F368114
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 202 | 255 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300025899|Ga0207642_10030627|Ga0207642_100306272 |
| Length | 154 |
| Sequence | VQMATLRDEAFPIRSSDDIVKVRQITRELALMQTFSLVDQTKIVTAASELARNALEHGGGGEVRFEALQEGSRRGIRLTFVDQGPGIPDLEQALKDGFTTGGGMGLGLSGSKRLVNEFEIHSEVGKGTRVTIARWKWEHCDYVRVHRGTGESSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 3 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 136 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 137 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 140 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 143 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 144 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 146 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 151 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 153 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 154 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 155 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 162 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 199 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 200 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 201 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.84 |
| Metatranscriptomes | 0 |
| Isolates | 1.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.75 |
| Nodule | 0.39 |
| Rhizoplane | 1.16 |
| Rhizosphere | 88.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1019750 | 3300001977 | Bacteria | 948 |
| 2 | Ga0055526_1005210 | 3300003771 | Bacteria | 7550 |
| 3 | Ga0055524_1026499 | 3300003775 | Bacteria | 1789 |
| 4 | Ga0055536_1040567 | 3300003781 | Bacteria | 1106 |
| 5 | Ga0055531_10049676 | 3300003794 | Bacteria | 1118 |
| 6 | Ga0065165_1060044 | 3300005262 | Bacteria | 1045 |
| 7 | Ga0065707_10306115 | 3300005295 | Bacteria | 994 |
| 8 | Ga0070658_10009389 | 3300005327 | Bacteria | 7856 |
| 9 | Ga0068869_100000727 | 3300005334 | Bacteria | 18759 |
| 10 | Ga0070680_100009718 | 3300005336 | Bacteria | 7402 |
| 11 | Ga0068868_100098888 | 3300005338 | Bacteria | 2359 |
| 12 | Ga0070661_101827323 | 3300005344 | Bacteria | 516 |
| 13 | Ga0070669_100216534 | 3300005353 | Bacteria | 1513 |
| 14 | Ga0070671_101392148 | 3300005355 | Bacteria | 619 |
| 15 | Ga0070674_100171815 | 3300005356 | Bacteria | 1653 |
| 16 | Ga0070667_100350468 | 3300005367 | Bacteria | 1336 |
| 17 | Ga0070667_100565073 | 3300005367 | Bacteria | 1046 |
| 18 | Ga0070705_100000565 | 3300005440 | Bacteria | 21451 |
| 19 | Ga0070700_100540053 | 3300005441 | Bacteria | 904 |
| 20 | Ga0070694_100001696 | 3300005444 | Bacteria | 12967 |
| 21 | Ga0070694_101493238 | 3300005444 | Bacteria | 572 |
| 22 | Ga0070678_101292886 | 3300005456 | Bacteria | 678 |
| 23 | Ga0070681_10018201 | 3300005458 | Bacteria | 7024 |
| 24 | Ga0070681_10284468 | 3300005458 | Bacteria | 1564 |
| 25 | Ga0068867_100000640 | 3300005459 | Bacteria | 23146 |
| 26 | Ga0068867_100594063 | 3300005459 | Bacteria | 964 |
| 27 | Ga0070706_100405856 | 3300005467 | Bacteria | 1269 |
| 28 | Ga0070679_100089518 | 3300005530 | Bacteria | 3065 |
| 29 | Ga0068853_100354257 | 3300005539 | Bacteria | 1366 |
| 30 | Ga0068853_101383484 | 3300005539 | Bacteria | 680 |
| 31 | Ga0070686_100002616 | 3300005544 | Bacteria | 9929 |
| 32 | Ga0070696_100000527 | 3300005546 | Bacteria | 24255 |
| 33 | Ga0068855_100059672 | 3300005563 | Bacteria | 4463 |
| 34 | Ga0070664_100003611 | 3300005564 | Bacteria | 12465 |
| 35 | Ga0070664_100180686 | 3300005564 | Bacteria | 1875 |
| 36 | Ga0068857_100001468 | 3300005577 | Bacteria | 18747 |
| 37 | Ga0068854_100048525 | 3300005578 | Bacteria | 3030 |
| 38 | Ga0068856_100026141 | 3300005614 | Bacteria | 5692 |
| 39 | Ga0070702_100000209 | 3300005615 | Bacteria | 19373 |
| 40 | Ga0070702_100086346 | 3300005615 | Bacteria | 1892 |
| 41 | Ga0068852_100162082 | 3300005616 | Bacteria | 2089 |
| 42 | Ga0068859_100055748 | 3300005617 | Bacteria | 3977 |
| 43 | Ga0068859_101203293 | 3300005617 | Bacteria | 834 |
| 44 | Ga0068866_10007307 | 3300005718 | Bacteria | 4623 |
| 45 | Ga0068861_100000746 | 3300005719 | Bacteria | 19514 |
| 46 | Ga0068851_10822607 | 3300005834 | Bacteria | 578 |
| 47 | Ga0068870_10039318 | 3300005840 | Bacteria | 2447 |
| 48 | Ga0068863_100281431 | 3300005841 | Bacteria | 1611 |
| 49 | Ga0068863_100427054 | 3300005841 | Bacteria | 1299 |
| 50 | Ga0068863_100895847 | 3300005841 | Bacteria | 887 |
| 51 | Ga0068858_100023114 | 3300005842 | Bacteria | 5798 |
| 52 | Ga0068860_100024979 | 3300005843 | Bacteria | 5769 |
| 53 | Ga0068862_100003396 | 3300005844 | Bacteria | 13729 |
| 54 | Ga0081455_10010326 | 3300005937 | Bacteria | 9491 |
| 55 | Ga0081540_1002899 | 3300005983 | Bacteria | 13827 |
| 56 | Ga0081539_10000546 | 3300005985 | Bacteria | 77546 |
| 57 | Ga0075364_10001451 | 3300006051 | Bacteria | 12880 |
| 58 | Ga0097621_100042926 | 3300006237 | Bacteria | 3643 |
| 59 | Ga0097621_101104612 | 3300006237 | Bacteria | 744 |
| 60 | Ga0097621_101552599 | 3300006237 | Bacteria | 629 |
| 61 | Ga0068871_100000265 | 3300006358 | Bacteria | 36023 |
| 62 | Ga0068871_100364370 | 3300006358 | Bacteria | 1281 |
| 63 | Ga0068871_100464792 | 3300006358 | Unclassified | 1136 |
| 64 | Ga0075428_100234026 | 3300006844 | Bacteria | 1982 |
| 65 | Ga0075428_100499686 | 3300006844 | Bacteria | 1301 |
| 66 | Ga0075433_10392194 | 3300006852 | Bacteria | 1225 |
| 67 | Ga0075429_100480769 | 3300006880 | Bacteria | 1088 |
| 68 | Ga0068865_100005335 | 3300006881 | Bacteria | 7783 |
| 69 | Ga0075436_100009663 | 3300006914 | Bacteria | 6602 |
| 70 | Ga0097620_100055750 | 3300006931 | Bacteria | 3977 |
| 71 | Ga0097620_101203281 | 3300006931 | Bacteria | 834 |
| 72 | Ga0105240_10672174 | 3300009093 | Bacteria | 1133 |
| 73 | Ga0111539_10026862 | 3300009094 | Bacteria | 7033 |
| 74 | Ga0111539_10191429 | 3300009094 | Bacteria | 2387 |
| 75 | Ga0111539_12927104 | 3300009094 | Bacteria | 552 |
| 76 | Ga0105245_10005829 | 3300009098 | Bacteria | 10811 |
| 77 | Ga0105245_10859194 | 3300009098 | Bacteria | 948 |
| 78 | Ga0105247_10630940 | 3300009101 | Bacteria | 798 |
| 79 | Ga0114129_12412990 | 3300009147 | Bacteria | 630 |
| 80 | Ga0105243_10005092 | 3300009148 | Bacteria | 10312 |
| 81 | Ga0105243_10161143 | 3300009148 | Bacteria | 1934 |
| 82 | Ga0105241_10148708 | 3300009174 | Bacteria | 1914 |
| 83 | Ga0105242_10001210 | 3300009176 | Bacteria | 20394 |
| 84 | Ga0105242_10038234 | 3300009176 | Bacteria | 3859 |
| 85 | Ga0105242_13096146 | 3300009176 | Bacteria | 515 |
| 86 | Ga0105248_11804096 | 3300009177 | Bacteria | 694 |
| 87 | Ga0105237_11913197 | 3300009545 | Unclassified | 601 |
| 88 | Ga0105238_10033468 | 3300009551 | Bacteria | 5232 |
| 89 | Ga0105249_10042160 | 3300009553 | Bacteria | 4150 |
| 90 | Ga0105239_10063837 | 3300010375 | Bacteria | 4043 |
| 91 | Ga0105246_10093339 | 3300011119 | Bacteria | 2174 |
| 92 | Ga0157369_10129722 | 3300013105 | Bacteria | 2672 |
| 93 | Ga0157369_10794655 | 3300013105 | Bacteria | 972 |
| 94 | Ga0157378_10037215 | 3300013297 | Bacteria | 4309 |
| 95 | Ga0157372_10446967 | 3300013307 | Bacteria | 1506 |
| 96 | Ga0157380_11990337 | 3300014326 | Bacteria | 643 |
| 97 | Ga0157377_10052926 | 3300014745 | Bacteria | 2293 |
| 98 | Ga0157379_10185200 | 3300014968 | Bacteria | 1881 |
| 99 | Ga0157379_11714353 | 3300014968 | Unclassified | 616 |
| 100 | Ga0182006_1028562 | 3300015261 | Bacteria | 2268 |
| 101 | Ga0207425_1000064 | 3300025245 | Bacteria | 129075 |
| 102 | Ga0209129_1000101 | 3300025258 | Bacteria | 161931 |
| 103 | Ga0209130_1010166 | 3300025284 | Bacteria | 2611 |
| 104 | Ga0209676_1001122 | 3300025292 | Bacteria | 29496 |
| 105 | Ga0209025_1000048 | 3300025294 | Bacteria | 335574 |
| 106 | Ga0209564_1000097 | 3300025295 | Bacteria | 231436 |
| 107 | Ga0209758_1000056 | 3300025297 | Bacteria | 335574 |
| 108 | Ga0209050_1001470 | 3300025298 | Bacteria | 25210 |
| 109 | Ga0209256_1001057 | 3300025299 | Bacteria | 31943 |
| 110 | Ga0209051_1009454 | 3300025303 | Bacteria | 5022 |
| 111 | Ga0209051_1097689 | 3300025303 | Bacteria | 798 |
| 112 | Ga0209257_1000049 | 3300025304 | Bacteria | 441224 |
| 113 | Ga0209257_1001446 | 3300025304 | Bacteria | 28071 |
| 114 | Ga0207653_10192296 | 3300025885 | Bacteria | 767 |
| 115 | Ga0207642_10030627 | 3300025899 | Bacteria | 2244 |
| 116 | Ga0207642_10034811 | 3300025899 | Bacteria | 2145 |
| 117 | Ga0207643_10018663 | 3300025908 | Bacteria | 3798 |
| 118 | Ga0207654_10105205 | 3300025911 | Bacteria | 1746 |
| 119 | Ga0207707_10016365 | 3300025912 | Bacteria | 6469 |
| 120 | Ga0207707_10058352 | 3300025912 | Bacteria | 3359 |
| 121 | Ga0207693_10314888 | 3300025915 | Bacteria | 1225 |
| 122 | Ga0207660_10001221 | 3300025917 | Bacteria | 17201 |
| 123 | Ga0207662_10000423 | 3300025918 | Bacteria | 18688 |
| 124 | Ga0207649_10009259 | 3300025920 | Bacteria | 5387 |
| 125 | Ga0207652_10268857 | 3300025921 | Bacteria | 1538 |
| 126 | Ga0207652_10462255 | 3300025921 | Bacteria | 1144 |
| 127 | Ga0207694_10018361 | 3300025924 | Bacteria | 5287 |
| 128 | Ga0207659_10582558 | 3300025926 | Bacteria | 953 |
| 129 | Ga0207687_10013843 | 3300025927 | Bacteria | 5268 |
| 130 | Ga0207687_10677550 | 3300025927 | Bacteria | 874 |
| 131 | Ga0207644_11088600 | 3300025931 | Unclassified | 671 |
| 132 | Ga0207644_11267580 | 3300025931 | Bacteria | 619 |
| 133 | Ga0207706_10822845 | 3300025933 | Bacteria | 788 |
| 134 | Ga0207686_10005460 | 3300025934 | Bacteria | 6824 |
| 135 | Ga0207686_10008653 | 3300025934 | Bacteria | 5496 |
| 136 | Ga0207709_10008014 | 3300025935 | Bacteria | 5852 |
| 137 | Ga0207670_10003051 | 3300025936 | Bacteria | 8840 |
| 138 | Ga0207669_10243293 | 3300025937 | Bacteria | 1335 |
| 139 | Ga0207704_10020249 | 3300025938 | Bacteria | 3515 |
| 140 | Ga0207711_10070863 | 3300025941 | Bacteria | 3023 |
| 141 | Ga0207711_11154164 | 3300025941 | Bacteria | 716 |
| 142 | Ga0207689_10001695 | 3300025942 | Bacteria | 20948 |
| 143 | Ga0207661_10137677 | 3300025944 | Bacteria | 2098 |
| 144 | Ga0207661_10877370 | 3300025944 | Bacteria | 826 |
| 145 | Ga0207679_10000134 | 3300025945 | Bacteria | 60399 |
| 146 | Ga0207667_10082522 | 3300025949 | Bacteria | 3329 |
| 147 | Ga0207712_10148663 | 3300025961 | Bacteria | 1807 |
| 148 | Ga0207640_10039144 | 3300025981 | Bacteria | 2998 |
| 149 | Ga0207658_10289897 | 3300025986 | Bacteria | 1406 |
| 150 | Ga0207677_10035893 | 3300026023 | Bacteria | 3224 |
| 151 | Ga0207703_10021294 | 3300026035 | Bacteria | 5076 |
| 152 | Ga0207703_11736562 | 3300026035 | Bacteria | 600 |
| 153 | Ga0207708_10000723 | 3300026075 | Bacteria | 24861 |
| 154 | Ga0207708_10297086 | 3300026075 | Bacteria | 1313 |
| 155 | Ga0207641_10366492 | 3300026088 | Bacteria | 1377 |
| 156 | Ga0207648_10001968 | 3300026089 | Bacteria | 22433 |
| 157 | Ga0207648_10955562 | 3300026089 | Bacteria | 802 |
| 158 | Ga0207674_10004119 | 3300026116 | Bacteria | 17598 |
| 159 | Ga0207675_100001083 | 3300026118 | Bacteria | 26980 |
| 160 | Ga0207675_100047281 | 3300026118 | Bacteria | 4018 |
| 161 | Ga0207683_10860825 | 3300026121 | Unclassified | 841 |
| 162 | Ga0207683_11151641 | 3300026121 | Bacteria | 719 |
| 163 | Ga0207698_10186532 | 3300026142 | Bacteria | 1843 |
| 164 | Ga0207428_10010570 | 3300027907 | Bacteria | 8236 |
| 165 | Ga0207428_10106169 | 3300027907 | Bacteria | 2165 |
| 166 | Ga0268265_10127683 | 3300028380 | Bacteria | 2107 |
| 167 | Ga0268264_10018627 | 3300028381 | Bacteria | 5676 |
| 168 | Ga0265327_10009940 | 3300031251 | Bacteria | 6779 |
| 169 | Ga0307408_100759611 | 3300031548 | Bacteria | 876 |
| 170 | Ga0307405_10170779 | 3300031731 | Bacteria | 1551 |
| 171 | Ga0307412_10083782 | 3300031911 | Bacteria | 2212 |
| 172 | Ga0373948_0001296 | 3300034817 | Bacteria | 3427 |
| 173 | Ga0373958_0060132 | 3300034819 | Bacteria | 821 |
| 174 | Ga0373959_0024693 | 3300034820 | Bacteria | 1176 |
| 175 | Ga0373928_0034542 | 3300035084 | Bacteria | 1135 |
| 176 | Ga0373929_0028274 | 3300035085 | Bacteria | 1183 |
| 177 | Ga0373940_0001252 | 3300035088 | Bacteria | 4506 |
| 178 | Ga0373949_0077074 | 3300035090 | Bacteria | 882 |
| 179 | Ga0373951_0008636 | 3300035091 | Bacteria | 2296 |
| 180 | Ga0373952_0015368 | 3300035092 | Bacteria | 1545 |
| 181 | Ga0373932_0001721 | 3300035112 | Bacteria | 5942 |
| 182 | Ga0373939_0006109 | 3300035114 | Bacteria | 2894 |
| 183 | Ga0373941_0133154 | 3300035115 | Bacteria | 897 |
| 184 | Ga0373942_0001712 | 3300035207 | Bacteria | 5571 |
| 185 | Ga0373962_0013935 | 3300035242 | Bacteria | 2043 |
| 186 | Ga0373931_0001276 | 3300035691 | Bacteria | 10750 |
| 187 | Ga0373931_0206159 | 3300035691 | Bacteria | 1177 |
| 188 | Ga0436364_0152053 | 3300037853 | Bacteria | 1195 |
| 189 | Ga0451807_2265722 | 3300041486 | Bacteria | 685 |
| 190 | Ga0451855_1592122 | 3300041511 | Bacteria | 606 |
| 191 | Ga0451577_0071553 | 3300042876 | Bacteria | 3093 |
| 192 | Ga0466963_0842184 | 3300044694 | Bacteria | 647 |
| 193 | Ga0453684_0132670 | 3300044712 | Bacteria | 2987 |
| 194 | Ga0451576_0024704 | 3300045051 | Bacteria | 6487 |
| 195 | Ga0451576_0026283 | 3300045051 | Bacteria | 6263 |
| 196 | Ga0451576_0144107 | 3300045051 | Bacteria | 2484 |
| 197 | Ga0495670_0314568 | 3300046691 | Bacteria | 840 |
| 198 | Ga0495676_0927981 | 3300047321 | Bacteria | 557 |
| 199 | Ga0495686_0010877 | 3300047472 | Bacteria | 6443 |
| 200 | Ga0496102_0001445 | 3300048905 | Bacteria | 21038 |
| 201 | Ga0496105_0936935 | 3300048908 | Bacteria | 651 |
| 202 | Ga0496124_0289677 | 3300048927 | Bacteria | 1189 |
| 203 | Ga0496126_0588630 | 3300048929 | Bacteria | 878 |
| 204 | Ga0501031_0054323 | 3300049568 | Bacteria | 2610 |
| 205 | Ga0501032_0157962 | 3300049569 | Bacteria | 1489 |
| 206 | Ga0501033_0056311 | 3300049570 | Bacteria | 2906 |
| 207 | Ga0501034_0417410 | 3300049571 | Bacteria | 1263 |
| 208 | Ga0501036_0005213 | 3300049572 | Bacteria | 10510 |
| 209 | Ga0501037_0029804 | 3300049573 | Bacteria | 4032 |
| 210 | Ga0501038_0002185 | 3300049574 | Bacteria | 18181 |
| 211 | Ga0501039_0003882 | 3300049575 | Bacteria | 11222 |
| 212 | Ga0501040_0011503 | 3300049576 | Bacteria | 5792 |
| 213 | Ga0501040_1173879 | 3300049576 | Bacteria | 557 |
| 214 | Ga0501042_0004075 | 3300049578 | Bacteria | 9275 |
| 215 | Ga0501043_0025366 | 3300049579 | Bacteria | 4651 |
| 216 | Ga0501048_0005843 | 3300049582 | Bacteria | 9361 |
| 217 | Ga0501068_0016373 | 3300049584 | Bacteria | 4274 |
| 218 | Ga0501069_0324147 | 3300049585 | Bacteria | 905 |
| 219 | Ga0501070_0082900 | 3300049586 | Bacteria | 2654 |
| 220 | Ga0501071_0000754 | 3300049587 | Bacteria | 17136 |
| 221 | Ga0501072_0001246 | 3300049588 | Bacteria | 19005 |
| 222 | Ga0501072_0155321 | 3300049588 | Bacteria | 1825 |
| 223 | Ga0501072_0798789 | 3300049588 | Bacteria | 739 |
| 224 | Ga0501073_0047106 | 3300049589 | Bacteria | 3030 |
| 225 | Ga0501074_0003120 | 3300049590 | Bacteria | 11683 |
| 226 | Ga0501074_0943992 | 3300049590 | Bacteria | 607 |
| 227 | Ga0501075_0000757 | 3300049591 | Bacteria | 20166 |
| 228 | Ga0501075_0310926 | 3300049591 | Bacteria | 1201 |
| 229 | Ga0501075_0474612 | 3300049591 | Bacteria | 954 |
| 230 | Ga0501076_0028581 | 3300049592 | Bacteria | 4330 |
| 231 | Ga0501077_0033224 | 3300049593 | Bacteria | 3283 |
| 232 | Ga0501079_0001026 | 3300049741 | Bacteria | 19370 |
| 233 | Ga0501079_0228185 | 3300049741 | Bacteria | 1455 |
| 234 | Ga0501080_0009898 | 3300049742 | Bacteria | 8710 |
| 235 | Ga0501080_0027381 | 3300049742 | Bacteria | 5300 |
| 236 | Ga0501081_0001303 | 3300049743 | Bacteria | 15198 |
| 237 | Ga0501081_0400022 | 3300049743 | Bacteria | 1017 |
| 238 | Ga0501035_0022048 | 3300049822 | Bacteria | 5851 |
| 239 | Ga0501045_0001777 | 3300049824 | Bacteria | 14560 |
| 240 | nmdc:mga00v17_63656_c1 | 3300050491 | Bacteria | 2272 |
| 241 | nmdc:mga09592_492114_c1 | 3300050508 | Bacteria | 1056 |
| 242 | nmdc:mga08y16_2349_c1 | 3300050511 | Bacteria | 19391 |
| 243 | nmdc:mga08y16_266177_c1 | 3300050511 | Bacteria | 1770 |
| 244 | nmdc:mga08y16_285588_c1 | 3300050511 | Bacteria | 1701 |
| 245 | nmdc:mga0n895_380929_c1 | 3300050512 | Bacteria | 1427 |
| 246 | nmdc:mga08x19_163466_c1 | 3300050514 | Bacteria | 1513 |
| 247 | nmdc:mga0a205_256702_c1 | 3300050515 | Bacteria | 1626 |
| 248 | Ga0501084_0000115 | 3300054114 | Bacteria | 60964 |
| 249 | Ga0590071_014365 | 3300059421 | Bacteria | 1857 |
| 250 | Ga0590074_017280 | 3300059423 | Bacteria | 1231 |
| 251 | Ga0590077_013167 | 3300059426 | Bacteria | 1719 |
| 252 | Ga0501082_0004211 | 3300060353 | Bacteria | 12568 |
| 253 | Ga0530510_0001687 | 3300061734 | Bacteria | 14960 |
| 254 | Ga0530510_0407938 | 3300061734 | Bacteria | 1025 |
| 255 | Ga0530510_0725588 | 3300061734 | Bacteria | 758 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006237 | Ga0097621_101552599 | Ga0097621_1015525991 | 106 |
| 2 | 3300048908 | Ga0496105_0936935 | Ga0496105_0936935_93_440 | 107 |
| 3 | 3300049588 | Ga0501072_0798789 | Ga0501072_0798789_348_695 | 107 |
| 4 | 3300049591 | Ga0501075_0474612 | Ga0501075_0474612_413_760 | 107 |
| 5 | 3300009093 | Ga0105240_10672174 | Ga0105240_106721741 | 116 |
| 6 | 3300009174 | Ga0105241_10148708 | Ga0105241_101487083 | 116 |
| 7 | 3300010375 | Ga0105239_10063837 | Ga0105239_100638374 | 116 |
| 8 | 3300031548 | Ga0307408_100759611 | Ga0307408_1007596111 | 116 |
| 9 | 3300031731 | Ga0307405_10170779 | Ga0307405_101707792 | 116 |
| 10 | 3300031911 | Ga0307412_10083782 | Ga0307412_100837822 | 116 |
| 11 | 3300035242 | Ga0373962_0013935 | Ga0373962_0013935_1593_1967 | 116 |
| 12 | 3300005441 | Ga0070700_100540053 | Ga0070700_1005400531 | 118 |
| 13 | 3300005456 | Ga0070678_101292886 | Ga0070678_1012928862 | 118 |
| 14 | 3300005459 | Ga0068867_100594063 | Ga0068867_1005940632 | 118 |
| 15 | 3300005539 | Ga0068853_101383484 | Ga0068853_1013834841 | 118 |
| 16 | 3300005615 | Ga0070702_100086346 | Ga0070702_1000863463 | 118 |
| 17 | 3300006852 | Ga0075433_10392194 | Ga0075433_103921942 | 118 |
| 18 | 3300009094 | Ga0111539_10026862 | Ga0111539_100268626 | 118 |
| 19 | 3300027907 | Ga0207428_10106169 | Ga0207428_101061693 | 118 |
| 20 | 3300050511 | nmdc:mga08y16_266177_c1 | nmdc:mga08y16_266177_c1_1030_1410 | 118 |
| 21 | 3300050515 | nmdc:mga0a205_256702_c1 | nmdc:mga0a205_256702_c1_697_1077 | 118 |
| 22 | 3300006914 | Ga0075436_100009663 | Ga0075436_1000096638 | 120 |
| 23 | 3300050514 | nmdc:mga08x19_163466_c1 | nmdc:mga08x19_163466_c1_1096_1491 | 120 |
| 24 | 3300005614 | Ga0068856_100026141 | Ga0068856_1000261412 | 121 |
| 25 | 3300009176 | Ga0105242_13096146 | Ga0105242_130961462 | 121 |
| 26 | 3300049571 | Ga0501034_0417410 | Ga0501034_0417410_575_964 | 121 |
| 27 | 3300005344 | Ga0070661_101827323 | Ga0070661_1018273231 | 122 |
| 28 | 3300006051 | Ga0075364_10001451 | Ga0075364_1000145112 | 122 |
| 29 | 3300045051 | Ga0451576_0144107 | Ga0451576_0144107_66_473 | 122 |
| 30 | 3300050491 | nmdc:mga00v17_63656_c1 | nmdc:mga00v17_63656_c1_338_751 | 122 |
| 31 | 3300001977 | JGI24746J21847_1019750 | JGI24746J21847_10197502 | 123 |
| 32 | 3300003771 | Ga0055526_1005210 | Ga0055526_10052103 | 123 |
| 33 | 3300003775 | Ga0055524_1026499 | Ga0055524_10264992 | 123 |
| 34 | 3300003781 | Ga0055536_1040567 | Ga0055536_10405673 | 123 |
| 35 | 3300003794 | Ga0055531_10049676 | Ga0055531_100496762 | 123 |
| 36 | 3300005262 | Ga0065165_1060044 | Ga0065165_10600441 | 123 |
| 37 | 3300005295 | Ga0065707_10306115 | Ga0065707_103061152 | 123 |
| 38 | 3300005327 | Ga0070658_10009389 | Ga0070658_100093894 | 123 |
| 39 | 3300005334 | Ga0068869_100000727 | Ga0068869_10000072720 | 123 |
| 40 | 3300005336 | Ga0070680_100009718 | Ga0070680_1000097187 | 123 |
| 41 | 3300005338 | Ga0068868_100098888 | Ga0068868_1000988882 | 123 |
| 42 | 3300005353 | Ga0070669_100216534 | Ga0070669_1002165342 | 123 |
| 43 | 3300005355 | Ga0070671_101392148 | Ga0070671_1013921481 | 123 |
| 44 | 3300005356 | Ga0070674_100171815 | Ga0070674_1001718153 | 123 |
| 45 | 3300005367 | Ga0070667_100350468 | Ga0070667_1003504682 | 123 |
| 46 | 3300005367 | Ga0070667_100565073 | Ga0070667_1005650732 | 123 |
| 47 | 3300005440 | Ga0070705_100000565 | Ga0070705_1000005653 | 123 |
| 48 | 3300005444 | Ga0070694_100001696 | Ga0070694_1000016964 | 123 |
| 49 | 3300005444 | Ga0070694_101493238 | Ga0070694_1014932381 | 123 |
| 50 | 3300005458 | Ga0070681_10018201 | Ga0070681_100182014 | 123 |
| 51 | 3300005458 | Ga0070681_10284468 | Ga0070681_102844682 | 123 |
| 52 | 3300005459 | Ga0068867_100000640 | Ga0068867_10000064016 | 123 |
| 53 | 3300005467 | Ga0070706_100405856 | Ga0070706_1004058563 | 123 |
| 54 | 3300005530 | Ga0070679_100089518 | Ga0070679_1000895183 | 123 |
| 55 | 3300005539 | Ga0068853_100354257 | Ga0068853_1003542572 | 123 |
| 56 | 3300005544 | Ga0070686_100002616 | Ga0070686_1000026163 | 123 |
| 57 | 3300005546 | Ga0070696_100000527 | Ga0070696_10000052721 | 123 |
| 58 | 3300005563 | Ga0068855_100059672 | Ga0068855_1000596723 | 123 |
| 59 | 3300005564 | Ga0070664_100003611 | Ga0070664_1000036115 | 123 |
| 60 | 3300005564 | Ga0070664_100180686 | Ga0070664_1001806863 | 123 |
| 61 | 3300005577 | Ga0068857_100001468 | Ga0068857_1000014685 | 123 |
| 62 | 3300005578 | Ga0068854_100048525 | Ga0068854_1000485252 | 123 |
| 63 | 3300005615 | Ga0070702_100000209 | Ga0070702_10000020913 | 123 |
| 64 | 3300005616 | Ga0068852_100162082 | Ga0068852_1001620822 | 123 |
| 65 | 3300005617 | Ga0068859_100055748 | Ga0068859_1000557482 | 123 |
| 66 | 3300005617 | Ga0068859_101203293 | Ga0068859_1012032932 | 123 |
| 67 | 3300005718 | Ga0068866_10007307 | Ga0068866_100073074 | 123 |
| 68 | 3300005719 | Ga0068861_100000746 | Ga0068861_10000074612 | 123 |
| 69 | 3300005834 | Ga0068851_10822607 | Ga0068851_108226071 | 123 |
| 70 | 3300005840 | Ga0068870_10039318 | Ga0068870_100393183 | 123 |
| 71 | 3300005841 | Ga0068863_100281431 | Ga0068863_1002814311 | 123 |
| 72 | 3300005841 | Ga0068863_100427054 | Ga0068863_1004270543 | 123 |
| 73 | 3300005841 | Ga0068863_100895847 | Ga0068863_1008958472 | 123 |
| 74 | 3300005842 | Ga0068858_100023114 | Ga0068858_1000231144 | 123 |
| 75 | 3300005843 | Ga0068860_100024979 | Ga0068860_1000249794 | 123 |
| 76 | 3300005844 | Ga0068862_100003396 | Ga0068862_1000033963 | 123 |
| 77 | 3300005937 | Ga0081455_10010326 | Ga0081455_100103264 | 123 |
| 78 | 3300005983 | Ga0081540_1002899 | Ga0081540_10028999 | 123 |
| 79 | 3300005985 | Ga0081539_10000546 | Ga0081539_1000054660 | 123 |
| 80 | 3300006237 | Ga0097621_100042926 | Ga0097621_1000429262 | 123 |
| 81 | 3300006237 | Ga0097621_101104612 | Ga0097621_1011046122 | 123 |
| 82 | 3300006358 | Ga0068871_100000265 | Ga0068871_10000026530 | 123 |
| 83 | 3300006358 | Ga0068871_100364370 | Ga0068871_1003643702 | 123 |
| 84 | 3300006358 | Ga0068871_100464792 | Ga0068871_1004647923 | 123 |
| 85 | 3300006844 | Ga0075428_100234026 | Ga0075428_1002340262 | 123 |
| 86 | 3300006844 | Ga0075428_100499686 | Ga0075428_1004996862 | 123 |
| 87 | 3300006880 | Ga0075429_100480769 | Ga0075429_1004807692 | 123 |
| 88 | 3300006881 | Ga0068865_100005335 | Ga0068865_1000053359 | 123 |
| 89 | 3300006931 | Ga0097620_100055750 | Ga0097620_1000557502 | 123 |
| 90 | 3300006931 | Ga0097620_101203281 | Ga0097620_1012032812 | 123 |
| 91 | 3300009094 | Ga0111539_10191429 | Ga0111539_101914292 | 123 |
| 92 | 3300009094 | Ga0111539_12927104 | Ga0111539_129271042 | 123 |
| 93 | 3300009098 | Ga0105245_10005829 | Ga0105245_1000582911 | 123 |
| 94 | 3300009098 | Ga0105245_10859194 | Ga0105245_108591942 | 123 |
| 95 | 3300009101 | Ga0105247_10630940 | Ga0105247_106309402 | 123 |
| 96 | 3300009147 | Ga0114129_12412990 | Ga0114129_124129902 | 123 |
| 97 | 3300009148 | Ga0105243_10005092 | Ga0105243_100050923 | 123 |
| 98 | 3300009148 | Ga0105243_10161143 | Ga0105243_101611432 | 123 |
| 99 | 3300009176 | Ga0105242_10001210 | Ga0105242_1000121010 | 123 |
| 100 | 3300009176 | Ga0105242_10038234 | Ga0105242_100382343 | 123 |
| 101 | 3300009177 | Ga0105248_11804096 | Ga0105248_118040962 | 123 |
| 102 | 3300009545 | Ga0105237_11913197 | Ga0105237_119131972 | 123 |
| 103 | 3300009551 | Ga0105238_10033468 | Ga0105238_100334683 | 123 |
| 104 | 3300009553 | Ga0105249_10042160 | Ga0105249_100421603 | 123 |
| 105 | 3300011119 | Ga0105246_10093339 | Ga0105246_100933393 | 123 |
| 106 | 3300013105 | Ga0157369_10129722 | Ga0157369_101297223 | 123 |
| 107 | 3300013105 | Ga0157369_10794655 | Ga0157369_107946552 | 123 |
| 108 | 3300013297 | Ga0157378_10037215 | Ga0157378_100372153 | 123 |
| 109 | 3300013307 | Ga0157372_10446967 | Ga0157372_104469672 | 123 |
| 110 | 3300014326 | Ga0157380_11990337 | Ga0157380_119903372 | 123 |
| 111 | 3300014745 | Ga0157377_10052926 | Ga0157377_100529262 | 123 |
| 112 | 3300014968 | Ga0157379_10185200 | Ga0157379_101852002 | 123 |
| 113 | 3300014968 | Ga0157379_11714353 | Ga0157379_117143531 | 123 |
| 114 | 3300015261 | Ga0182006_1028562 | Ga0182006_10285623 | 123 |
| 115 | 3300025245 | Ga0207425_1000064 | Ga0207425_100006476 | 123 |
| 116 | 3300025258 | Ga0209129_1000101 | Ga0209129_100010176 | 123 |
| 117 | 3300025284 | Ga0209130_1010166 | Ga0209130_10101664 | 123 |
| 118 | 3300025292 | Ga0209676_1001122 | Ga0209676_100112220 | 123 |
| 119 | 3300025294 | Ga0209025_1000048 | Ga0209025_1000048170 | 123 |
| 120 | 3300025295 | Ga0209564_1000097 | Ga0209564_100009784 | 123 |
| 121 | 3300025297 | Ga0209758_1000056 | Ga0209758_1000056170 | 123 |
| 122 | 3300025298 | Ga0209050_1001470 | Ga0209050_100147017 | 123 |
| 123 | 3300025299 | Ga0209256_1001057 | Ga0209256_100105710 | 123 |
| 124 | 3300025303 | Ga0209051_1009454 | Ga0209051_10094547 | 123 |
| 125 | 3300025303 | Ga0209051_1097689 | Ga0209051_10976892 | 123 |
| 126 | 3300025304 | Ga0209257_1000049 | Ga0209257_100004954 | 123 |
| 127 | 3300025304 | Ga0209257_1001446 | Ga0209257_100144618 | 123 |
| 128 | 3300025885 | Ga0207653_10192296 | Ga0207653_101922962 | 123 |
| 129 | 3300025899 | Ga0207642_10030627 | Ga0207642_100306272 | 123 |
| 130 | 3300025899 | Ga0207642_10034811 | Ga0207642_100348112 | 123 |
| 131 | 3300025908 | Ga0207643_10018663 | Ga0207643_100186633 | 123 |
| 132 | 3300025911 | Ga0207654_10105205 | Ga0207654_101052052 | 123 |
| 133 | 3300025912 | Ga0207707_10016365 | Ga0207707_100163652 | 123 |
| 134 | 3300025912 | Ga0207707_10058352 | Ga0207707_100583522 | 123 |
| 135 | 3300025915 | Ga0207693_10314888 | Ga0207693_103148883 | 123 |
| 136 | 3300025917 | Ga0207660_10001221 | Ga0207660_100012213 | 123 |
| 137 | 3300025918 | Ga0207662_10000423 | Ga0207662_1000042311 | 123 |
| 138 | 3300025920 | Ga0207649_10009259 | Ga0207649_100092596 | 123 |
| 139 | 3300025921 | Ga0207652_10268857 | Ga0207652_102688571 | 123 |
| 140 | 3300025921 | Ga0207652_10462255 | Ga0207652_104622551 | 123 |
| 141 | 3300025924 | Ga0207694_10018361 | Ga0207694_100183614 | 123 |
| 142 | 3300025926 | Ga0207659_10582558 | Ga0207659_105825582 | 123 |
| 143 | 3300025927 | Ga0207687_10013843 | Ga0207687_100138433 | 123 |
| 144 | 3300025927 | Ga0207687_10677550 | Ga0207687_106775502 | 123 |
| 145 | 3300025931 | Ga0207644_11088600 | Ga0207644_110886002 | 123 |
| 146 | 3300025931 | Ga0207644_11267580 | Ga0207644_112675801 | 123 |
| 147 | 3300025933 | Ga0207706_10822845 | Ga0207706_108228452 | 123 |
| 148 | 3300025934 | Ga0207686_10005460 | Ga0207686_100054602 | 123 |
| 149 | 3300025934 | Ga0207686_10008653 | Ga0207686_100086534 | 123 |
| 150 | 3300025935 | Ga0207709_10008014 | Ga0207709_100080143 | 123 |
| 151 | 3300025936 | Ga0207670_10003051 | Ga0207670_1000305110 | 123 |
| 152 | 3300025937 | Ga0207669_10243293 | Ga0207669_102432932 | 123 |
| 153 | 3300025938 | Ga0207704_10020249 | Ga0207704_100202494 | 123 |
| 154 | 3300025941 | Ga0207711_10070863 | Ga0207711_100708633 | 123 |
| 155 | 3300025941 | Ga0207711_11154164 | Ga0207711_111541642 | 123 |
| 156 | 3300025942 | Ga0207689_10001695 | Ga0207689_100016953 | 123 |
| 157 | 3300025944 | Ga0207661_10137677 | Ga0207661_101376772 | 123 |
| 158 | 3300025944 | Ga0207661_10877370 | Ga0207661_108773701 | 123 |
| 159 | 3300025945 | Ga0207679_10000134 | Ga0207679_1000013438 | 123 |
| 160 | 3300025949 | Ga0207667_10082522 | Ga0207667_100825223 | 123 |
| 161 | 3300025961 | Ga0207712_10148663 | Ga0207712_101486633 | 123 |
| 162 | 3300025981 | Ga0207640_10039144 | Ga0207640_100391442 | 123 |
| 163 | 3300025986 | Ga0207658_10289897 | Ga0207658_102898972 | 123 |
| 164 | 3300026023 | Ga0207677_10035893 | Ga0207677_100358934 | 123 |
| 165 | 3300026035 | Ga0207703_10021294 | Ga0207703_100212944 | 123 |
| 166 | 3300026035 | Ga0207703_11736562 | Ga0207703_117365622 | 123 |
| 167 | 3300026075 | Ga0207708_10000723 | Ga0207708_1000072311 | 123 |
| 168 | 3300026075 | Ga0207708_10297086 | Ga0207708_102970862 | 123 |
| 169 | 3300026088 | Ga0207641_10366492 | Ga0207641_103664923 | 123 |
| 170 | 3300026089 | Ga0207648_10001968 | Ga0207648_100019684 | 123 |
| 171 | 3300026089 | Ga0207648_10955562 | Ga0207648_109555622 | 123 |
| 172 | 3300026116 | Ga0207674_10004119 | Ga0207674_100041193 | 123 |
| 173 | 3300026118 | Ga0207675_100001083 | Ga0207675_10000108329 | 123 |
| 174 | 3300026118 | Ga0207675_100047281 | Ga0207675_1000472814 | 123 |
| 175 | 3300026121 | Ga0207683_10860825 | Ga0207683_108608252 | 123 |
| 176 | 3300026121 | Ga0207683_11151641 | Ga0207683_111516412 | 123 |
| 177 | 3300026142 | Ga0207698_10186532 | Ga0207698_101865322 | 123 |
| 178 | 3300027907 | Ga0207428_10010570 | Ga0207428_100105706 | 123 |
| 179 | 3300028380 | Ga0268265_10127683 | Ga0268265_101276833 | 123 |
| 180 | 3300028381 | Ga0268264_10018627 | Ga0268264_100186274 | 123 |
| 181 | 3300031251 | Ga0265327_10009940 | Ga0265327_100099403 | 123 |
| 182 | 3300034817 | Ga0373948_0001296 | Ga0373948_0001296_1754_2185 | 123 |
| 183 | 3300034819 | Ga0373958_0060132 | Ga0373958_0060132_31_462 | 123 |
| 184 | 3300034820 | Ga0373959_0024693 | Ga0373959_0024693_287_718 | 123 |
| 185 | 3300035084 | Ga0373928_0034542 | Ga0373928_0034542_212_643 | 123 |
| 186 | 3300035085 | Ga0373929_0028274 | Ga0373929_0028274_629_1060 | 123 |
| 187 | 3300035088 | Ga0373940_0001252 | Ga0373940_0001252_2458_2889 | 123 |
| 188 | 3300035090 | Ga0373949_0077074 | Ga0373949_0077074_150_581 | 123 |
| 189 | 3300035091 | Ga0373951_0008636 | Ga0373951_0008636_280_711 | 123 |
| 190 | 3300035092 | Ga0373952_0015368 | Ga0373952_0015368_980_1411 | 123 |
| 191 | 3300035112 | Ga0373932_0001721 | Ga0373932_0001721_3407_3838 | 123 |
| 192 | 3300035114 | Ga0373939_0006109 | Ga0373939_0006109_866_1297 | 123 |
| 193 | 3300035115 | Ga0373941_0133154 | Ga0373941_0133154_405_827 | 123 |
| 194 | 3300035207 | Ga0373942_0001712 | Ga0373942_0001712_4662_5093 | 123 |
| 195 | 3300035691 | Ga0373931_0001276 | Ga0373931_0001276_441_872 | 123 |
| 196 | 3300035691 | Ga0373931_0206159 | Ga0373931_0206159_32_439 | 123 |
| 197 | 3300037853 | Ga0436364_0152053 | Ga0436364_0152053_289_690 | 123 |
| 198 | 3300041486 | Ga0451807_2265722 | Ga0451807_2265722_184_648 | 123 |
| 199 | 3300041511 | Ga0451855_1592122 | Ga0451855_1592122_23_469 | 123 |
| 200 | 3300042876 | Ga0451577_0071553 | Ga0451577_0071553_948_1349 | 123 |
| 201 | 3300044694 | Ga0466963_0842184 | Ga0466963_0842184_24_431 | 123 |
| 202 | 3300044712 | Ga0453684_0132670 | Ga0453684_0132670_1140_1541 | 123 |
| 203 | 3300045051 | Ga0451576_0024704 | Ga0451576_0024704_3658_4089 | 123 |
| 204 | 3300045051 | Ga0451576_0026283 | Ga0451576_0026283_69_470 | 123 |
| 205 | 3300046691 | Ga0495670_0314568 | Ga0495670_0314568_218_628 | 123 |
| 206 | 3300047321 | Ga0495676_0927981 | Ga0495676_0927981_103_507 | 123 |
| 207 | 3300047472 | Ga0495686_0010877 | Ga0495686_0010877_2647_3069 | 123 |
| 208 | 3300048905 | Ga0496102_0001445 | Ga0496102_0001445_19142_19564 | 123 |
| 209 | 3300048927 | Ga0496124_0289677 | Ga0496124_0289677_377_778 | 123 |
| 210 | 3300048929 | Ga0496126_0588630 | Ga0496126_0588630_12_413 | 123 |
| 211 | 3300049568 | Ga0501031_0054323 | Ga0501031_0054323_840_1244 | 123 |
| 212 | 3300049569 | Ga0501032_0157962 | Ga0501032_0157962_299_703 | 123 |
| 213 | 3300049570 | Ga0501033_0056311 | Ga0501033_0056311_1053_1457 | 123 |
| 214 | 3300049572 | Ga0501036_0005213 | Ga0501036_0005213_5632_6036 | 123 |
| 215 | 3300049573 | Ga0501037_0029804 | Ga0501037_0029804_1626_2030 | 123 |
| 216 | 3300049574 | Ga0501038_0002185 | Ga0501038_0002185_12972_13376 | 123 |
| 217 | 3300049575 | Ga0501039_0003882 | Ga0501039_0003882_3713_4117 | 123 |
| 218 | 3300049576 | Ga0501040_0011503 | Ga0501040_0011503_1521_1925 | 123 |
| 219 | 3300049576 | Ga0501040_1173879 | Ga0501040_1173879_124_528 | 123 |
| 220 | 3300049578 | Ga0501042_0004075 | Ga0501042_0004075_7319_7723 | 123 |
| 221 | 3300049579 | Ga0501043_0025366 | Ga0501043_0025366_2744_3148 | 123 |
| 222 | 3300049582 | Ga0501048_0005843 | Ga0501048_0005843_2282_2686 | 123 |
| 223 | 3300049584 | Ga0501068_0016373 | Ga0501068_0016373_1828_2232 | 123 |
| 224 | 3300049585 | Ga0501069_0324147 | Ga0501069_0324147_469_873 | 123 |
| 225 | 3300049586 | Ga0501070_0082900 | Ga0501070_0082900_2009_2413 | 123 |
| 226 | 3300049587 | Ga0501071_0000754 | Ga0501071_0000754_5521_5925 | 123 |
| 227 | 3300049588 | Ga0501072_0001246 | Ga0501072_0001246_7217_7621 | 123 |
| 228 | 3300049588 | Ga0501072_0155321 | Ga0501072_0155321_1342_1746 | 123 |
| 229 | 3300049589 | Ga0501073_0047106 | Ga0501073_0047106_623_1027 | 123 |
| 230 | 3300049590 | Ga0501074_0003120 | Ga0501074_0003120_9751_10155 | 123 |
| 231 | 3300049590 | Ga0501074_0943992 | Ga0501074_0943992_170_574 | 123 |
| 232 | 3300049591 | Ga0501075_0000757 | Ga0501075_0000757_10686_11090 | 123 |
| 233 | 3300049591 | Ga0501075_0310926 | Ga0501075_0310926_17_421 | 123 |
| 234 | 3300049592 | Ga0501076_0028581 | Ga0501076_0028581_2721_3125 | 123 |
| 235 | 3300049593 | Ga0501077_0033224 | Ga0501077_0033224_1303_1707 | 123 |
| 236 | 3300049741 | Ga0501079_0001026 | Ga0501079_0001026_7437_7841 | 123 |
| 237 | 3300049741 | Ga0501079_0228185 | Ga0501079_0228185_443_847 | 123 |
| 238 | 3300049742 | Ga0501080_0009898 | Ga0501080_0009898_3804_4208 | 123 |
| 239 | 3300049742 | Ga0501080_0027381 | Ga0501080_0027381_1529_1933 | 123 |
| 240 | 3300049743 | Ga0501081_0001303 | Ga0501081_0001303_4907_5311 | 123 |
| 241 | 3300049743 | Ga0501081_0400022 | Ga0501081_0400022_462_866 | 123 |
| 242 | 3300049822 | Ga0501035_0022048 | Ga0501035_0022048_418_822 | 123 |
| 243 | 3300049824 | Ga0501045_0001777 | Ga0501045_0001777_5503_5907 | 123 |
| 244 | 3300050508 | nmdc:mga09592_492114_c1 | nmdc:mga09592_492114_c1_485_886 | 123 |
| 245 | 3300050511 | nmdc:mga08y16_2349_c1 | nmdc:mga08y16_2349_c1_14703_15116 | 123 |
| 246 | 3300050511 | nmdc:mga08y16_285588_c1 | nmdc:mga08y16_285588_c1_417_848 | 123 |
| 247 | 3300050512 | nmdc:mga0n895_380929_c1 | nmdc:mga0n895_380929_c1_760_1182 | 123 |
| 248 | 3300054114 | Ga0501084_0000115 | Ga0501084_0000115_10901_11305 | 123 |
| 249 | 3300059421 | Ga0590071_014365 | Ga0590071_014365_377_790 | 123 |
| 250 | 3300059423 | Ga0590074_017280 | Ga0590074_017280_500_913 | 123 |
| 251 | 3300059426 | Ga0590077_013167 | Ga0590077_013167_735_1148 | 123 |
| 252 | 3300060353 | Ga0501082_0004211 | Ga0501082_0004211_670_1074 | 123 |
| 253 | 3300061734 | Ga0530510_0001687 | Ga0530510_0001687_14053_14457 | 123 |
| 254 | 3300061734 | Ga0530510_0407938 | Ga0530510_0407938_152_556 | 123 |
| 255 | 3300061734 | Ga0530510_0725588 | Ga0530510_0725588_26_433 | 123 |
| 256 | iso_pu_bacteria | 2510917013 | 2511090348 | 123 |
| 257 | iso_pu_bacteria | 2515154189 | 2516017440 | 123 |
| 258 | iso_pu_bacteria | 2831864461 | 2831867080 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1thn-assembly1.cif.gz_A | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i | 0.8502 | 1 | 119 |
| 1thn-assembly1.cif.gz_A | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i | 0.8311 | 1 | 119 |
| 1th8-assembly1.cif.gz_A-2 | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.8038 | 2 | 119 |
| 1th8-assembly1.cif.gz_A-2 | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.7804 | 2 | 119 |
| 6m36-assembly2.cif.gz_O | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.78 | 4 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tidC00 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7986 | 3 | 119 | 3.30.565.10 |
| af_Q9LIR0_51_379_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7791 | 51 | 73 | 2.130.10.10 |
| af_Q2FWJ3_5_155_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7736 | 1 | 120 | 3.30.565.10 |
| 1tidC00 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7692 | 3 | 119 | 3.30.565.10 |
| af_Q2FWJ3_5_155_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7622 | 1 | 120 | 3.30.565.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6H2D199-F1-model_v4 | Anti-sigma regulatory factor | 0.976 | 3 | 121 |
|
| AF-A0A564QAV8-F1-model_v4 | Anti-sigma F factor | 0.9695 | 1 | 121 |
|
| AF-A0A7X0NZH6-F1-model_v4 | Serine/threonine-protein kinase RsbT (EC 2.7.11.1) | 0.9693 | 2 | 120 |
GO:0004676
GO:0004677 GO:0004679 GO:0004711 GO:0035175 GO:0035402 GO:0035403 GO:0035979 GO:0044022 GO:0044023 GO:0044024 GO:0044025 GO:0072354 GO:0072371 GO:0072518 GO:0140823 GO:0140855 GO:0140857 GO:1990244 |
| AF-A0A564QAV8-F1-model_v4 | Anti-sigma F factor | 0.9617 | 1 | 121 |
|
| AF-A0A2V7L193-F1-model_v4 | ATP-binding protein | 0.9613 | 4 | 120 |
GO:0004674
GO:0005524 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar