F368096

General Info

Members Datasets Scaffolds Average Seq Length
258 189 242 253

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10015730|Ga0182007_100157302
Length 284
Sequence MPPRQDIQLIPVNTAPGHLAHAAVINRGGTIMRRLAGKVALVTGGAVGIGAACVARLVEAGARVAIVDLHDGPGRQLAGQFGDAARYFHADVSVEAEVAAAIAGTVAAFGRLDVLVNNAGIAGPNKPTHELTEAEWDRVQAVNVKGVFFCTKHAIAPLRAAGGGSIINLSSIYGLVGAPDVPPYHASKGAVRLMSKTDALIYAADRIRVNSIHPGFIWTPMVEQHIASMGGDPQQHRREVDALHPLGHMGEPDDIAWGVVYLASDEAKFVTGSELVIDGGYSCR

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221612 Lysobacter sp. Root76 Isolate Unclassified
7 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
8 2643221727 Lysobacter sp. Root96 Isolate Unclassified
9 2643221728 Lysobacter sp. Root983 Isolate Unclassified
10 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
11 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
12 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
13 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
14 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
15 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
179 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0
Isolates 6.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 2.33
Rhizosphere 81.4
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000597 3300002737 Bacteria 26205
2 JGI25157J39369_1001756 3300002741 Bacteria 7117
3 JGI25164J39214_1000259 3300002772 Bacteria 39804
4 JGI25152J39213_1019604 3300002773 Bacteria 1227
5 JGI25165J46597_1000379 3300003214 Bacteria 48698
6 JGI25153J46596_10002682 3300003215 Bacteria 10163
7 JGI25153J46596_10024116 3300003215 Bacteria 2199
8 rootH1_10041057 3300003316 Bacteria 3593
9 rootH2_10125269 3300003320 Bacteria 2748
10 rootL2_10048291 3300003322 Bacteria 9407
11 rootH1_10107151 3300003323 Bacteria 4115
12 Ga0065715_10098713 3300005293 Bacteria 3508
13 Ga0070670_100000004 3300005331 Bacteria 392110
14 Ga0070666_10000066 3300005335 Bacteria 77241
15 Ga0070666_10009379 3300005335 Bacteria 6099
16 Ga0070682_100004557 3300005337 Bacteria 7706
17 Ga0068868_100052717 3300005338 Bacteria 3202
18 Ga0070660_100163142 3300005339 Bacteria 1796
19 Ga0070668_100009811 3300005347 Bacteria 7094
20 Ga0070671_100021105 3300005355 Bacteria 5318
21 Ga0070671_100431955 3300005355 Bacteria 1128
22 Ga0070659_100043600 3300005366 Bacteria 3508
23 Ga0070667_100000500 3300005367 Bacteria 39688
24 Ga0070714_100000694 3300005435 Bacteria 23800
25 Ga0070714_100011953 3300005435 Bacteria 6905
26 Ga0070713_100000941 3300005436 Bacteria 18599
27 Ga0070700_100532169 3300005441 Bacteria 910
28 Ga0070662_100024492 3300005457 Bacteria 4158
29 Ga0070681_10266390 3300005458 Bacteria 1625
30 Ga0070696_100002388 3300005546 Bacteria 12422
31 Ga0070665_100001459 3300005548 Bacteria 27707
32 Ga0070704_100487905 3300005549 Bacteria 1067
33 Ga0068855_100012611 3300005563 Bacteria 10200
34 Ga0068857_100070951 3300005577 Bacteria 3103
35 Ga0068857_100329290 3300005577 Bacteria 1411
36 Ga0068854_100000457 3300005578 Bacteria 25185
37 Ga0068859_100357674 3300005617 Bacteria 1555
38 Ga0068864_100000541 3300005618 Bacteria 32242
39 Ga0068851_10290619 3300005834 Bacteria 937
40 Ga0068863_100000319 3300005841 Bacteria 48831
41 Ga0068858_100033021 3300005842 Bacteria 4807
42 Ga0068858_100592200 3300005842 Bacteria 1075
43 Ga0068860_100000551 3300005843 Bacteria 45665
44 Ga0068862_100053083 3300005844 Bacteria 3469
45 Ga0068865_100000639 3300006881 Bacteria 19786
46 Ga0097620_100357630 3300006931 Bacteria 1555
47 Ga0105240_10000842 3300009093 Bacteria 55187
48 Ga0105245_10326701 3300009098 Bacteria 1513
49 Ga0105248_10006301 3300009177 Bacteria 13019
50 Ga0105248_10057297 3300009177 Bacteria 4373
51 Ga0105248_10175568 3300009177 Bacteria 2415
52 Ga0105238_10022760 3300009551 Bacteria 6386
53 Ga0105238_10192427 3300009551 Bacteria 2016
54 Ga0105249_10000432 3300009553 Bacteria 39792
55 Ga0105239_10086792 3300010375 Bacteria 3449
56 Ga0105239_10519774 3300010375 Bacteria 1354
57 Ga0157373_10004598 3300013100 Bacteria 10377
58 Ga0157371_10086553 3300013102 Bacteria 2219
59 Ga0157370_10037206 3300013104 Bacteria 4718
60 Ga0157378_10070269 3300013297 Bacteria 3143
61 Ga0157372_10086350 3300013307 Bacteria 3559
62 Ga0157375_10002171 3300013308 Bacteria 16958
63 Ga0157380_10238075 3300014326 Bacteria 1639
64 Ga0182008_10111467 3300014497 Bacteria 1356
65 Ga0157376_10435698 3300014969 Unclassified 1275
66 Ga0182006_1006979 3300015261 Bacteria 5197
67 Ga0182007_10015730 3300015262 Bacteria 2811
68 Ga0182007_10022104 3300015262 Bacteria 2250
69 Ga0182007_10041637 3300015262 Bacteria 1531
70 Ga0209674_100587 3300025226 Bacteria 14006
71 Ga0207427_100101 3300025231 Bacteria 120866
72 Ga0209437_100090 3300025233 Bacteria 247138
73 Ga0209026_1000114 3300025250 Bacteria 136985
74 Ga0209129_1000892 3300025258 Bacteria 18328
75 Ga0209233_1000077 3300025261 Bacteria 349570
76 Ga0209758_1000013 3300025297 Bacteria 873003
77 Ga0209758_1001515 3300025297 Bacteria 26943
78 Ga0209257_1006865 3300025304 Bacteria 7147
79 Ga0207710_10155759 3300025900 Bacteria 1110
80 Ga0207680_10000006 3300025903 Bacteria 635950
81 Ga0207680_10005004 3300025903 Bacteria 6313
82 Ga0207647_10015810 3300025904 Bacteria 5165
83 Ga0207705_10057696 3300025909 Bacteria 2800
84 Ga0207707_10024031 3300025912 Bacteria 5329
85 Ga0207707_10191420 3300025912 Bacteria 1784
86 Ga0207671_10140861 3300025914 Bacteria 1858
87 Ga0207657_10030565 3300025919 Bacteria 4888
88 Ga0207657_10041098 3300025919 Bacteria 4091
89 Ga0207694_10041146 3300025924 Bacteria 3560
90 Ga0207694_10143746 3300025924 Bacteria 1919
91 Ga0207650_10000118 3300025925 Bacteria 104112
92 Ga0207659_10672150 3300025926 Bacteria 886
93 Ga0207664_10000666 3300025929 Bacteria 23590
94 Ga0207644_10028365 3300025931 Bacteria 3874
95 Ga0207644_10250132 3300025931 Bacteria 1414
96 Ga0207690_10000124 3300025932 Bacteria 63516
97 Ga0207690_10127856 3300025932 Bacteria 1855
98 Ga0207706_10046998 3300025933 Bacteria 3820
99 Ga0207706_10098371 3300025933 Bacteria 2574
100 Ga0207711_10003760 3300025941 Bacteria 13070
101 Ga0207711_10097187 3300025941 Bacteria 2600
102 Ga0207667_10045352 3300025949 Bacteria 4656
103 Ga0207712_10000889 3300025961 Bacteria 21687
104 Ga0207668_10000041 3300025972 Bacteria 104351
105 Ga0207640_10000009 3300025981 Bacteria 283101
106 Ga0207658_10001380 3300025986 Bacteria 18968
107 Ga0207677_10049553 3300026023 Bacteria 2835
108 Ga0207703_10000395 3300026035 Bacteria 46814
109 Ga0207703_10505510 3300026035 Bacteria 1135
110 Ga0207639_10170378 3300026041 Bacteria 1843
111 Ga0207678_10331844 3300026067 Bacteria 1309
112 Ga0207678_10344759 3300026067 Bacteria 1284
113 Ga0207702_10473517 3300026078 Bacteria 1218
114 Ga0207702_10819379 3300026078 Bacteria 920
115 Ga0207641_10002475 3300026088 Bacteria 17061
116 Ga0207676_10000533 3300026095 Bacteria 31944
117 Ga0207674_10027147 3300026116 Bacteria 6063
118 Ga0207674_10068094 3300026116 Bacteria 3583
119 Ga0209973_1001378 3300027252 Bacteria 2118
120 Ga0209967_1001453 3300027364 Bacteria 3036
121 Ga0209995_1024008 3300027471 Bacteria 1014
122 Ga0209999_1003598 3300027543 Bacteria 2775
123 Ga0209982_1001343 3300027552 Bacteria 3337
124 Ga0209983_1005414 3300027665 Bacteria 2645
125 Ga0268266_10001916 3300028379 Bacteria 23387
126 Ga0268265_10053182 3300028380 Bacteria 3067
127 Ga0268264_10000032 3300028381 Bacteria 408337
128 Ga0307515_10089643 3300028794 Unclassified 3869
129 Ga0265338_10380399 3300028800 Bacteria 1010
130 Ga0265340_10002591 3300031247 Bacteria 10272
131 Ga0265327_10101566 3300031251 Bacteria 1387
132 Ga0307406_10004677 3300031901 Bacteria 7459
133 Ga0307412_10535794 3300031911 Bacteria 981
134 Ga0307416_100173447 3300032002 Bacteria 2011
135 Ga0307414_10009513 3300032004 Bacteria 5589
136 Ga0395899_0000743 3300037312 Bacteria 32540
137 Ga0395899_0030653 3300037312 Bacteria 4044
138 Ga0395899_0039730 3300037312 Bacteria 3520
139 Ga0395900_0000256 3300037418 Bacteria 82977
140 Ga0395900_0117172 3300037418 Bacteria 2733
141 Ga0395900_0760487 3300037418 Bacteria 899
142 Ga0395898_0045503 3300037466 Bacteria 4313
143 Ga0395898_0613981 3300037466 Bacteria 1030
144 Ga0395901_0000267 3300038443 Bacteria 64966
145 Ga0395901_0001304 3300038443 Bacteria 26281
146 Ga0395901_0010806 3300038443 Bacteria 9252
147 Ga0395901_0046571 3300038443 Bacteria 4505
148 Ga0395901_0096633 3300038443 Bacteria 3096
149 Ga0439436_0023002 3300041404 Bacteria 1845
150 Ga0439437_006652 3300042000 Bacteria 1280
151 Ga0439432_014335 3300042006 Bacteria 2684
152 Ga0439432_023598 3300042006 Bacteria 2025
153 Ga0439434_0061109 3300042435 Bacteria 1178
154 Ga0453684_0085375 3300044712 Bacteria 3922
155 Ga0453684_0650683 3300044712 Bacteria 1150
156 Ga0495592_0207928 3300046454 Bacteria 1316
157 Ga0495592_0496030 3300046454 Bacteria 758
158 Ga0495628_0028421 3300046516 Bacteria 4544
159 Ga0495621_0000802 3300046539 Bacteria 7952
160 Ga0495656_0000652 3300046615 Bacteria 11102
161 Ga0495656_0112016 3300046615 Bacteria 1278
162 Ga0495625_0003573 3300046660 Bacteria 15334
163 Ga0495659_0013732 3300046664 Bacteria 2641
164 Ga0495636_0000081 3300047318 Bacteria 40032
165 Ga0495636_0000535 3300047318 Bacteria 13969
166 Ga0495636_0013742 3300047318 Bacteria 3213
167 Ga0495636_0024752 3300047318 Bacteria 2436
168 Ga0496101_0595916 3300048904 Bacteria 874
169 Ga0496105_0707497 3300048908 Bacteria 773
170 Ga0496108_0108595 3300048911 Bacteria 2370
171 Ga0496109_0040545 3300048912 Bacteria 4217
172 Ga0496109_0144823 3300048912 Bacteria 2222
173 Ga0496110_0347324 3300048913 Bacteria 1351
174 Ga0496117_0037597 3300048920 Bacteria 3604
175 Ga0496118_0003291 3300048921 Bacteria 20547
176 Ga0496119_0010795 3300048922 Bacteria 7644
177 Ga0496120_0111133 3300048923 Bacteria 1432
178 Ga0496121_0000135 3300048924 Bacteria 165485
179 Ga0496126_0254952 3300048929 Bacteria 1460
180 Ga0501290_006213 3300049513 Bacteria 1495
181 Ga0501032_0008012 3300049569 Bacteria 7701
182 Ga0501032_0020079 3300049569 Bacteria 4659
183 Ga0501032_0372618 3300049569 Bacteria 918
184 Ga0501034_0000585 3300049571 Bacteria 57565
185 Ga0501034_0001079 3300049571 Bacteria 38634
186 Ga0501034_0010411 3300049571 Bacteria 9692
187 Ga0501034_0099524 3300049571 Bacteria 2902
188 Ga0501036_0018668 3300049572 Bacteria 5815
189 Ga0501037_0011730 3300049573 Bacteria 6452
190 Ga0501038_0190810 3300049574 Bacteria 1649
191 Ga0501039_0180973 3300049575 Bacteria 1658
192 Ga0501043_0032474 3300049579 Bacteria 4104
193 Ga0501043_0165994 3300049579 Bacteria 1724
194 Ga0501043_0206454 3300049579 Bacteria 1523
195 Ga0501043_0388360 3300049579 Bacteria 1056
196 Ga0501043_0457407 3300049579 Bacteria 958
197 Ga0501046_0049952 3300049580 Bacteria 3306
198 Ga0501047_0009308 3300049581 Bacteria 9277
199 Ga0501047_0013994 3300049581 Bacteria 7625
200 Ga0501047_0015840 3300049581 Bacteria 7183
201 Ga0501047_0266872 3300049581 Bacteria 1558
202 Ga0501047_0501303 3300049581 Bacteria 1041
203 Ga0501067_0004897 3300049583 Bacteria 7437
204 Ga0501068_0084601 3300049584 Bacteria 1951
205 Ga0501069_0222820 3300049585 Bacteria 1096
206 Ga0501069_0236542 3300049585 Bacteria 1064
207 Ga0501070_0015805 3300049586 Bacteria 6346
208 Ga0501071_0026183 3300049587 Bacteria 4091
209 Ga0501071_0056607 3300049587 Bacteria 2833
210 Ga0501072_0056397 3300049588 Bacteria 3096
211 Ga0501073_0000005 3300049589 Bacteria 237180
212 Ga0501073_0029779 3300049589 Bacteria 3901
213 Ga0501074_0026869 3300049590 Bacteria 4171
214 Ga0501075_0005436 3300049591 Bacteria 8712
215 Ga0501076_0009771 3300049592 Bacteria 7087
216 Ga0501077_0000039 3300049593 Bacteria 65680
217 Ga0501077_0003603 3300049593 Bacteria 9313
218 Ga0501079_0057009 3300049741 Bacteria 3015
219 Ga0501079_0080669 3300049741 Bacteria 2516
220 Ga0501080_0031567 3300049742 Bacteria 4935
221 Ga0501080_0036884 3300049742 Bacteria 4563
222 Ga0501080_0239877 3300049742 Bacteria 1655
223 Ga0501080_0343070 3300049742 Bacteria 1349
224 Ga0501081_0016540 3300049743 Bacteria 4876
225 Ga0501083_0128507 3300049744 Bacteria 1661
226 Ga0501265_000470 3300049762 Bacteria 4242
227 Ga0501275_000699 3300049772 Bacteria 3684
228 Ga0501035_0044998 3300049822 Bacteria 3972
229 Ga0501035_0072317 3300049822 Bacteria 3052
230 Ga0501035_0271939 3300049822 Bacteria 1434
231 Ga0501044_0017340 3300049823 Bacteria 7723
232 Ga0501044_0084215 3300049823 Bacteria 3214
233 Ga0501044_0336210 3300049823 Bacteria 1432
234 Ga0501044_0352993 3300049823 Bacteria 1390
235 Ga0501045_0466035 3300049824 Bacteria 939
236 nmdc:mga09592_258960_c1 3300050508 Bacteria 1508
237 Ga0495601_0203504 3300053077 Bacteria 1293
238 Ga0500555_005097 3300053103 Bacteria 3728
239 Ga0500556_0019175 3300053104 Bacteria 2170
240 Ga0501084_0306590 3300054114 Bacteria 1341
241 Ga0501082_0054346 3300060353 Bacteria 3452
242 Ga0501082_0070014 3300060353 Bacteria 3021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0496030 Ga0495592_0496030_92_748 215
2 3300049741 Ga0501079_0057009 Ga0501079_0057009_2337_3002 218
3 3300044712 Ga0453684_0650683 Ga0453684_0650683_10_681 220
4 3300005834 Ga0068851_10290619 Ga0068851_102906191 223
5 3300031911 Ga0307412_10535794 Ga0307412_105357941 225
6 3300037418 Ga0395900_0760487 Ga0395900_0760487_63_755 227
7 3300048904 Ga0496101_0595916 Ga0496101_0595916_22_714 227
8 3300048908 Ga0496105_0707497 Ga0496105_0707497_29_721 227
9 3300049588 Ga0501072_0056397 Ga0501072_0056397_2255_2947 227
10 3300038443 Ga0395901_0010806 Ga0395901_0010806_4403_5101 228
11 3300026067 Ga0207678_10331844 Ga0207678_103318442 229
12 3300049571 Ga0501034_0001079 Ga0501034_0001079_23868_24635 231
13 3300049584 Ga0501068_0084601 Ga0501068_0084601_36_803 231
14 3300049742 Ga0501080_0031567 Ga0501080_0031567_3768_4535 231
15 3300049823 Ga0501044_0336210 Ga0501044_0336210_135_902 231
16 3300009177 Ga0105248_10006301 Ga0105248_1000630111 233
17 3300025941 Ga0207711_10003760 Ga0207711_100037606 233
18 3300048920 Ga0496117_0037597 Ga0496117_0037597_1447_2214 233
19 3300048921 Ga0496118_0003291 Ga0496118_0003291_4890_5657 233
20 3300048922 Ga0496119_0010795 Ga0496119_0010795_5323_6090 233
21 3300048923 Ga0496120_0111133 Ga0496120_0111133_534_1301 233
22 3300048924 Ga0496121_0000135 Ga0496121_0000135_106958_107725 233
23 3300049592 Ga0501076_0009771 Ga0501076_0009771_1469_2203 233
24 3300053103 Ga0500555_005097 Ga0500555_005097_1898_2665 233
25 3300027252 Ga0209973_1001378 Ga0209973_10013782 234
26 3300049569 Ga0501032_0372618 Ga0501032_0372618_96_857 240
27 3300049579 Ga0501043_0032474 Ga0501043_0032474_3308_4069 240
28 3300049581 Ga0501047_0013994 Ga0501047_0013994_5217_5978 240
29 3300049587 Ga0501071_0056607 Ga0501071_0056607_1414_2169 240
30 3300049591 Ga0501075_0005436 Ga0501075_0005436_4660_5415 240
31 3300049593 Ga0501077_0003603 Ga0501077_0003603_8232_8987 240
32 3300049743 Ga0501081_0016540 Ga0501081_0016540_1971_2726 240
33 3300049822 Ga0501035_0072317 Ga0501035_0072317_1686_2447 240
34 3300049824 Ga0501045_0466035 Ga0501045_0466035_27_788 240
35 3300054114 Ga0501084_0306590 Ga0501084_0306590_454_1209 240
36 3300060353 Ga0501082_0054346 Ga0501082_0054346_1530_2285 240
37 3300037418 Ga0395900_0117172 Ga0395900_0117172_1570_2337 242
38 3300038443 Ga0395901_0001304 Ga0395901_0001304_19458_20225 242
39 3300031247 Ga0265340_10002591 Ga0265340_100025917 243
40 3300037312 Ga0395899_0030653 Ga0395899_0030653_1939_2772 243
41 3300049823 Ga0501044_0352993 Ga0501044_0352993_639_1379 243
42 3300028800 Ga0265338_10380399 Ga0265338_103803991 244
43 3300038443 Ga0395901_0096633 Ga0395901_0096633_1777_2544 244
44 iso_pu_bacteria 2791355137 2792832658 246
45 iso_pu_bacteria 2904615490 2904620009 246
46 3300049579 Ga0501043_0457407 Ga0501043_0457407_78_836 247
47 3300049581 Ga0501047_0266872 Ga0501047_0266872_422_1180 247
48 3300003320 rootH2_10125269 rootH2_101252691 248
49 3300046454 Ga0495592_0207928 Ga0495592_0207928_129_950 249
50 3300046516 Ga0495628_0028421 Ga0495628_0028421_2669_3490 249
51 3300053077 Ga0495601_0203504 Ga0495601_0203504_60_881 249
52 iso_pu_bacteria 2537561836 2538833914 249
53 iso_pu_bacteria 2571042365 2572253603 249
54 iso_pu_bacteria 2643221559 2643817975 249
55 iso_pu_bacteria 2643221577 2643895468 249
56 iso_pu_bacteria 2643221586 2643937633 249
57 iso_pu_bacteria 2643221612 2644078547 249
58 iso_pu_bacteria 2643221685 2644477645 249
59 iso_pu_bacteria 2643221727 2644693324 249
60 iso_pu_bacteria 2643221728 2644697653 249
61 iso_pu_bacteria 2854681122 2854683302 249
62 iso_pu_bacteria 2895395659 2895396226 249
63 iso_pu_bacteria 2937843397 2937844011 249
64 iso_pu_bacteria 2939611941 2939615425 249
65 iso_pu_bacteria 8002869464 8002870162 249
66 3300025304 Ga0209257_1006865 Ga0209257_10068655 250
67 3300049581 Ga0501047_0501303 Ga0501047_0501303_105_869 251
68 3300003322 rootL2_10048291 rootL2_100482916 252
69 3300005293 Ga0065715_10098713 Ga0065715_100987133 252
70 3300005331 Ga0070670_100000004 Ga0070670_100000004246 252
71 3300005335 Ga0070666_10009379 Ga0070666_100093793 252
72 3300005347 Ga0070668_100009811 Ga0070668_1000098117 252
73 3300005367 Ga0070667_100000500 Ga0070667_10000050019 252
74 3300005441 Ga0070700_100532169 Ga0070700_1005321691 252
75 3300005548 Ga0070665_100001459 Ga0070665_1000014599 252
76 3300005549 Ga0070704_100487905 Ga0070704_1004879052 252
77 3300005617 Ga0068859_100357674 Ga0068859_1003576742 252
78 3300005618 Ga0068864_100000541 Ga0068864_10000054113 252
79 3300005841 Ga0068863_100000319 Ga0068863_10000031941 252
80 3300005842 Ga0068858_100033021 Ga0068858_1000330212 252
81 3300005843 Ga0068860_100000551 Ga0068860_1000005512 252
82 3300005844 Ga0068862_100053083 Ga0068862_1000530834 252
83 3300006881 Ga0068865_100000639 Ga0068865_1000006396 252
84 3300006931 Ga0097620_100357630 Ga0097620_1003576302 252
85 3300009093 Ga0105240_10000842 Ga0105240_1000084213 252
86 3300009177 Ga0105248_10057297 Ga0105248_100572973 252
87 3300009553 Ga0105249_10000432 Ga0105249_1000043234 252
88 3300014326 Ga0157380_10238075 Ga0157380_102380752 252
89 3300014969 Ga0157376_10435698 Ga0157376_104356982 252
90 3300025900 Ga0207710_10155759 Ga0207710_101557592 252
91 3300025903 Ga0207680_10005004 Ga0207680_100050043 252
92 3300025925 Ga0207650_10000118 Ga0207650_1000011828 252
93 3300025926 Ga0207659_10672150 Ga0207659_106721501 252
94 3300025941 Ga0207711_10097187 Ga0207711_100971873 252
95 3300025961 Ga0207712_10000889 Ga0207712_100008893 252
96 3300025972 Ga0207668_10000041 Ga0207668_10000041101 252
97 3300025986 Ga0207658_10001380 Ga0207658_1000138020 252
98 3300026035 Ga0207703_10000395 Ga0207703_1000039526 252
99 3300026088 Ga0207641_10002475 Ga0207641_100024755 252
100 3300026095 Ga0207676_10000533 Ga0207676_1000053333 252
101 3300028379 Ga0268266_10001916 Ga0268266_100019169 252
102 3300028380 Ga0268265_10053182 Ga0268265_100531822 252
103 3300028381 Ga0268264_10000032 Ga0268264_10000032170 252
104 3300028794 Ga0307515_10089643 Ga0307515_100896432 252
105 3300049569 Ga0501032_0008012 Ga0501032_0008012_4303_5070 252
106 3300049579 Ga0501043_0165994 Ga0501043_0165994_141_908 252
107 3300049579 Ga0501043_0206454 Ga0501043_0206454_421_1212 252
108 3300049580 Ga0501046_0049952 Ga0501046_0049952_1495_2286 252
109 3300049583 Ga0501067_0004897 Ga0501067_0004897_6248_7015 252
110 3300049585 Ga0501069_0236542 Ga0501069_0236542_205_996 252
111 3300049589 Ga0501073_0000005 Ga0501073_0000005_203236_204003 252
112 3300049593 Ga0501077_0000039 Ga0501077_0000039_46667_47434 252
113 3300049742 Ga0501080_0036884 Ga0501080_0036884_3015_3782 252
114 3300049742 Ga0501080_0239877 Ga0501080_0239877_690_1457 252
115 3300049744 Ga0501083_0128507 Ga0501083_0128507_208_999 252
116 3300049822 Ga0501035_0271939 Ga0501035_0271939_474_1241 252
117 3300050508 nmdc:mga09592_258960_c1 nmdc:mga09592_258960_c1_550_1326 252
118 3300053104 Ga0500556_0019175 Ga0500556_0019175_536_1303 252
119 3300060353 Ga0501082_0070014 Ga0501082_0070014_855_1622 252
120 3300002737 JGI25162J39368_1000597 JGI25162J39368_100059719 253
121 3300002741 JGI25157J39369_1001756 JGI25157J39369_10017568 253
122 3300002772 JGI25164J39214_1000259 JGI25164J39214_100025919 253
123 3300002773 JGI25152J39213_1019604 JGI25152J39213_10196042 253
124 3300003214 JGI25165J46597_1000379 JGI25165J46597_100037931 253
125 3300003215 JGI25153J46596_10002682 JGI25153J46596_100026824 253
126 3300003215 JGI25153J46596_10024116 JGI25153J46596_100241162 253
127 3300003316 rootH1_10041057 rootH1_100410572 253
128 3300003323 rootH1_10107151 rootH1_101071513 253
129 3300005335 Ga0070666_10000066 Ga0070666_1000006648 253
130 3300005337 Ga0070682_100004557 Ga0070682_1000045578 253
131 3300005338 Ga0068868_100052717 Ga0068868_1000527172 253
132 3300005339 Ga0070660_100163142 Ga0070660_1001631422 253
133 3300005355 Ga0070671_100021105 Ga0070671_1000211057 253
134 3300005355 Ga0070671_100431955 Ga0070671_1004319552 253
135 3300005366 Ga0070659_100043600 Ga0070659_1000436002 253
136 3300005435 Ga0070714_100000694 Ga0070714_10000069420 253
137 3300005435 Ga0070714_100011953 Ga0070714_1000119538 253
138 3300005436 Ga0070713_100000941 Ga0070713_1000009418 253
139 3300005457 Ga0070662_100024492 Ga0070662_1000244923 253
140 3300005458 Ga0070681_10266390 Ga0070681_102663902 253
141 3300005546 Ga0070696_100002388 Ga0070696_1000023883 253
142 3300005563 Ga0068855_100012611 Ga0068855_1000126119 253
143 3300005577 Ga0068857_100070951 Ga0068857_1000709513 253
144 3300005577 Ga0068857_100329290 Ga0068857_1003292902 253
145 3300005578 Ga0068854_100000457 Ga0068854_10000045728 253
146 3300005842 Ga0068858_100592200 Ga0068858_1005922001 253
147 3300009098 Ga0105245_10326701 Ga0105245_103267012 253
148 3300009177 Ga0105248_10175568 Ga0105248_101755683 253
149 3300009551 Ga0105238_10022760 Ga0105238_100227608 253
150 3300009551 Ga0105238_10192427 Ga0105238_101924272 253
151 3300010375 Ga0105239_10086792 Ga0105239_100867922 253
152 3300010375 Ga0105239_10519774 Ga0105239_105197742 253
153 3300013100 Ga0157373_10004598 Ga0157373_100045983 253
154 3300013102 Ga0157371_10086553 Ga0157371_100865531 253
155 3300013104 Ga0157370_10037206 Ga0157370_100372063 253
156 3300013297 Ga0157378_10070269 Ga0157378_100702693 253
157 3300013307 Ga0157372_10086350 Ga0157372_100863502 253
158 3300013308 Ga0157375_10002171 Ga0157375_100021713 253
159 3300014497 Ga0182008_10111467 Ga0182008_101114672 253
160 3300015261 Ga0182006_1006979 Ga0182006_10069792 253
161 3300015262 Ga0182007_10015730 Ga0182007_100157302 253
162 3300015262 Ga0182007_10022104 Ga0182007_100221043 253
163 3300015262 Ga0182007_10041637 Ga0182007_100416372 253
164 3300025226 Ga0209674_100587 Ga0209674_10058717 253
165 3300025231 Ga0207427_100101 Ga0207427_10010134 253
166 3300025233 Ga0209437_100090 Ga0209437_100090139 253
167 3300025250 Ga0209026_1000114 Ga0209026_100011498 253
168 3300025258 Ga0209129_1000892 Ga0209129_100089210 253
169 3300025261 Ga0209233_1000077 Ga0209233_1000077236 253
170 3300025297 Ga0209758_1000013 Ga0209758_10000136 253
171 3300025297 Ga0209758_1001515 Ga0209758_10015159 253
172 3300025903 Ga0207680_10000006 Ga0207680_1000000621 253
173 3300025904 Ga0207647_10015810 Ga0207647_100158104 253
174 3300025909 Ga0207705_10057696 Ga0207705_100576962 253
175 3300025912 Ga0207707_10024031 Ga0207707_100240314 253
176 3300025912 Ga0207707_10191420 Ga0207707_101914201 253
177 3300025914 Ga0207671_10140861 Ga0207671_101408612 253
178 3300025919 Ga0207657_10030565 Ga0207657_100305653 253
179 3300025919 Ga0207657_10041098 Ga0207657_100410983 253
180 3300025924 Ga0207694_10041146 Ga0207694_100411463 253
181 3300025924 Ga0207694_10143746 Ga0207694_101437462 253
182 3300025929 Ga0207664_10000666 Ga0207664_1000066620 253
183 3300025931 Ga0207644_10028365 Ga0207644_100283654 253
184 3300025931 Ga0207644_10250132 Ga0207644_102501322 253
185 3300025932 Ga0207690_10000124 Ga0207690_1000012462 253
186 3300025932 Ga0207690_10127856 Ga0207690_101278563 253
187 3300025933 Ga0207706_10046998 Ga0207706_100469982 253
188 3300025933 Ga0207706_10098371 Ga0207706_100983713 253
189 3300025949 Ga0207667_10045352 Ga0207667_100453523 253
190 3300025981 Ga0207640_10000009 Ga0207640_1000000929 253
191 3300026023 Ga0207677_10049553 Ga0207677_100495532 253
192 3300026035 Ga0207703_10505510 Ga0207703_105055102 253
193 3300026041 Ga0207639_10170378 Ga0207639_101703782 253
194 3300026067 Ga0207678_10344759 Ga0207678_103447591 253
195 3300026078 Ga0207702_10473517 Ga0207702_104735172 253
196 3300026078 Ga0207702_10819379 Ga0207702_108193791 253
197 3300026116 Ga0207674_10027147 Ga0207674_100271476 253
198 3300026116 Ga0207674_10068094 Ga0207674_100680943 253
199 3300027364 Ga0209967_1001453 Ga0209967_10014533 253
200 3300027471 Ga0209995_1024008 Ga0209995_10240082 253
201 3300027543 Ga0209999_1003598 Ga0209999_10035982 253
202 3300027552 Ga0209982_1001343 Ga0209982_10013433 253
203 3300027665 Ga0209983_1005414 Ga0209983_10054144 253
204 3300031251 Ga0265327_10101566 Ga0265327_101015662 253
205 3300031901 Ga0307406_10004677 Ga0307406_100046778 253
206 3300032002 Ga0307416_100173447 Ga0307416_1001734471 253
207 3300032004 Ga0307414_10009513 Ga0307414_100095132 253
208 3300037312 Ga0395899_0000743 Ga0395899_0000743_943_1713 253
209 3300037312 Ga0395899_0039730 Ga0395899_0039730_550_1320 253
210 3300037418 Ga0395900_0000256 Ga0395900_0000256_81557_82327 253
211 3300037466 Ga0395898_0045503 Ga0395898_0045503_1606_2376 253
212 3300037466 Ga0395898_0613981 Ga0395898_0613981_26_796 253
213 3300038443 Ga0395901_0000267 Ga0395901_0000267_29327_30097 253
214 3300038443 Ga0395901_0046571 Ga0395901_0046571_1522_2292 253
215 3300041404 Ga0439436_0023002 Ga0439436_0023002_619_1392 253
216 3300042000 Ga0439437_006652 Ga0439437_006652_458_1225 253
217 3300042006 Ga0439432_014335 Ga0439432_014335_1018_1797 253
218 3300042006 Ga0439432_023598 Ga0439432_023598_518_1294 253
219 3300042435 Ga0439434_0061109 Ga0439434_0061109_294_1067 253
220 3300044712 Ga0453684_0085375 Ga0453684_0085375_2901_3674 253
221 3300046539 Ga0495621_0000802 Ga0495621_0000802_6399_7172 253
222 3300046615 Ga0495656_0000652 Ga0495656_0000652_3716_4489 253
223 3300046615 Ga0495656_0112016 Ga0495656_0112016_80_853 253
224 3300046660 Ga0495625_0003573 Ga0495625_0003573_2940_3701 253
225 3300046664 Ga0495659_0013732 Ga0495659_0013732_342_1115 253
226 3300047318 Ga0495636_0000081 Ga0495636_0000081_18318_19091 253
227 3300047318 Ga0495636_0000535 Ga0495636_0000535_389_1162 253
228 3300047318 Ga0495636_0013742 Ga0495636_0013742_2118_2891 253
229 3300047318 Ga0495636_0024752 Ga0495636_0024752_1032_1805 253
230 3300048911 Ga0496108_0108595 Ga0496108_0108595_264_1037 253
231 3300048912 Ga0496109_0040545 Ga0496109_0040545_592_1365 253
232 3300048912 Ga0496109_0144823 Ga0496109_0144823_222_995 253
233 3300048913 Ga0496110_0347324 Ga0496110_0347324_445_1218 253
234 3300048929 Ga0496126_0254952 Ga0496126_0254952_578_1339 253
235 3300049513 Ga0501290_006213 Ga0501290_006213_710_1483 253
236 3300049569 Ga0501032_0020079 Ga0501032_0020079_2036_2797 253
237 3300049571 Ga0501034_0000585 Ga0501034_0000585_7046_7816 253
238 3300049571 Ga0501034_0010411 Ga0501034_0010411_1820_2581 253
239 3300049571 Ga0501034_0099524 Ga0501034_0099524_1556_2389 253
240 3300049572 Ga0501036_0018668 Ga0501036_0018668_2510_3271 253
241 3300049573 Ga0501037_0011730 Ga0501037_0011730_2856_3617 253
242 3300049574 Ga0501038_0190810 Ga0501038_0190810_80_850 253
243 3300049575 Ga0501039_0180973 Ga0501039_0180973_841_1602 253
244 3300049579 Ga0501043_0388360 Ga0501043_0388360_206_976 253
245 3300049581 Ga0501047_0009308 Ga0501047_0009308_654_1424 253
246 3300049581 Ga0501047_0015840 Ga0501047_0015840_1191_1961 253
247 3300049585 Ga0501069_0222820 Ga0501069_0222820_56_826 253
248 3300049586 Ga0501070_0015805 Ga0501070_0015805_458_1228 253
249 3300049587 Ga0501071_0026183 Ga0501071_0026183_2759_3529 253
250 3300049589 Ga0501073_0029779 Ga0501073_0029779_796_1566 253
251 3300049590 Ga0501074_0026869 Ga0501074_0026869_2285_3055 253
252 3300049741 Ga0501079_0080669 Ga0501079_0080669_857_1627 253
253 3300049742 Ga0501080_0343070 Ga0501080_0343070_53_823 253
254 3300049762 Ga0501265_000470 Ga0501265_000470_263_1036 253
255 3300049772 Ga0501275_000699 Ga0501275_000699_1175_1948 253
256 3300049822 Ga0501035_0044998 Ga0501035_0044998_1974_2735 253
257 3300049823 Ga0501044_0017340 Ga0501044_0017340_5504_6274 253
258 3300049823 Ga0501044_0084215 Ga0501044_0084215_2425_3186 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

38

229

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

44

282

0.93

PF08659

KR

KR domain

38

197

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5itv-assembly1.cif.gz_A crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9716 1 251
2d1y-assembly1.cif.gz_A crystal structure of tt0321 from thermus thermophilus hb8 0.971 2 251
1iy8-assembly1.cif.gz_B crystal structure of levodione reductase 0.9704 3 250
6emm-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with salicylic acid 0.9695 1 249
2d1y-assembly1.cif.gz_D crystal structure of tt0321 from thermus thermophilus hb8 0.9683 4 251
ID Description Score Start End Superfamily
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9716 1 251 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9714 4 180 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9703 3 250 3.40.50.720
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9678 1 251 3.40.50.720
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9674 2 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2U9T8L5-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9884 34 251
AF-A0A521FYD5-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9872 2 251
AF-A0A1H3AHD1-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9821 1 248 GO:0016491
AF-A0A0F2PR96-F1-model_v4 Short-chain dehydrogenase 0.981 1 251 GO:0016616
AF-A0A7X7GQP6-F1-model_v4 SDR family oxidoreductase 0.9809 1 251 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.72 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map