKSHFIYHKYQLNCFGDDSGLEIDALNGEPGVYSSRYAGEYGNHAANMDRVLEKLNGATNRSARFRTVISLIWEGKEHFFEGTVEGTIRHERSGTAGFGYDPIFEPMGYNITFAEMSMEEKNSISHRAKAVEKLVEFLAPFTS

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
144 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
145 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 0
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 0
Rhizoplane 0.39
Rhizosphere 83.72
Stem 0
Stem Tuber 0
Unclassified 7.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022858 3300001979 Bacteria 2145
2 JGI24737J22298_10001296 3300001990 Bacteria 8857
3 JGI24735J21928_10000017 3300002067 Bacteria 114440
4 JGI24735J21928_10042150 3300002067 Bacteria 1329
5 JGI25162J39368_1000008 3300002737 Bacteria 397212
6 JGI25162J39368_1001222 3300002737 Bacteria 14893
7 JGI25164J39214_1000686 3300002772 Bacteria 13360
8 JGI25165J46597_1000937 3300003214 Bacteria 19984
9 rootH1_10087025 3300003316 Bacteria 3693
10 rootH1_10087025 3300003323 Bacteria 14602
11 rootH1_10117319 3300003316 Bacteria 3424
12 rootH2_10092263 3300003320 Bacteria 3195
13 rootH2_10157637 3300003320 Unclassified 1358
14 rootH2_10209483 3300003320 Bacteria 1267
15 rootL2_10054585 3300003322 Bacteria 1565
16 rootH1_10032009 3300003323 Bacteria 20379
17 rootH1_10372142 3300003323 Bacteria 1252
18 Ga0065714_10019616 3300005288 Bacteria 1877
19 Ga0065714_10215123 3300005288 Bacteria 856
20 Ga0065714_10257942 3300005288 Unclassified 762
21 Ga0070677_10307349 3300005333 Unclassified 808
22 Ga0070680_100634175 3300005336 Unclassified 918
23 Ga0070675_100774899 3300005354 Unclassified 876
24 Ga0070674_100202127 3300005356 Unclassified 1535
25 Ga0070659_100002505 3300005366 Bacteria 13046
26 Ga0070663_100011963 3300005455 Bacteria 5474
27 Ga0070678_100561557 3300005456 Bacteria 1014
28 Ga0070681_10474763 3300005458 Bacteria 1163
29 Ga0070679_100020182 3300005530 Bacteria 6494
30 Ga0070679_100266389 3300005530 Unclassified 1668
31 Ga0070665_100683475 3300005548 Bacteria 1039
32 Ga0068855_100066159 3300005563 Bacteria 4214
33 Ga0068855_100084130 3300005563 Bacteria 3684
34 Ga0068855_100974386 3300005563 Unclassified 892
35 Ga0068857_100023240 3300005577 Bacteria 5456
36 Ga0068857_100051831 3300005577 Bacteria 3641
37 Ga0068854_100020002 3300005578 Bacteria 4520
38 Ga0068856_100000006 3300005614 Bacteria 223827
39 Ga0068856_100041952 3300005614 Bacteria 4499
40 Ga0068852_100081077 3300005616 Bacteria 2879
41 Ga0068864_100789975 3300005618 Bacteria 932
42 Ga0068858_100065168 3300005842 Bacteria 3371
43 Ga0075366_10000026 3300006195 Bacteria 51752
44 Ga0075366_10003461 3300006195 Bacteria 8333
45 Ga0075366_10282707 3300006195 Bacteria 1014
46 Ga0105240_10001259 3300009093 Bacteria 43960
47 Ga0105240_10053510 3300009093 Bacteria 5067
48 Ga0105240_10110774 3300009093 Bacteria 3322
49 Ga0105240_10353426 3300009093 Bacteria 1667
50 Ga0114129_11170666 3300009147 Bacteria 959
51 Ga0105241_10006368 3300009174 Bacteria 8695
52 Ga0105241_10136328 3300009174 Bacteria 1993
53 Ga0105241_10183845 3300009174 Bacteria 1736
54 Ga0105241_10537924 3300009174 Unclassified 1047
55 Ga0105237_10002006 3300009545 Bacteria 25906
56 Ga0105237_10004787 3300009545 Bacteria 15556
57 Ga0105237_10011689 3300009545 Bacteria 9287
58 Ga0105237_10033449 3300009545 Bacteria 5207
59 Ga0105237_10074538 3300009545 Bacteria 3386
60 Ga0105237_10266421 3300009545 Bacteria 1716
61 Ga0105237_10533318 3300009545 Unclassified 1180
62 Ga0105238_10057690 3300009551 Bacteria 3892
63 Ga0105238_10259315 3300009551 Bacteria 1718
64 Ga0105239_10000016 3300010375 Bacteria 293142
65 Ga0105239_10000045 3300010375 Bacteria 186314
66 Ga0105239_10000955 3300010375 Bacteria 40720
67 Ga0105239_10016398 3300010375 Bacteria 8194
68 Ga0105239_10033293 3300010375 Bacteria 5660
69 Ga0105239_10318841 3300010375 Bacteria 1752
70 Ga0105239_11632129 3300010375 Bacteria 746
71 Ga0157373_10001194 3300013100 Bacteria 19864
72 Ga0157371_10000571 3300013102 Bacteria 43698
73 Ga0157371_10001025 3300013102 Bacteria 30579
74 Ga0157371_10068883 3300013102 Bacteria 2505
75 Ga0157370_10256201 3300013104 Bacteria 1618
76 Ga0157370_11240977 3300013104 Bacteria 672
77 Ga0157369_10002452 3300013105 Bacteria 22259
78 Ga0157369_10109159 3300013105 Bacteria 2942
79 Ga0157369_10484246 3300013105 Bacteria 1280
80 Ga0157378_10001635 3300013297 Bacteria 20269
81 Ga0157378_10034996 3300013297 Unclassified 4441
82 Ga0157378_11837683 3300013297 Unclassified 654
83 Ga0163162_10001672 3300013306 Bacteria 20806
84 Ga0163162_10001761 3300013306 Bacteria 20290
85 Ga0157372_10000077 3300013307 Bacteria 102192
86 Ga0157372_10001739 3300013307 Bacteria 23620
87 Ga0157372_10005470 3300013307 Bacteria 13496
88 Ga0157372_10508796 3300013307 Bacteria 1404
89 Ga0157372_11967680 3300013307 Unclassified 672
90 Ga0157375_10032705 3300013308 Bacteria 4935
91 Ga0213872_10172327 3300021361 Bacteria 937
92 Ga0213871_10000428 3300021441 Bacteria 5634
93 Ga0207427_100109 3300025231 Bacteria 116061
94 Ga0209437_100030 3300025233 Bacteria 532466
95 Ga0209437_100096 3300025233 Bacteria 233558
96 Ga0209026_1001779 3300025250 Bacteria 8908
97 Ga0209233_1000029 3300025261 Bacteria 641642
98 Ga0209233_1011719 3300025261 Bacteria 2575
99 Ga0209233_1026836 3300025261 Bacteria 1402
100 Ga0209455_1008394 3300025272 Bacteria 2811
101 Ga0207647_10000080 3300025904 Bacteria 71854
102 Ga0207647_10100698 3300025904 Unclassified 1715
103 Ga0207654_10008230 3300025911 Bacteria 5264
104 Ga0207654_10287224 3300025911 Unclassified 1114
105 Ga0207695_10000183 3300025913 Bacteria 181350
106 Ga0207695_10062538 3300025913 Bacteria 3842
107 Ga0207695_10132090 3300025913 Bacteria 2453
108 Ga0207695_10324414 3300025913 Bacteria 1429
109 Ga0207671_10000477 3300025914 Bacteria 54330
110 Ga0207671_10001595 3300025914 Bacteria 25763
111 Ga0207671_10010947 3300025914 Bacteria 7431
112 Ga0207671_10021230 3300025914 Bacteria 4931
113 Ga0207671_10098241 3300025914 Unclassified 2214
114 Ga0207660_10603612 3300025917 Unclassified 894
115 Ga0207652_10857765 3300025921 Unclassified 804
116 Ga0207694_10062003 3300025924 Bacteria 2911
117 Ga0207669_10201516 3300025937 Unclassified 1445
118 Ga0207667_10031440 3300025949 Bacteria 5731
119 Ga0207667_10832494 3300025949 Bacteria 918
120 Ga0207640_10064909 3300025981 Bacteria 2434
121 Ga0207678_10039081 3300026067 Unclassified 4119
122 Ga0207702_10000023 3300026078 Bacteria 189234
123 Ga0207702_10030047 3300026078 Bacteria 4527
124 Ga0207702_10297212 3300026078 Bacteria 1531
125 Ga0207674_10062939 3300026116 Bacteria 3746
126 Ga0207683_10606104 3300026121 Bacteria 1014
127 Ga0207698_10063300 3300026142 Bacteria 2894
128 Ga0268266_10833414 3300028379 Bacteria 891
129 Ga0265326_10061883 3300028558 Bacteria 1059
130 Ga0307517_10234451 3300028786 Bacteria 1097
131 Ga0307515_10000133 3300028794 Bacteria 176091
132 Ga0307515_10000318 3300028794 Bacteria 118891
133 Ga0265338_10044564 3300028800 Bacteria 4094
134 Ga0265338_10180661 3300028800 Bacteria 1609
135 Ga0265320_10018351 3300031240 Bacteria 3855
136 Ga0265316_10116733 3300031344 Bacteria 2017
137 Ga0307509_10046347 3300031507 Bacteria 4681
138 Ga0307408_100000527 3300031548 Bacteria 33024
139 Ga0307514_10006049 3300031649 Bacteria 10638
140 Ga0316575_10154957 3300031665 Bacteria 946
141 Ga0265342_10146730 3300031712 Bacteria 1313
142 Ga0316576_10156700 3300031727 Bacteria 1717
143 Ga0307412_10241112 3300031911 Bacteria 1398
144 Ga0307412_10823058 3300031911 Unclassified 808
145 Ga0307414_10005227 3300032004 Bacteria 7132
146 Ga0307414_10070835 3300032004 Bacteria 2512
147 Ga0307414_10404270 3300032004 Bacteria 1187
148 Ga0307507_10000111 3300033179 Bacteria 134722
149 Ga0373941_0032627 3300035115 Bacteria 1560
150 Ga0316574_0000575 3300035398 Bacteria 15159
151 Ga0373947_0463547 3300035725 Bacteria 859
152 Ga0316582_0052575 3300036647 Bacteria 2589
153 Ga0316584_0075628 3300036712 Bacteria 2524
154 Ga0395899_0000017 3300037312 Bacteria 440179
155 Ga0395899_0000152 3300037312 Bacteria 105233
156 Ga0395900_0001123 3300037418 Bacteria 33875
157 Ga0395900_0211427 3300037418 Unclassified 1958
158 Ga0395900_0639906 3300037418 Bacteria 1001
159 Ga0316581_0013982 3300037588 Bacteria 2282
160 Ga0395901_0213337 3300038443 Bacteria 2020
161 Ga0395901_0537426 3300038443 Unclassified 1186
162 Ga0400483_219863 3300039062 Bacteria 173210
163 Ga0436360_0638428 3300039438 Bacteria 11768
164 Ga0451855_1610876 3300041511 Bacteria 795
165 Ga0451577_0000004 3300042876 Bacteria 816743
166 Ga0451577_0015793 3300042876 Bacteria 7008
167 Ga0451577_0037718 3300042876 Unclassified 4350
168 Ga0451577_0051137 3300042876 Bacteria 3689
169 Ga0451577_0172773 3300042876 Bacteria 1947
170 Ga0451577_0196953 3300042876 Bacteria 1818
171 Ga0451577_0839673 3300042876 Bacteria 829
172 Ga0466969_0141218 3300044656 Bacteria 1113
173 Ga0453683_0000004 3300044673 Bacteria 759456
174 Ga0453683_0007576 3300044673 Bacteria 7355
175 Ga0453683_0608530 3300044673 Bacteria 713
176 Ga0466966_0008903 3300044684 Bacteria 6649
177 Ga0453684_0000025 3300044712 Bacteria 818638
178 Ga0453684_0001027 3300044712 Bacteria 89253
179 Ga0453684_0006764 3300044712 Bacteria 21578
180 Ga0453684_0019690 3300044712 Bacteria 10248
181 Ga0453684_0020661 3300044712 Bacteria 9909
182 Ga0453684_0058220 3300044712 Bacteria 4992
183 Ga0453684_0062544 3300044712 Bacteria 4767
184 Ga0453684_0064424 3300044712 Bacteria 4682
185 Ga0453684_0096037 3300044712 Bacteria 3642
186 Ga0451576_0000005 3300045051 Bacteria 1294643
187 Ga0451576_0000253 3300045051 Bacteria 131961
188 Ga0451576_0006198 3300045051 Bacteria 14724
189 Ga0451576_0101979 3300045051 Bacteria 2985
190 Ga0466958_0283446 3300045836 Bacteria 1062
191 Ga0495638_0025314 3300046460 Bacteria 3860
192 Ga0495638_0050836 3300046460 Bacteria 2588
193 Ga0495651_0332221 3300046462 Bacteria 1010
194 Ga0495650_0000050 3300046471 Bacteria 318894
195 Ga0495650_0092345 3300046471 Bacteria 1149
196 Ga0495585_0000560 3300046492 Bacteria 35150
197 Ga0495585_0000785 3300046492 Bacteria 28010
198 Ga0495583_0007344 3300046506 Bacteria 6945
199 Ga0495583_0040496 3300046506 Bacteria 2189
200 Ga0495606_0000581 3300046507 Bacteria 58129
201 Ga0495606_0003600 3300046507 Bacteria 16307
202 Ga0495606_0003924 3300046507 Bacteria 15309
203 Ga0495606_0033601 3300046507 Bacteria 3536
204 Ga0495606_0084153 3300046507 Bacteria 1971
205 Ga0495610_0002203 3300046512 Bacteria 16495
206 Ga0495616_0000296 3300046513 Bacteria 40157
207 Ga0495616_0001541 3300046513 Bacteria 15901
208 Ga0495616_0194745 3300046513 Bacteria 894
209 Ga0495637_0032721 3300046520 Bacteria 2289
210 Ga0495648_0013917 3300046524 Bacteria 5922
211 Ga0495648_0035819 3300046524 Bacteria 3212
212 Ga0495652_0443098 3300046529 Unclassified 911
213 Ga0495609_0002045 3300046538 Bacteria 12713
214 Ga0495633_0007257 3300046558 Bacteria 6412
215 Ga0495668_0000011 3300046616 Bacteria 472186
216 Ga0495668_0156282 3300046616 Unclassified 1249
217 Ga0495611_0043818 3300046648 Bacteria 2001
218 Ga0495625_0000077 3300046660 Bacteria 163166
219 Ga0495625_0001500 3300046660 Bacteria 28046
220 Ga0495625_0004941 3300046660 Bacteria 12391
221 Ga0495625_0023665 3300046660 Bacteria 4688
222 Ga0495625_0049572 3300046660 Bacteria 3017
223 Ga0495625_0052001 3300046660 Bacteria 2935
224 Ga0495625_0542349 3300046660 Bacteria 705
225 Ga0495661_0001682 3300046665 Bacteria 18011
226 Ga0495661_0002867 3300046665 Bacteria 13039
227 Ga0495670_0279165 3300046691 Unclassified 893
228 Ga0495649_0000011 3300046694 Bacteria 416695
229 Ga0495660_0001898 3300046810 Bacteria 13688
230 Ga0495687_093811 3300047443 Bacteria 1142
231 Ga0495687_093818 3300047443 Bacteria 1142
232 Ga0495673_0087121 3300047469 Bacteria 1282
233 Ga0495686_0011708 3300047472 Bacteria 6177
234 Ga0495686_0148446 3300047472 Bacteria 1378
235 Ga0495686_0229540 3300047472 Bacteria 1052
236 Ga0495614_0015447 3300048089 Bacteria 3328
237 Ga0495678_002338 3300049459 Bacteria 13039
238 Ga0495682_0013224 3300049460 Bacteria 3146
239 Ga0501034_0000098 3300049571 Bacteria 160770
240 Ga0501036_0179198 3300049572 Bacteria 1784
241 Ga0501038_0151805 3300049574 Bacteria 1888
242 nmdc:mga0k408_17060_c1 3300050493 Bacteria 4038
243 nmdc:mga0k408_217361_c1 3300050493 Bacteria 1141
244 nmdc:mga0k408_26_c4 3300050493 Bacteria 51744
245 Ga0500635_0000392 3300053080 Bacteria 13382
246 Ga0500618_000021 3300053125 Bacteria 160813
247 Ga0500616_0021660 3300053153 Bacteria 3600
248 Ga0500622_0017198 3300053156 Bacteria 3851
249 Ga0500624_000168 3300053157 Bacteria 26458

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10474763 Ga0070681_104747631 172
2 3300013307 Ga0157372_10508796 Ga0157372_105087962 176
3 3300042876 Ga0451577_0015793 Ga0451577_0015793_3691_4314 184
4 3300044673 Ga0453683_0000004 Ga0453683_0000004_607754_608377 184
5 3300044712 Ga0453684_0096037 Ga0453684_0096037_1218_1841 184
6 3300045051 Ga0451576_0000005 Ga0451576_0000005_607754_608377 184
7 iso_pu_bacteria 2833640130 2833643072 186
8 3300031665 Ga0316575_10154957 Ga0316575_101549571 187
9 3300031727 Ga0316576_10156700 Ga0316576_101567002 187
10 3300035398 Ga0316574_0000575 Ga0316574_0000575_10908_11498 187
11 3300005333 Ga0070677_10307349 Ga0070677_103073491 188
12 3300005354 Ga0070675_100774899 Ga0070675_1007748991 188
13 iso_pu_bacteria 2911138879 2911139935 188
14 iso_pu_bacteria 8036736890 8036737580 188
15 3300032004 Ga0307414_10070835 Ga0307414_100708354 189
16 iso_pu_bacteria 2599185184 2599480706 189
17 iso_pu_bacteria 2852623160 2852625948 189
18 iso_pu_bacteria 2884933994 2884935583 189
19 iso_pu_bacteria 2928147474 2928150372 189
20 3300003320 rootH2_10157637 rootH2_101576371 190
21 3300003323 rootH1_10372142 rootH1_103721422 190
22 3300025261 Ga0209233_1026836 Ga0209233_10268362 190
23 3300031911 Ga0307412_10823058 Ga0307412_108230582 190
24 3300032004 Ga0307414_10005227 Ga0307414_100052273 190
25 3300036647 Ga0316582_0052575 Ga0316582_0052575_1439_2035 190
26 3300037588 Ga0316581_0013982 Ga0316581_0013982_572_1168 190
27 3300046660 Ga0495625_0542349 Ga0495625_0542349_108_683 190
28 iso_pu_bacteria 2919437846 2919439873 190
29 iso_pu_bacteria 2928078545 2928081599 190
30 iso_pu_bacteria 2932082852 2932085197 190
31 3300002067 JGI24735J21928_10042150 JGI24735J21928_100421502 191
32 3300002737 JGI25162J39368_1001222 JGI25162J39368_10012228 191
33 3300002772 JGI25164J39214_1000686 JGI25164J39214_100068613 191
34 3300003214 JGI25165J46597_1000937 JGI25165J46597_10009377 191
35 3300003320 rootH2_10092263 rootH2_100922631 191
36 3300003323 rootH1_10032009 rootH1_100320094 191
37 3300005288 Ga0065714_10215123 Ga0065714_102151232 191
38 3300005356 Ga0070674_100202127 Ga0070674_1002021272 191
39 3300005366 Ga0070659_100002505 Ga0070659_1000025055 191
40 3300005456 Ga0070678_100561557 Ga0070678_1005615572 191
41 3300005530 Ga0070679_100020182 Ga0070679_1000201822 191
42 3300005530 Ga0070679_100266389 Ga0070679_1002663891 191
43 3300005548 Ga0070665_100683475 Ga0070665_1006834752 191
44 3300005577 Ga0068857_100023240 Ga0068857_1000232403 191
45 3300005614 Ga0068856_100041952 Ga0068856_1000419523 191
46 3300005616 Ga0068852_100081077 Ga0068852_1000810772 191
47 3300005618 Ga0068864_100789975 Ga0068864_1007899751 191
48 3300005842 Ga0068858_100065168 Ga0068858_1000651682 191
49 3300006195 Ga0075366_10000026 Ga0075366_1000002647 191
50 3300009093 Ga0105240_10053510 Ga0105240_100535104 191
51 3300009093 Ga0105240_10110774 Ga0105240_101107742 191
52 3300009093 Ga0105240_10353426 Ga0105240_103534262 191
53 3300009147 Ga0114129_11170666 Ga0114129_111706661 191
54 3300009174 Ga0105241_10537924 Ga0105241_105379241 191
55 3300009545 Ga0105237_10002006 Ga0105237_1000200623 191
56 3300009545 Ga0105237_10533318 Ga0105237_105333182 191
57 3300009551 Ga0105238_10057690 Ga0105238_100576903 191
58 3300010375 Ga0105239_10000045 Ga0105239_1000004598 191
59 3300010375 Ga0105239_10016398 Ga0105239_100163986 191
60 3300013100 Ga0157373_10001194 Ga0157373_100011944 191
61 3300013102 Ga0157371_10000571 Ga0157371_100005713 191
62 3300013105 Ga0157369_10484246 Ga0157369_104842462 191
63 3300013297 Ga0157378_10034996 Ga0157378_100349962 191
64 3300013297 Ga0157378_11837683 Ga0157378_118376831 191
65 3300013306 Ga0163162_10001672 Ga0163162_1000167212 191
66 3300013307 Ga0157372_10001739 Ga0157372_1000173915 191
67 3300021361 Ga0213872_10172327 Ga0213872_101723272 191
68 3300021441 Ga0213871_10000428 Ga0213871_100004282 191
69 3300025231 Ga0207427_100109 Ga0207427_10010969 191
70 3300025233 Ga0209437_100096 Ga0209437_100096176 191
71 3300025261 Ga0209233_1000029 Ga0209233_1000029552 191
72 3300025261 Ga0209233_1011719 Ga0209233_10117192 191
73 3300025272 Ga0209455_1008394 Ga0209455_10083942 191
74 3300025904 Ga0207647_10000080 Ga0207647_1000008047 191
75 3300025904 Ga0207647_10100698 Ga0207647_101006982 191
76 3300025911 Ga0207654_10287224 Ga0207654_102872242 191
77 3300025913 Ga0207695_10062538 Ga0207695_100625383 191
78 3300025913 Ga0207695_10132090 Ga0207695_101320902 191
79 3300025913 Ga0207695_10324414 Ga0207695_103244142 191
80 3300025914 Ga0207671_10001595 Ga0207671_1000159515 191
81 3300025921 Ga0207652_10857765 Ga0207652_108577652 191
82 3300025924 Ga0207694_10062003 Ga0207694_100620032 191
83 3300025937 Ga0207669_10201516 Ga0207669_102015161 191
84 3300026078 Ga0207702_10030047 Ga0207702_100300473 191
85 3300026078 Ga0207702_10297212 Ga0207702_102972122 191
86 3300026121 Ga0207683_10606104 Ga0207683_106061042 191
87 3300026142 Ga0207698_10063300 Ga0207698_100633001 191
88 3300028379 Ga0268266_10833414 Ga0268266_108334142 191
89 3300028786 Ga0307517_10234451 Ga0307517_102344511 191
90 3300028794 Ga0307515_10000318 Ga0307515_100003185 191
91 3300031507 Ga0307509_10046347 Ga0307509_100463472 191
92 3300031548 Ga0307408_100000527 Ga0307408_10000052710 191
93 3300033179 Ga0307507_10000111 Ga0307507_1000011176 191
94 3300035725 Ga0373947_0463547 Ga0373947_0463547_151_729 191
95 3300037418 Ga0395900_0639906 Ga0395900_0639906_373_951 191
96 3300038443 Ga0395901_0213337 Ga0395901_0213337_164_742 191
97 3300039062 Ga0400483_219863 Ga0400483_219863_60165_60788 191
98 3300039438 Ga0436360_0638428 Ga0436360_0638428_5240_5860 191
99 3300041511 Ga0451855_1610876 Ga0451855_1610876_59_640 191
100 3300044673 Ga0453683_0007576 Ga0453683_0007576_2753_3352 191
101 3300044712 Ga0453684_0019690 Ga0453684_0019690_6897_7517 191
102 3300044712 Ga0453684_0062544 Ga0453684_0062544_3584_4201 191
103 3300045051 Ga0451576_0000253 Ga0451576_0000253_10157_10756 191
104 3300046462 Ga0495651_0332221 Ga0495651_0332221_168_746 191
105 3300046492 Ga0495585_0000785 Ga0495585_0000785_15975_16553 191
106 3300046506 Ga0495583_0040496 Ga0495583_0040496_1229_1810 191
107 3300046507 Ga0495606_0033601 Ga0495606_0033601_817_1398 191
108 3300046513 Ga0495616_0194745 Ga0495616_0194745_240_818 191
109 3300046524 Ga0495648_0013917 Ga0495648_0013917_3177_3755 191
110 3300046529 Ga0495652_0443098 Ga0495652_0443098_319_897 191
111 3300046538 Ga0495609_0002045 Ga0495609_0002045_8549_9127 191
112 3300046616 Ga0495668_0000011 Ga0495668_0000011_407586_408164 191
113 3300046660 Ga0495625_0001500 Ga0495625_0001500_23552_24130 191
114 3300046660 Ga0495625_0023665 Ga0495625_0023665_858_1436 191
115 3300048089 Ga0495614_0015447 Ga0495614_0015447_2496_3074 191
116 3300049460 Ga0495682_0013224 Ga0495682_0013224_1475_2053 191
117 3300050493 nmdc:mga0k408_26_c4 nmdc:mga0k408_26_c4_44284_44937 191
118 3300053080 Ga0500635_0000392 Ga0500635_0000392_3025_3603 191
119 3300053157 Ga0500624_000168 Ga0500624_000168_81_659 191
120 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008148 192
121 3300005336 Ga0070680_100634175 Ga0070680_1006341752 192
122 3300005455 Ga0070663_100011963 Ga0070663_1000119634 192
123 3300005614 Ga0068856_100000006 Ga0068856_10000000695 192
124 3300006195 Ga0075366_10282707 Ga0075366_102827072 192
125 3300009174 Ga0105241_10136328 Ga0105241_101363282 192
126 3300009174 Ga0105241_10183845 Ga0105241_101838452 192
127 3300009545 Ga0105237_10004787 Ga0105237_100047877 192
128 3300010375 Ga0105239_10000016 Ga0105239_10000016112 192
129 3300010375 Ga0105239_10033293 Ga0105239_100332932 192
130 3300013102 Ga0157371_10001025 Ga0157371_1000102525 192
131 3300013104 Ga0157370_10256201 Ga0157370_102562011 192
132 3300013105 Ga0157369_10002452 Ga0157369_100024526 192
133 3300013307 Ga0157372_10000077 Ga0157372_1000007778 192
134 3300025233 Ga0209437_100030 Ga0209437_100030241 192
135 3300025914 Ga0207671_10010947 Ga0207671_100109474 192
136 3300025917 Ga0207660_10603612 Ga0207660_106036121 192
137 3300026067 Ga0207678_10039081 Ga0207678_100390812 192
138 3300026078 Ga0207702_10000023 Ga0207702_1000002379 192
139 3300028800 Ga0265338_10044564 Ga0265338_100445642 192
140 3300028800 Ga0265338_10180661 Ga0265338_101806612 192
141 3300032004 Ga0307414_10404270 Ga0307414_104042702 192
142 3300036712 Ga0316584_0075628 Ga0316584_0075628_22_687 192
143 3300037312 Ga0395899_0000017 Ga0395899_0000017_29068_29649 192
144 3300037312 Ga0395899_0000152 Ga0395899_0000152_94837_95418 192
145 3300037418 Ga0395900_0211427 Ga0395900_0211427_992_1573 192
146 3300038443 Ga0395901_0537426 Ga0395901_0537426_109_690 192
147 3300042876 Ga0451577_0000004 Ga0451577_0000004_533128_533733 192
148 3300042876 Ga0451577_0037718 Ga0451577_0037718_2476_3060 192
149 3300044656 Ga0466969_0141218 Ga0466969_0141218_131_712 192
150 3300044684 Ga0466966_0008903 Ga0466966_0008903_3778_4359 192
151 3300044712 Ga0453684_0000025 Ga0453684_0000025_533156_533761 192
152 3300044712 Ga0453684_0006764 Ga0453684_0006764_2680_3264 192
153 3300045836 Ga0466958_0283446 Ga0466958_0283446_39_647 192
154 3300046460 Ga0495638_0050836 Ga0495638_0050836_489_1070 192
155 3300046471 Ga0495650_0092345 Ga0495650_0092345_67_651 192
156 3300046507 Ga0495606_0003600 Ga0495606_0003600_6921_7505 192
157 3300046507 Ga0495606_0003924 Ga0495606_0003924_11040_11621 192
158 3300046513 Ga0495616_0001541 Ga0495616_0001541_10782_11363 192
159 3300046616 Ga0495668_0156282 Ga0495668_0156282_148_738 192
160 3300046660 Ga0495625_0049572 Ga0495625_0049572_261_842 192
161 3300046691 Ga0495670_0279165 Ga0495670_0279165_233_823 192
162 3300046810 Ga0495660_0001898 Ga0495660_0001898_11147_11728 192
163 3300047472 Ga0495686_0011708 Ga0495686_0011708_378_962 192
164 3300049459 Ga0495678_002338 Ga0495678_002338_4041_4622 192
165 3300050493 nmdc:mga0k408_217361_c1 nmdc:mga0k408_217361_c1_365_946 192
166 3300053125 Ga0500618_000021 Ga0500618_000021_43190_43774 192
167 3300053153 Ga0500616_0021660 Ga0500616_0021660_2497_3081 192
168 3300001979 JGI24740J21852_10022858 JGI24740J21852_100228581 193
169 3300001990 JGI24737J22298_10001296 JGI24737J22298_100012961 193
170 3300002067 JGI24735J21928_10000017 JGI24735J21928_1000001763 193
171 3300003316 rootH1_10087025 rootH1_100870252 193
172 3300003316 rootH1_10117319 rootH1_101173192 193
173 3300003320 rootH2_10209483 rootH2_102094831 193
174 3300003322 rootL2_10054585 rootL2_100545852 193
175 3300005288 Ga0065714_10019616 Ga0065714_100196161 193
176 3300005288 Ga0065714_10257942 Ga0065714_102579422 193
177 3300005563 Ga0068855_100066159 Ga0068855_1000661593 193
178 3300005563 Ga0068855_100084130 Ga0068855_1000841304 193
179 3300005563 Ga0068855_100974386 Ga0068855_1009743862 193
180 3300005577 Ga0068857_100051831 Ga0068857_1000518313 193
181 3300005578 Ga0068854_100020002 Ga0068854_1000200023 193
182 3300006195 Ga0075366_10003461 Ga0075366_100034617 193
183 3300009093 Ga0105240_10001259 Ga0105240_1000125918 193
184 3300009174 Ga0105241_10006368 Ga0105241_100063682 193
185 3300009545 Ga0105237_10011689 Ga0105237_100116893 193
186 3300009545 Ga0105237_10033449 Ga0105237_100334493 193
187 3300009545 Ga0105237_10074538 Ga0105237_100745382 193
188 3300009545 Ga0105237_10266421 Ga0105237_102664212 193
189 3300009551 Ga0105238_10259315 Ga0105238_102593152 193
190 3300010375 Ga0105239_10000955 Ga0105239_1000095536 193
191 3300010375 Ga0105239_10318841 Ga0105239_103188411 193
192 3300010375 Ga0105239_11632129 Ga0105239_116321291 193
193 3300013102 Ga0157371_10068883 Ga0157371_100688832 193
194 3300013104 Ga0157370_11240977 Ga0157370_112409771 193
195 3300013105 Ga0157369_10109159 Ga0157369_101091594 193
196 3300013297 Ga0157378_10001635 Ga0157378_1000163518 193
197 3300013306 Ga0163162_10001761 Ga0163162_100017619 193
198 3300013307 Ga0157372_10005470 Ga0157372_100054707 193
199 3300013307 Ga0157372_11967680 Ga0157372_119676801 193
200 3300013308 Ga0157375_10032705 Ga0157375_100327052 193
201 3300025250 Ga0209026_1001779 Ga0209026_10017791 193
202 3300025911 Ga0207654_10008230 Ga0207654_100082303 193
203 3300025913 Ga0207695_10000183 Ga0207695_10000183141 193
204 3300025914 Ga0207671_10000477 Ga0207671_1000047730 193
205 3300025914 Ga0207671_10021230 Ga0207671_100212305 193
206 3300025914 Ga0207671_10098241 Ga0207671_100982412 193
207 3300025949 Ga0207667_10031440 Ga0207667_100314401 193
208 3300025949 Ga0207667_10832494 Ga0207667_108324942 193
209 3300025981 Ga0207640_10064909 Ga0207640_100649093 193
210 3300026116 Ga0207674_10062939 Ga0207674_100629394 193
211 3300028558 Ga0265326_10061883 Ga0265326_100618832 193
212 3300028794 Ga0307515_10000133 Ga0307515_1000013398 193
213 3300031240 Ga0265320_10018351 Ga0265320_100183512 193
214 3300031344 Ga0265316_10116733 Ga0265316_101167332 193
215 3300031649 Ga0307514_10006049 Ga0307514_1000604910 193
216 3300031712 Ga0265342_10146730 Ga0265342_101467302 193
217 3300031911 Ga0307412_10241112 Ga0307412_102411122 193
218 3300035115 Ga0373941_0032627 Ga0373941_0032627_939_1526 193
219 3300037418 Ga0395900_0001123 Ga0395900_0001123_20354_20944 193
220 3300042876 Ga0451577_0051137 Ga0451577_0051137_1628_2245 193
221 3300042876 Ga0451577_0172773 Ga0451577_0172773_1143_1763 193
222 3300042876 Ga0451577_0196953 Ga0451577_0196953_235_849 193
223 3300042876 Ga0451577_0839673 Ga0451577_0839673_107_730 193
224 3300044673 Ga0453683_0608530 Ga0453683_0608530_48_647 193
225 3300044712 Ga0453684_0001027 Ga0453684_0001027_70737_71354 193
226 3300044712 Ga0453684_0020661 Ga0453684_0020661_278_892 193
227 3300044712 Ga0453684_0058220 Ga0453684_0058220_1389_1988 193
228 3300044712 Ga0453684_0064424 Ga0453684_0064424_3797_4417 193
229 3300045051 Ga0451576_0006198 Ga0451576_0006198_7710_8330 193
230 3300045051 Ga0451576_0101979 Ga0451576_0101979_1764_2363 193
231 3300046460 Ga0495638_0025314 Ga0495638_0025314_441_1025 193
232 3300046471 Ga0495650_0000050 Ga0495650_0000050_201271_201855 193
233 3300046492 Ga0495585_0000560 Ga0495585_0000560_10305_10889 193
234 3300046506 Ga0495583_0007344 Ga0495583_0007344_785_1369 193
235 3300046507 Ga0495606_0000581 Ga0495606_0000581_51336_51920 193
236 3300046507 Ga0495606_0084153 Ga0495606_0084153_600_1187 193
237 3300046512 Ga0495610_0002203 Ga0495610_0002203_5816_6400 193
238 3300046513 Ga0495616_0000296 Ga0495616_0000296_18723_19307 193
239 3300046520 Ga0495637_0032721 Ga0495637_0032721_1669_2253 193
240 3300046524 Ga0495648_0035819 Ga0495648_0035819_1858_2442 193
241 3300046558 Ga0495633_0007257 Ga0495633_0007257_955_1539 193
242 3300046648 Ga0495611_0043818 Ga0495611_0043818_165_752 193
243 3300046660 Ga0495625_0000077 Ga0495625_0000077_66855_67439 193
244 3300046660 Ga0495625_0004941 Ga0495625_0004941_6741_7328 193
245 3300046660 Ga0495625_0052001 Ga0495625_0052001_2078_2680 193
246 3300046665 Ga0495661_0001682 Ga0495661_0001682_7440_8030 193
247 3300046665 Ga0495661_0002867 Ga0495661_0002867_8157_8741 193
248 3300046694 Ga0495649_0000011 Ga0495649_0000011_159883_160467 193
249 3300047443 Ga0495687_093811 Ga0495687_093811_241_828 193
250 3300047443 Ga0495687_093818 Ga0495687_093818_241_828 193
251 3300047469 Ga0495673_0087121 Ga0495673_0087121_194_778 193
252 3300047472 Ga0495686_0148446 Ga0495686_0148446_743_1327 193
253 3300047472 Ga0495686_0229540 Ga0495686_0229540_382_1014 193
254 3300049571 Ga0501034_0000098 Ga0501034_0000098_35014_35655 193
255 3300049572 Ga0501036_0179198 Ga0501036_0179198_230_871 193
256 3300049574 Ga0501038_0151805 Ga0501038_0151805_52_693 193
257 3300050493 nmdc:mga0k408_17060_c1 nmdc:mga0k408_17060_c1_942_1523 193
258 3300053156 Ga0500622_0017198 Ga0500622_0017198_1621_2250 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

39

223

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9384 3 188
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9368 1 190
2dvn-assembly1.cif.gz_A structure of ph1917 protein with the complex of imp from pyrococcus horikoshii 0.9278 1 189
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9225 1 190
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9177 1 190
ID Description Score Start End Superfamily
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9468 2 189 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9425 1 190 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9368 1 190 3.90.950.10
af_Q9UU89_2_186_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9325 2 190 3.90.950.10
af_P9WMR7_2_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9301 1 190 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A426H7E2-F1-model_v4 deleted 0.9975 39 190
AF-A0A1M6UMJ1-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.995 1 190 GO:0000166
GO:0005886
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A838ZR09-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9925 1 190 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0046872
GO:0047429
AF-A0A2X2JAL2-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.992 1 190 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A2T4HLC6-F1-model_v4 deleted 0.992 1 191

Feature Viewer

pLDDT pTM Quality
94.2 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map