F368114

General Info

Members Datasets Scaffolds Average Seq Length
258 202 255 133

Family's Representative Sequence

Representative Sequence 3300025899|Ga0207642_10030627|Ga0207642_100306272
Length 154
Sequence VQMATLRDEAFPIRSSDDIVKVRQITRELALMQTFSLVDQTKIVTAASELARNALEHGGGGEVRFEALQEGSRRGIRLTFVDQGPGIPDLEQALKDGFTTGGGMGLGLSGSKRLVNEFEIHSEVGKGTRVTIARWKWEHCDYVRVHRGTGESSG

Samples

Sample ID Description Type Environment
1 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
3 2831864461 Roseateles noduli HZ7 Isolate Nodule
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.75
Nodule 0.39
Rhizoplane 1.16
Rhizosphere 88.76
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1019750 3300001977 Bacteria 948
2 Ga0055526_1005210 3300003771 Bacteria 7550
3 Ga0055524_1026499 3300003775 Bacteria 1789
4 Ga0055536_1040567 3300003781 Bacteria 1106
5 Ga0055531_10049676 3300003794 Bacteria 1118
6 Ga0065165_1060044 3300005262 Bacteria 1045
7 Ga0065707_10306115 3300005295 Bacteria 994
8 Ga0070658_10009389 3300005327 Bacteria 7856
9 Ga0068869_100000727 3300005334 Bacteria 18759
10 Ga0070680_100009718 3300005336 Bacteria 7402
11 Ga0068868_100098888 3300005338 Bacteria 2359
12 Ga0070661_101827323 3300005344 Bacteria 516
13 Ga0070669_100216534 3300005353 Bacteria 1513
14 Ga0070671_101392148 3300005355 Bacteria 619
15 Ga0070674_100171815 3300005356 Bacteria 1653
16 Ga0070667_100350468 3300005367 Bacteria 1336
17 Ga0070667_100565073 3300005367 Bacteria 1046
18 Ga0070705_100000565 3300005440 Bacteria 21451
19 Ga0070700_100540053 3300005441 Bacteria 904
20 Ga0070694_100001696 3300005444 Bacteria 12967
21 Ga0070694_101493238 3300005444 Bacteria 572
22 Ga0070678_101292886 3300005456 Bacteria 678
23 Ga0070681_10018201 3300005458 Bacteria 7024
24 Ga0070681_10284468 3300005458 Bacteria 1564
25 Ga0068867_100000640 3300005459 Bacteria 23146
26 Ga0068867_100594063 3300005459 Bacteria 964
27 Ga0070706_100405856 3300005467 Bacteria 1269
28 Ga0070679_100089518 3300005530 Bacteria 3065
29 Ga0068853_100354257 3300005539 Bacteria 1366
30 Ga0068853_101383484 3300005539 Bacteria 680
31 Ga0070686_100002616 3300005544 Bacteria 9929
32 Ga0070696_100000527 3300005546 Bacteria 24255
33 Ga0068855_100059672 3300005563 Bacteria 4463
34 Ga0070664_100003611 3300005564 Bacteria 12465
35 Ga0070664_100180686 3300005564 Bacteria 1875
36 Ga0068857_100001468 3300005577 Bacteria 18747
37 Ga0068854_100048525 3300005578 Bacteria 3030
38 Ga0068856_100026141 3300005614 Bacteria 5692
39 Ga0070702_100000209 3300005615 Bacteria 19373
40 Ga0070702_100086346 3300005615 Bacteria 1892
41 Ga0068852_100162082 3300005616 Bacteria 2089
42 Ga0068859_100055748 3300005617 Bacteria 3977
43 Ga0068859_101203293 3300005617 Bacteria 834
44 Ga0068866_10007307 3300005718 Bacteria 4623
45 Ga0068861_100000746 3300005719 Bacteria 19514
46 Ga0068851_10822607 3300005834 Bacteria 578
47 Ga0068870_10039318 3300005840 Bacteria 2447
48 Ga0068863_100281431 3300005841 Bacteria 1611
49 Ga0068863_100427054 3300005841 Bacteria 1299
50 Ga0068863_100895847 3300005841 Bacteria 887
51 Ga0068858_100023114 3300005842 Bacteria 5798
52 Ga0068860_100024979 3300005843 Bacteria 5769
53 Ga0068862_100003396 3300005844 Bacteria 13729
54 Ga0081455_10010326 3300005937 Bacteria 9491
55 Ga0081540_1002899 3300005983 Bacteria 13827
56 Ga0081539_10000546 3300005985 Bacteria 77546
57 Ga0075364_10001451 3300006051 Bacteria 12880
58 Ga0097621_100042926 3300006237 Bacteria 3643
59 Ga0097621_101104612 3300006237 Bacteria 744
60 Ga0097621_101552599 3300006237 Bacteria 629
61 Ga0068871_100000265 3300006358 Bacteria 36023
62 Ga0068871_100364370 3300006358 Bacteria 1281
63 Ga0068871_100464792 3300006358 Unclassified 1136
64 Ga0075428_100234026 3300006844 Bacteria 1982
65 Ga0075428_100499686 3300006844 Bacteria 1301
66 Ga0075433_10392194 3300006852 Bacteria 1225
67 Ga0075429_100480769 3300006880 Bacteria 1088
68 Ga0068865_100005335 3300006881 Bacteria 7783
69 Ga0075436_100009663 3300006914 Bacteria 6602
70 Ga0097620_100055750 3300006931 Bacteria 3977
71 Ga0097620_101203281 3300006931 Bacteria 834
72 Ga0105240_10672174 3300009093 Bacteria 1133
73 Ga0111539_10026862 3300009094 Bacteria 7033
74 Ga0111539_10191429 3300009094 Bacteria 2387
75 Ga0111539_12927104 3300009094 Bacteria 552
76 Ga0105245_10005829 3300009098 Bacteria 10811
77 Ga0105245_10859194 3300009098 Bacteria 948
78 Ga0105247_10630940 3300009101 Bacteria 798
79 Ga0114129_12412990 3300009147 Bacteria 630
80 Ga0105243_10005092 3300009148 Bacteria 10312
81 Ga0105243_10161143 3300009148 Bacteria 1934
82 Ga0105241_10148708 3300009174 Bacteria 1914
83 Ga0105242_10001210 3300009176 Bacteria 20394
84 Ga0105242_10038234 3300009176 Bacteria 3859
85 Ga0105242_13096146 3300009176 Bacteria 515
86 Ga0105248_11804096 3300009177 Bacteria 694
87 Ga0105237_11913197 3300009545 Unclassified 601
88 Ga0105238_10033468 3300009551 Bacteria 5232
89 Ga0105249_10042160 3300009553 Bacteria 4150
90 Ga0105239_10063837 3300010375 Bacteria 4043
91 Ga0105246_10093339 3300011119 Bacteria 2174
92 Ga0157369_10129722 3300013105 Bacteria 2672
93 Ga0157369_10794655 3300013105 Bacteria 972
94 Ga0157378_10037215 3300013297 Bacteria 4309
95 Ga0157372_10446967 3300013307 Bacteria 1506
96 Ga0157380_11990337 3300014326 Bacteria 643
97 Ga0157377_10052926 3300014745 Bacteria 2293
98 Ga0157379_10185200 3300014968 Bacteria 1881
99 Ga0157379_11714353 3300014968 Unclassified 616
100 Ga0182006_1028562 3300015261 Bacteria 2268
101 Ga0207425_1000064 3300025245 Bacteria 129075
102 Ga0209129_1000101 3300025258 Bacteria 161931
103 Ga0209130_1010166 3300025284 Bacteria 2611
104 Ga0209676_1001122 3300025292 Bacteria 29496
105 Ga0209025_1000048 3300025294 Bacteria 335574
106 Ga0209564_1000097 3300025295 Bacteria 231436
107 Ga0209758_1000056 3300025297 Bacteria 335574
108 Ga0209050_1001470 3300025298 Bacteria 25210
109 Ga0209256_1001057 3300025299 Bacteria 31943
110 Ga0209051_1009454 3300025303 Bacteria 5022
111 Ga0209051_1097689 3300025303 Bacteria 798
112 Ga0209257_1000049 3300025304 Bacteria 441224
113 Ga0209257_1001446 3300025304 Bacteria 28071
114 Ga0207653_10192296 3300025885 Bacteria 767
115 Ga0207642_10030627 3300025899 Bacteria 2244
116 Ga0207642_10034811 3300025899 Bacteria 2145
117 Ga0207643_10018663 3300025908 Bacteria 3798
118 Ga0207654_10105205 3300025911 Bacteria 1746
119 Ga0207707_10016365 3300025912 Bacteria 6469
120 Ga0207707_10058352 3300025912 Bacteria 3359
121 Ga0207693_10314888 3300025915 Bacteria 1225
122 Ga0207660_10001221 3300025917 Bacteria 17201
123 Ga0207662_10000423 3300025918 Bacteria 18688
124 Ga0207649_10009259 3300025920 Bacteria 5387
125 Ga0207652_10268857 3300025921 Bacteria 1538
126 Ga0207652_10462255 3300025921 Bacteria 1144
127 Ga0207694_10018361 3300025924 Bacteria 5287
128 Ga0207659_10582558 3300025926 Bacteria 953
129 Ga0207687_10013843 3300025927 Bacteria 5268
130 Ga0207687_10677550 3300025927 Bacteria 874
131 Ga0207644_11088600 3300025931 Unclassified 671
132 Ga0207644_11267580 3300025931 Bacteria 619
133 Ga0207706_10822845 3300025933 Bacteria 788
134 Ga0207686_10005460 3300025934 Bacteria 6824
135 Ga0207686_10008653 3300025934 Bacteria 5496
136 Ga0207709_10008014 3300025935 Bacteria 5852
137 Ga0207670_10003051 3300025936 Bacteria 8840
138 Ga0207669_10243293 3300025937 Bacteria 1335
139 Ga0207704_10020249 3300025938 Bacteria 3515
140 Ga0207711_10070863 3300025941 Bacteria 3023
141 Ga0207711_11154164 3300025941 Bacteria 716
142 Ga0207689_10001695 3300025942 Bacteria 20948
143 Ga0207661_10137677 3300025944 Bacteria 2098
144 Ga0207661_10877370 3300025944 Bacteria 826
145 Ga0207679_10000134 3300025945 Bacteria 60399
146 Ga0207667_10082522 3300025949 Bacteria 3329
147 Ga0207712_10148663 3300025961 Bacteria 1807
148 Ga0207640_10039144 3300025981 Bacteria 2998
149 Ga0207658_10289897 3300025986 Bacteria 1406
150 Ga0207677_10035893 3300026023 Bacteria 3224
151 Ga0207703_10021294 3300026035 Bacteria 5076
152 Ga0207703_11736562 3300026035 Bacteria 600
153 Ga0207708_10000723 3300026075 Bacteria 24861
154 Ga0207708_10297086 3300026075 Bacteria 1313
155 Ga0207641_10366492 3300026088 Bacteria 1377
156 Ga0207648_10001968 3300026089 Bacteria 22433
157 Ga0207648_10955562 3300026089 Bacteria 802
158 Ga0207674_10004119 3300026116 Bacteria 17598
159 Ga0207675_100001083 3300026118 Bacteria 26980
160 Ga0207675_100047281 3300026118 Bacteria 4018
161 Ga0207683_10860825 3300026121 Unclassified 841
162 Ga0207683_11151641 3300026121 Bacteria 719
163 Ga0207698_10186532 3300026142 Bacteria 1843
164 Ga0207428_10010570 3300027907 Bacteria 8236
165 Ga0207428_10106169 3300027907 Bacteria 2165
166 Ga0268265_10127683 3300028380 Bacteria 2107
167 Ga0268264_10018627 3300028381 Bacteria 5676
168 Ga0265327_10009940 3300031251 Bacteria 6779
169 Ga0307408_100759611 3300031548 Bacteria 876
170 Ga0307405_10170779 3300031731 Bacteria 1551
171 Ga0307412_10083782 3300031911 Bacteria 2212
172 Ga0373948_0001296 3300034817 Bacteria 3427
173 Ga0373958_0060132 3300034819 Bacteria 821
174 Ga0373959_0024693 3300034820 Bacteria 1176
175 Ga0373928_0034542 3300035084 Bacteria 1135
176 Ga0373929_0028274 3300035085 Bacteria 1183
177 Ga0373940_0001252 3300035088 Bacteria 4506
178 Ga0373949_0077074 3300035090 Bacteria 882
179 Ga0373951_0008636 3300035091 Bacteria 2296
180 Ga0373952_0015368 3300035092 Bacteria 1545
181 Ga0373932_0001721 3300035112 Bacteria 5942
182 Ga0373939_0006109 3300035114 Bacteria 2894
183 Ga0373941_0133154 3300035115 Bacteria 897
184 Ga0373942_0001712 3300035207 Bacteria 5571
185 Ga0373962_0013935 3300035242 Bacteria 2043
186 Ga0373931_0001276 3300035691 Bacteria 10750
187 Ga0373931_0206159 3300035691 Bacteria 1177
188 Ga0436364_0152053 3300037853 Bacteria 1195
189 Ga0451807_2265722 3300041486 Bacteria 685
190 Ga0451855_1592122 3300041511 Bacteria 606
191 Ga0451577_0071553 3300042876 Bacteria 3093
192 Ga0466963_0842184 3300044694 Bacteria 647
193 Ga0453684_0132670 3300044712 Bacteria 2987
194 Ga0451576_0024704 3300045051 Bacteria 6487
195 Ga0451576_0026283 3300045051 Bacteria 6263
196 Ga0451576_0144107 3300045051 Bacteria 2484
197 Ga0495670_0314568 3300046691 Bacteria 840
198 Ga0495676_0927981 3300047321 Bacteria 557
199 Ga0495686_0010877 3300047472 Bacteria 6443
200 Ga0496102_0001445 3300048905 Bacteria 21038
201 Ga0496105_0936935 3300048908 Bacteria 651
202 Ga0496124_0289677 3300048927 Bacteria 1189
203 Ga0496126_0588630 3300048929 Bacteria 878
204 Ga0501031_0054323 3300049568 Bacteria 2610
205 Ga0501032_0157962 3300049569 Bacteria 1489
206 Ga0501033_0056311 3300049570 Bacteria 2906
207 Ga0501034_0417410 3300049571 Bacteria 1263
208 Ga0501036_0005213 3300049572 Bacteria 10510
209 Ga0501037_0029804 3300049573 Bacteria 4032
210 Ga0501038_0002185 3300049574 Bacteria 18181
211 Ga0501039_0003882 3300049575 Bacteria 11222
212 Ga0501040_0011503 3300049576 Bacteria 5792
213 Ga0501040_1173879 3300049576 Bacteria 557
214 Ga0501042_0004075 3300049578 Bacteria 9275
215 Ga0501043_0025366 3300049579 Bacteria 4651
216 Ga0501048_0005843 3300049582 Bacteria 9361
217 Ga0501068_0016373 3300049584 Bacteria 4274
218 Ga0501069_0324147 3300049585 Bacteria 905
219 Ga0501070_0082900 3300049586 Bacteria 2654
220 Ga0501071_0000754 3300049587 Bacteria 17136
221 Ga0501072_0001246 3300049588 Bacteria 19005
222 Ga0501072_0155321 3300049588 Bacteria 1825
223 Ga0501072_0798789 3300049588 Bacteria 739
224 Ga0501073_0047106 3300049589 Bacteria 3030
225 Ga0501074_0003120 3300049590 Bacteria 11683
226 Ga0501074_0943992 3300049590 Bacteria 607
227 Ga0501075_0000757 3300049591 Bacteria 20166
228 Ga0501075_0310926 3300049591 Bacteria 1201
229 Ga0501075_0474612 3300049591 Bacteria 954
230 Ga0501076_0028581 3300049592 Bacteria 4330
231 Ga0501077_0033224 3300049593 Bacteria 3283
232 Ga0501079_0001026 3300049741 Bacteria 19370
233 Ga0501079_0228185 3300049741 Bacteria 1455
234 Ga0501080_0009898 3300049742 Bacteria 8710
235 Ga0501080_0027381 3300049742 Bacteria 5300
236 Ga0501081_0001303 3300049743 Bacteria 15198
237 Ga0501081_0400022 3300049743 Bacteria 1017
238 Ga0501035_0022048 3300049822 Bacteria 5851
239 Ga0501045_0001777 3300049824 Bacteria 14560
240 nmdc:mga00v17_63656_c1 3300050491 Bacteria 2272
241 nmdc:mga09592_492114_c1 3300050508 Bacteria 1056
242 nmdc:mga08y16_2349_c1 3300050511 Bacteria 19391
243 nmdc:mga08y16_266177_c1 3300050511 Bacteria 1770
244 nmdc:mga08y16_285588_c1 3300050511 Bacteria 1701
245 nmdc:mga0n895_380929_c1 3300050512 Bacteria 1427
246 nmdc:mga08x19_163466_c1 3300050514 Bacteria 1513
247 nmdc:mga0a205_256702_c1 3300050515 Bacteria 1626
248 Ga0501084_0000115 3300054114 Bacteria 60964
249 Ga0590071_014365 3300059421 Bacteria 1857
250 Ga0590074_017280 3300059423 Bacteria 1231
251 Ga0590077_013167 3300059426 Bacteria 1719
252 Ga0501082_0004211 3300060353 Bacteria 12568
253 Ga0530510_0001687 3300061734 Bacteria 14960
254 Ga0530510_0407938 3300061734 Bacteria 1025
255 Ga0530510_0725588 3300061734 Bacteria 758

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_101552599 Ga0097621_1015525991 106
2 3300048908 Ga0496105_0936935 Ga0496105_0936935_93_440 107
3 3300049588 Ga0501072_0798789 Ga0501072_0798789_348_695 107
4 3300049591 Ga0501075_0474612 Ga0501075_0474612_413_760 107
5 3300009093 Ga0105240_10672174 Ga0105240_106721741 116
6 3300009174 Ga0105241_10148708 Ga0105241_101487083 116
7 3300010375 Ga0105239_10063837 Ga0105239_100638374 116
8 3300031548 Ga0307408_100759611 Ga0307408_1007596111 116
9 3300031731 Ga0307405_10170779 Ga0307405_101707792 116
10 3300031911 Ga0307412_10083782 Ga0307412_100837822 116
11 3300035242 Ga0373962_0013935 Ga0373962_0013935_1593_1967 116
12 3300005441 Ga0070700_100540053 Ga0070700_1005400531 118
13 3300005456 Ga0070678_101292886 Ga0070678_1012928862 118
14 3300005459 Ga0068867_100594063 Ga0068867_1005940632 118
15 3300005539 Ga0068853_101383484 Ga0068853_1013834841 118
16 3300005615 Ga0070702_100086346 Ga0070702_1000863463 118
17 3300006852 Ga0075433_10392194 Ga0075433_103921942 118
18 3300009094 Ga0111539_10026862 Ga0111539_100268626 118
19 3300027907 Ga0207428_10106169 Ga0207428_101061693 118
20 3300050511 nmdc:mga08y16_266177_c1 nmdc:mga08y16_266177_c1_1030_1410 118
21 3300050515 nmdc:mga0a205_256702_c1 nmdc:mga0a205_256702_c1_697_1077 118
22 3300006914 Ga0075436_100009663 Ga0075436_1000096638 120
23 3300050514 nmdc:mga08x19_163466_c1 nmdc:mga08x19_163466_c1_1096_1491 120
24 3300005614 Ga0068856_100026141 Ga0068856_1000261412 121
25 3300009176 Ga0105242_13096146 Ga0105242_130961462 121
26 3300049571 Ga0501034_0417410 Ga0501034_0417410_575_964 121
27 3300005344 Ga0070661_101827323 Ga0070661_1018273231 122
28 3300006051 Ga0075364_10001451 Ga0075364_1000145112 122
29 3300045051 Ga0451576_0144107 Ga0451576_0144107_66_473 122
30 3300050491 nmdc:mga00v17_63656_c1 nmdc:mga00v17_63656_c1_338_751 122
31 3300001977 JGI24746J21847_1019750 JGI24746J21847_10197502 123
32 3300003771 Ga0055526_1005210 Ga0055526_10052103 123
33 3300003775 Ga0055524_1026499 Ga0055524_10264992 123
34 3300003781 Ga0055536_1040567 Ga0055536_10405673 123
35 3300003794 Ga0055531_10049676 Ga0055531_100496762 123
36 3300005262 Ga0065165_1060044 Ga0065165_10600441 123
37 3300005295 Ga0065707_10306115 Ga0065707_103061152 123
38 3300005327 Ga0070658_10009389 Ga0070658_100093894 123
39 3300005334 Ga0068869_100000727 Ga0068869_10000072720 123
40 3300005336 Ga0070680_100009718 Ga0070680_1000097187 123
41 3300005338 Ga0068868_100098888 Ga0068868_1000988882 123
42 3300005353 Ga0070669_100216534 Ga0070669_1002165342 123
43 3300005355 Ga0070671_101392148 Ga0070671_1013921481 123
44 3300005356 Ga0070674_100171815 Ga0070674_1001718153 123
45 3300005367 Ga0070667_100350468 Ga0070667_1003504682 123
46 3300005367 Ga0070667_100565073 Ga0070667_1005650732 123
47 3300005440 Ga0070705_100000565 Ga0070705_1000005653 123
48 3300005444 Ga0070694_100001696 Ga0070694_1000016964 123
49 3300005444 Ga0070694_101493238 Ga0070694_1014932381 123
50 3300005458 Ga0070681_10018201 Ga0070681_100182014 123
51 3300005458 Ga0070681_10284468 Ga0070681_102844682 123
52 3300005459 Ga0068867_100000640 Ga0068867_10000064016 123
53 3300005467 Ga0070706_100405856 Ga0070706_1004058563 123
54 3300005530 Ga0070679_100089518 Ga0070679_1000895183 123
55 3300005539 Ga0068853_100354257 Ga0068853_1003542572 123
56 3300005544 Ga0070686_100002616 Ga0070686_1000026163 123
57 3300005546 Ga0070696_100000527 Ga0070696_10000052721 123
58 3300005563 Ga0068855_100059672 Ga0068855_1000596723 123
59 3300005564 Ga0070664_100003611 Ga0070664_1000036115 123
60 3300005564 Ga0070664_100180686 Ga0070664_1001806863 123
61 3300005577 Ga0068857_100001468 Ga0068857_1000014685 123
62 3300005578 Ga0068854_100048525 Ga0068854_1000485252 123
63 3300005615 Ga0070702_100000209 Ga0070702_10000020913 123
64 3300005616 Ga0068852_100162082 Ga0068852_1001620822 123
65 3300005617 Ga0068859_100055748 Ga0068859_1000557482 123
66 3300005617 Ga0068859_101203293 Ga0068859_1012032932 123
67 3300005718 Ga0068866_10007307 Ga0068866_100073074 123
68 3300005719 Ga0068861_100000746 Ga0068861_10000074612 123
69 3300005834 Ga0068851_10822607 Ga0068851_108226071 123
70 3300005840 Ga0068870_10039318 Ga0068870_100393183 123
71 3300005841 Ga0068863_100281431 Ga0068863_1002814311 123
72 3300005841 Ga0068863_100427054 Ga0068863_1004270543 123
73 3300005841 Ga0068863_100895847 Ga0068863_1008958472 123
74 3300005842 Ga0068858_100023114 Ga0068858_1000231144 123
75 3300005843 Ga0068860_100024979 Ga0068860_1000249794 123
76 3300005844 Ga0068862_100003396 Ga0068862_1000033963 123
77 3300005937 Ga0081455_10010326 Ga0081455_100103264 123
78 3300005983 Ga0081540_1002899 Ga0081540_10028999 123
79 3300005985 Ga0081539_10000546 Ga0081539_1000054660 123
80 3300006237 Ga0097621_100042926 Ga0097621_1000429262 123
81 3300006237 Ga0097621_101104612 Ga0097621_1011046122 123
82 3300006358 Ga0068871_100000265 Ga0068871_10000026530 123
83 3300006358 Ga0068871_100364370 Ga0068871_1003643702 123
84 3300006358 Ga0068871_100464792 Ga0068871_1004647923 123
85 3300006844 Ga0075428_100234026 Ga0075428_1002340262 123
86 3300006844 Ga0075428_100499686 Ga0075428_1004996862 123
87 3300006880 Ga0075429_100480769 Ga0075429_1004807692 123
88 3300006881 Ga0068865_100005335 Ga0068865_1000053359 123
89 3300006931 Ga0097620_100055750 Ga0097620_1000557502 123
90 3300006931 Ga0097620_101203281 Ga0097620_1012032812 123
91 3300009094 Ga0111539_10191429 Ga0111539_101914292 123
92 3300009094 Ga0111539_12927104 Ga0111539_129271042 123
93 3300009098 Ga0105245_10005829 Ga0105245_1000582911 123
94 3300009098 Ga0105245_10859194 Ga0105245_108591942 123
95 3300009101 Ga0105247_10630940 Ga0105247_106309402 123
96 3300009147 Ga0114129_12412990 Ga0114129_124129902 123
97 3300009148 Ga0105243_10005092 Ga0105243_100050923 123
98 3300009148 Ga0105243_10161143 Ga0105243_101611432 123
99 3300009176 Ga0105242_10001210 Ga0105242_1000121010 123
100 3300009176 Ga0105242_10038234 Ga0105242_100382343 123
101 3300009177 Ga0105248_11804096 Ga0105248_118040962 123
102 3300009545 Ga0105237_11913197 Ga0105237_119131972 123
103 3300009551 Ga0105238_10033468 Ga0105238_100334683 123
104 3300009553 Ga0105249_10042160 Ga0105249_100421603 123
105 3300011119 Ga0105246_10093339 Ga0105246_100933393 123
106 3300013105 Ga0157369_10129722 Ga0157369_101297223 123
107 3300013105 Ga0157369_10794655 Ga0157369_107946552 123
108 3300013297 Ga0157378_10037215 Ga0157378_100372153 123
109 3300013307 Ga0157372_10446967 Ga0157372_104469672 123
110 3300014326 Ga0157380_11990337 Ga0157380_119903372 123
111 3300014745 Ga0157377_10052926 Ga0157377_100529262 123
112 3300014968 Ga0157379_10185200 Ga0157379_101852002 123
113 3300014968 Ga0157379_11714353 Ga0157379_117143531 123
114 3300015261 Ga0182006_1028562 Ga0182006_10285623 123
115 3300025245 Ga0207425_1000064 Ga0207425_100006476 123
116 3300025258 Ga0209129_1000101 Ga0209129_100010176 123
117 3300025284 Ga0209130_1010166 Ga0209130_10101664 123
118 3300025292 Ga0209676_1001122 Ga0209676_100112220 123
119 3300025294 Ga0209025_1000048 Ga0209025_1000048170 123
120 3300025295 Ga0209564_1000097 Ga0209564_100009784 123
121 3300025297 Ga0209758_1000056 Ga0209758_1000056170 123
122 3300025298 Ga0209050_1001470 Ga0209050_100147017 123
123 3300025299 Ga0209256_1001057 Ga0209256_100105710 123
124 3300025303 Ga0209051_1009454 Ga0209051_10094547 123
125 3300025303 Ga0209051_1097689 Ga0209051_10976892 123
126 3300025304 Ga0209257_1000049 Ga0209257_100004954 123
127 3300025304 Ga0209257_1001446 Ga0209257_100144618 123
128 3300025885 Ga0207653_10192296 Ga0207653_101922962 123
129 3300025899 Ga0207642_10030627 Ga0207642_100306272 123
130 3300025899 Ga0207642_10034811 Ga0207642_100348112 123
131 3300025908 Ga0207643_10018663 Ga0207643_100186633 123
132 3300025911 Ga0207654_10105205 Ga0207654_101052052 123
133 3300025912 Ga0207707_10016365 Ga0207707_100163652 123
134 3300025912 Ga0207707_10058352 Ga0207707_100583522 123
135 3300025915 Ga0207693_10314888 Ga0207693_103148883 123
136 3300025917 Ga0207660_10001221 Ga0207660_100012213 123
137 3300025918 Ga0207662_10000423 Ga0207662_1000042311 123
138 3300025920 Ga0207649_10009259 Ga0207649_100092596 123
139 3300025921 Ga0207652_10268857 Ga0207652_102688571 123
140 3300025921 Ga0207652_10462255 Ga0207652_104622551 123
141 3300025924 Ga0207694_10018361 Ga0207694_100183614 123
142 3300025926 Ga0207659_10582558 Ga0207659_105825582 123
143 3300025927 Ga0207687_10013843 Ga0207687_100138433 123
144 3300025927 Ga0207687_10677550 Ga0207687_106775502 123
145 3300025931 Ga0207644_11088600 Ga0207644_110886002 123
146 3300025931 Ga0207644_11267580 Ga0207644_112675801 123
147 3300025933 Ga0207706_10822845 Ga0207706_108228452 123
148 3300025934 Ga0207686_10005460 Ga0207686_100054602 123
149 3300025934 Ga0207686_10008653 Ga0207686_100086534 123
150 3300025935 Ga0207709_10008014 Ga0207709_100080143 123
151 3300025936 Ga0207670_10003051 Ga0207670_1000305110 123
152 3300025937 Ga0207669_10243293 Ga0207669_102432932 123
153 3300025938 Ga0207704_10020249 Ga0207704_100202494 123
154 3300025941 Ga0207711_10070863 Ga0207711_100708633 123
155 3300025941 Ga0207711_11154164 Ga0207711_111541642 123
156 3300025942 Ga0207689_10001695 Ga0207689_100016953 123
157 3300025944 Ga0207661_10137677 Ga0207661_101376772 123
158 3300025944 Ga0207661_10877370 Ga0207661_108773701 123
159 3300025945 Ga0207679_10000134 Ga0207679_1000013438 123
160 3300025949 Ga0207667_10082522 Ga0207667_100825223 123
161 3300025961 Ga0207712_10148663 Ga0207712_101486633 123
162 3300025981 Ga0207640_10039144 Ga0207640_100391442 123
163 3300025986 Ga0207658_10289897 Ga0207658_102898972 123
164 3300026023 Ga0207677_10035893 Ga0207677_100358934 123
165 3300026035 Ga0207703_10021294 Ga0207703_100212944 123
166 3300026035 Ga0207703_11736562 Ga0207703_117365622 123
167 3300026075 Ga0207708_10000723 Ga0207708_1000072311 123
168 3300026075 Ga0207708_10297086 Ga0207708_102970862 123
169 3300026088 Ga0207641_10366492 Ga0207641_103664923 123
170 3300026089 Ga0207648_10001968 Ga0207648_100019684 123
171 3300026089 Ga0207648_10955562 Ga0207648_109555622 123
172 3300026116 Ga0207674_10004119 Ga0207674_100041193 123
173 3300026118 Ga0207675_100001083 Ga0207675_10000108329 123
174 3300026118 Ga0207675_100047281 Ga0207675_1000472814 123
175 3300026121 Ga0207683_10860825 Ga0207683_108608252 123
176 3300026121 Ga0207683_11151641 Ga0207683_111516412 123
177 3300026142 Ga0207698_10186532 Ga0207698_101865322 123
178 3300027907 Ga0207428_10010570 Ga0207428_100105706 123
179 3300028380 Ga0268265_10127683 Ga0268265_101276833 123
180 3300028381 Ga0268264_10018627 Ga0268264_100186274 123
181 3300031251 Ga0265327_10009940 Ga0265327_100099403 123
182 3300034817 Ga0373948_0001296 Ga0373948_0001296_1754_2185 123
183 3300034819 Ga0373958_0060132 Ga0373958_0060132_31_462 123
184 3300034820 Ga0373959_0024693 Ga0373959_0024693_287_718 123
185 3300035084 Ga0373928_0034542 Ga0373928_0034542_212_643 123
186 3300035085 Ga0373929_0028274 Ga0373929_0028274_629_1060 123
187 3300035088 Ga0373940_0001252 Ga0373940_0001252_2458_2889 123
188 3300035090 Ga0373949_0077074 Ga0373949_0077074_150_581 123
189 3300035091 Ga0373951_0008636 Ga0373951_0008636_280_711 123
190 3300035092 Ga0373952_0015368 Ga0373952_0015368_980_1411 123
191 3300035112 Ga0373932_0001721 Ga0373932_0001721_3407_3838 123
192 3300035114 Ga0373939_0006109 Ga0373939_0006109_866_1297 123
193 3300035115 Ga0373941_0133154 Ga0373941_0133154_405_827 123
194 3300035207 Ga0373942_0001712 Ga0373942_0001712_4662_5093 123
195 3300035691 Ga0373931_0001276 Ga0373931_0001276_441_872 123
196 3300035691 Ga0373931_0206159 Ga0373931_0206159_32_439 123
197 3300037853 Ga0436364_0152053 Ga0436364_0152053_289_690 123
198 3300041486 Ga0451807_2265722 Ga0451807_2265722_184_648 123
199 3300041511 Ga0451855_1592122 Ga0451855_1592122_23_469 123
200 3300042876 Ga0451577_0071553 Ga0451577_0071553_948_1349 123
201 3300044694 Ga0466963_0842184 Ga0466963_0842184_24_431 123
202 3300044712 Ga0453684_0132670 Ga0453684_0132670_1140_1541 123
203 3300045051 Ga0451576_0024704 Ga0451576_0024704_3658_4089 123
204 3300045051 Ga0451576_0026283 Ga0451576_0026283_69_470 123
205 3300046691 Ga0495670_0314568 Ga0495670_0314568_218_628 123
206 3300047321 Ga0495676_0927981 Ga0495676_0927981_103_507 123
207 3300047472 Ga0495686_0010877 Ga0495686_0010877_2647_3069 123
208 3300048905 Ga0496102_0001445 Ga0496102_0001445_19142_19564 123
209 3300048927 Ga0496124_0289677 Ga0496124_0289677_377_778 123
210 3300048929 Ga0496126_0588630 Ga0496126_0588630_12_413 123
211 3300049568 Ga0501031_0054323 Ga0501031_0054323_840_1244 123
212 3300049569 Ga0501032_0157962 Ga0501032_0157962_299_703 123
213 3300049570 Ga0501033_0056311 Ga0501033_0056311_1053_1457 123
214 3300049572 Ga0501036_0005213 Ga0501036_0005213_5632_6036 123
215 3300049573 Ga0501037_0029804 Ga0501037_0029804_1626_2030 123
216 3300049574 Ga0501038_0002185 Ga0501038_0002185_12972_13376 123
217 3300049575 Ga0501039_0003882 Ga0501039_0003882_3713_4117 123
218 3300049576 Ga0501040_0011503 Ga0501040_0011503_1521_1925 123
219 3300049576 Ga0501040_1173879 Ga0501040_1173879_124_528 123
220 3300049578 Ga0501042_0004075 Ga0501042_0004075_7319_7723 123
221 3300049579 Ga0501043_0025366 Ga0501043_0025366_2744_3148 123
222 3300049582 Ga0501048_0005843 Ga0501048_0005843_2282_2686 123
223 3300049584 Ga0501068_0016373 Ga0501068_0016373_1828_2232 123
224 3300049585 Ga0501069_0324147 Ga0501069_0324147_469_873 123
225 3300049586 Ga0501070_0082900 Ga0501070_0082900_2009_2413 123
226 3300049587 Ga0501071_0000754 Ga0501071_0000754_5521_5925 123
227 3300049588 Ga0501072_0001246 Ga0501072_0001246_7217_7621 123
228 3300049588 Ga0501072_0155321 Ga0501072_0155321_1342_1746 123
229 3300049589 Ga0501073_0047106 Ga0501073_0047106_623_1027 123
230 3300049590 Ga0501074_0003120 Ga0501074_0003120_9751_10155 123
231 3300049590 Ga0501074_0943992 Ga0501074_0943992_170_574 123
232 3300049591 Ga0501075_0000757 Ga0501075_0000757_10686_11090 123
233 3300049591 Ga0501075_0310926 Ga0501075_0310926_17_421 123
234 3300049592 Ga0501076_0028581 Ga0501076_0028581_2721_3125 123
235 3300049593 Ga0501077_0033224 Ga0501077_0033224_1303_1707 123
236 3300049741 Ga0501079_0001026 Ga0501079_0001026_7437_7841 123
237 3300049741 Ga0501079_0228185 Ga0501079_0228185_443_847 123
238 3300049742 Ga0501080_0009898 Ga0501080_0009898_3804_4208 123
239 3300049742 Ga0501080_0027381 Ga0501080_0027381_1529_1933 123
240 3300049743 Ga0501081_0001303 Ga0501081_0001303_4907_5311 123
241 3300049743 Ga0501081_0400022 Ga0501081_0400022_462_866 123
242 3300049822 Ga0501035_0022048 Ga0501035_0022048_418_822 123
243 3300049824 Ga0501045_0001777 Ga0501045_0001777_5503_5907 123
244 3300050508 nmdc:mga09592_492114_c1 nmdc:mga09592_492114_c1_485_886 123
245 3300050511 nmdc:mga08y16_2349_c1 nmdc:mga08y16_2349_c1_14703_15116 123
246 3300050511 nmdc:mga08y16_285588_c1 nmdc:mga08y16_285588_c1_417_848 123
247 3300050512 nmdc:mga0n895_380929_c1 nmdc:mga0n895_380929_c1_760_1182 123
248 3300054114 Ga0501084_0000115 Ga0501084_0000115_10901_11305 123
249 3300059421 Ga0590071_014365 Ga0590071_014365_377_790 123
250 3300059423 Ga0590074_017280 Ga0590074_017280_500_913 123
251 3300059426 Ga0590077_013167 Ga0590077_013167_735_1148 123
252 3300060353 Ga0501082_0004211 Ga0501082_0004211_670_1074 123
253 3300061734 Ga0530510_0001687 Ga0530510_0001687_14053_14457 123
254 3300061734 Ga0530510_0407938 Ga0530510_0407938_152_556 123
255 3300061734 Ga0530510_0725588 Ga0530510_0725588_26_433 123
256 iso_pu_bacteria 2510917013 2511090348 123
257 iso_pu_bacteria 2515154189 2516017440 123
258 iso_pu_bacteria 2831864461 2831867080 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

38

139

0.86

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

13

134

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8502 1 119
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8311 1 119
1th8-assembly1.cif.gz_A-2 crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.8038 2 119
1th8-assembly1.cif.gz_A-2 crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.7804 2 119
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.78 4 121
ID Description Score Start End Superfamily
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7986 3 119 3.30.565.10
af_Q9LIR0_51_379_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7791 51 73 2.130.10.10
af_Q2FWJ3_5_155_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7736 1 120 3.30.565.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7692 3 119 3.30.565.10
af_Q2FWJ3_5_155_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7622 1 120 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A6H2D199-F1-model_v4 Anti-sigma regulatory factor 0.976 3 121
AF-A0A564QAV8-F1-model_v4 Anti-sigma F factor 0.9695 1 121
AF-A0A7X0NZH6-F1-model_v4 Serine/threonine-protein kinase RsbT (EC 2.7.11.1) 0.9693 2 120 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A564QAV8-F1-model_v4 Anti-sigma F factor 0.9617 1 121
AF-A0A2V7L193-F1-model_v4 ATP-binding protein 0.9613 4 120 GO:0004674
GO:0005524

Feature Viewer

pLDDT pTM Quality
92.54 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map