F368148

General Info

Members Datasets Scaffolds Average Seq Length
258 200 516 126

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_12413251|Ga0207702_124132511
Length 142
Sequence MQARSGRRASAAAQQGVDMLGAKDAIATVAVKDLQAAKKFYEGSVGLKPLPTQQPEVVNYKSGNSTLLVYRSQFAGTNKATAVTWTVDDTEAEVRALKSKGVVFEHYDMPGATLKGDVHVMGDMKAAWFKDPDGNILAIVGR

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
175 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
176 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
180 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
181 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
182 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
183 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
184 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
185 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
186 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
187 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
188 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
189 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
190 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
191 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
192 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
193 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
194 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
195 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
196 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
197 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
198 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
199 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
200 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.47
Metatranscriptomes 0
Isolates 8.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.95
Nodule 6.59
Rhizoplane 1.16
Rhizosphere 51.16
Stem 0
Stem Tuber 0
Unclassified 10.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_12413251 3300026078 Bacteria 513
2 JGI24740J21852_10010448 3300001979 Bacteria 3573
3 JGI25155J39150_1000085 3300002704 Bacteria 53417
4 JGI25156J39149_1000139 3300002705 Bacteria 53436
5 JGI25154J39366_1000154 3300002738 Bacteria 53436
6 JGI25157J39369_1000181 3300002741 Bacteria 53436
7 JGI25152J39213_1000108 3300002773 Bacteria 58108
8 JGI25150J39212_1005982 3300002774 Bacteria 2553
9 JGI25159J45721_1000660 3300002987 Bacteria 15290
10 JGI25159J45721_1003204 3300002987 Bacteria 5862
11 JGI25151J46595_10007180 3300003187 Bacteria 5490
12 JGI25151J46595_10031895 3300003187 Bacteria 2050
13 JGI25151J46595_10099663 3300003187 Bacteria 786
14 JGI25160J50197_1000458 3300003354 Bacteria 25369
15 JGI25161J50226_1000335 3300003374 Bacteria 25369
16 Ga0055542_1000295 3300003762 Bacteria 55507
17 Ga0055526_1015658 3300003771 Bacteria 3030
18 Ga0055537_1000504 3300003773 Bacteria 23556
19 Ga0055537_1010174 3300003773 Bacteria 2003
20 Ga0055524_1000120 3300003775 Bacteria 91299
21 Ga0055524_1089075 3300003775 Bacteria 540
22 Ga0055536_1027535 3300003781 Bacteria 1568
23 Ga0055534_1031264 3300003784 Bacteria 819
24 Ga0055528_1000996 3300003790 Bacteria 18803
25 Ga0055530_10001942 3300003791 Bacteria 14112
26 Ga0055540_1000067 3300003792 Bacteria 122108
27 Ga0055531_10003115 3300003794 Bacteria 10705
28 Ga0055543_1000744 3300004625 Bacteria 16452
29 Ga0065165_1008422 3300005262 Bacteria 4828
30 Ga0070683_100049874 3300005329 Bacteria 3873
31 Ga0070670_100017303 3300005331 Bacteria 6183
32 Ga0068869_101693559 3300005334 Unclassified 564
33 Ga0070680_100006980 3300005336 Bacteria 8609
34 Ga0070680_100293137 3300005336 Bacteria 1379
35 Ga0070682_100016167 3300005337 Bacteria 4335
36 Ga0070682_100198949 3300005337 Bacteria 1412
37 Ga0068868_101078038 3300005338 Bacteria 738
38 Ga0070660_101058076 3300005339 Unclassified 686
39 Ga0070689_100397609 3300005340 Bacteria 1164
40 Ga0070687_100651776 3300005343 Bacteria 730
41 Ga0070661_100007666 3300005344 Bacteria 7452
42 Ga0070673_101122669 3300005364 Bacteria 735
43 Ga0070659_100722550 3300005366 Bacteria 862
44 Ga0070709_10356379 3300005434 Bacteria 1082
45 Ga0070708_101276410 3300005445 Bacteria 686
46 Ga0070708_101646581 3300005445 Bacteria 597
47 Ga0070662_101526851 3300005457 Bacteria 576
48 Ga0070681_10003294 3300005458 Bacteria 15075
49 Ga0070681_10003649 3300005458 Bacteria 14448
50 Ga0070707_100147665 3300005468 Unclassified 2288
51 Ga0070698_100073362 3300005471 Unclassified 3429
52 Ga0070698_100271143 3300005471 Unclassified 1629
53 Ga0070699_100116313 3300005518 Bacteria 2350
54 Ga0070699_100148200 3300005518 Unclassified 2074
55 Ga0070699_100661198 3300005518 Bacteria 954
56 Ga0070679_100013561 3300005530 Bacteria 7809
57 Ga0070679_100016726 3300005530 Bacteria 7086
58 Ga0070684_100000480 3300005535 Bacteria 27364
59 Ga0070684_101158004 3300005535 Unclassified 727
60 Ga0070697_100366490 3300005536 Bacteria 1246
61 Ga0068853_101472835 3300005539 Unclassified 659
62 Ga0070696_100303094 3300005546 Bacteria 1224
63 Ga0070696_100451784 3300005546 Bacteria 1014
64 Ga0070693_100138170 3300005547 Bacteria 1531
65 Ga0070693_100459268 3300005547 Bacteria 895
66 Ga0070665_102170542 3300005548 Unclassified 559
67 Ga0070664_100014935 3300005564 Bacteria 6336
68 Ga0068857_100090665 3300005577 Bacteria 2735
69 Ga0068866_10236761 3300005718 Bacteria 1110
70 Ga0068863_100232106 3300005841 Bacteria 1780
71 Ga0068860_101562295 3300005843 Unclassified 682
72 Ga0081540_1133790 3300005983 Unclassified 1007
73 Ga0075368_10191953 3300006042 Bacteria 863
74 Ga0075363_100155555 3300006048 Bacteria 1292
75 Ga0075363_100424776 3300006048 Bacteria 783
76 Ga0075364_10113713 3300006051 Bacteria 1808
77 Ga0075364_10353985 3300006051 Bacteria 1001
78 Ga0075432_10031857 3300006058 Bacteria 1825
79 Ga0075362_10086406 3300006177 Bacteria 1451
80 Ga0075362_10120662 3300006177 Bacteria 1241
81 Ga0075362_10318995 3300006177 Bacteria 774
82 Ga0075362_10740179 3300006177 Bacteria 515
83 Ga0075367_10557858 3300006178 Bacteria 727
84 Ga0075366_10056575 3300006195 Bacteria 2330
85 Ga0075366_10480601 3300006195 Bacteria 767
86 Ga0075366_10527328 3300006195 Bacteria 731
87 Ga0075370_10066215 3300006353 Bacteria 2061
88 Ga0075428_100781573 3300006844 Bacteria 1015
89 Ga0075430_100276005 3300006846 Bacteria 1391
90 Ga0075431_100070892 3300006847 Bacteria 3595
91 Ga0075434_100913916 3300006871 Bacteria 892
92 Ga0075429_100011180 3300006880 Bacteria 7771
93 Ga0075436_100528808 3300006914 Bacteria 864
94 Ga0079104_1020372 3300006946 Bacteria 1829
95 Ga0099826_10043692 3300006948 Bacteria 3081
96 Ga0075435_100030499 3300007076 Bacteria 4241
97 Ga0075435_100110927 3300007076 Unclassified 2282
98 Ga0075435_100226291 3300007076 Bacteria 1589
99 Ga0105245_10331607 3300009098 Bacteria 1502
100 Ga0114129_10085921 3300009147 Bacteria 4364
101 Ga0114129_10343152 3300009147 Bacteria 1980
102 Ga0114129_10518992 3300009147 Unclassified 1553
103 Ga0105243_12575934 3300009148 Bacteria 548
104 Ga0105242_10410672 3300009176 Bacteria 1266
105 Ga0105249_12038009 3300009553 Unclassified 647
106 Ga0105246_10424292 3300011119 Bacteria 1111
107 Ga0157373_10036060 3300013100 Bacteria 3550
108 Ga0157378_10318642 3300013297 Bacteria 1510
109 Ga0163162_11113796 3300013306 Unclassified 895
110 Ga0163162_13046820 3300013306 Bacteria 538
111 Ga0157372_11050893 3300013307 Unclassified 943
112 Ga0157372_11555054 3300013307 Bacteria 762
113 Ga0157375_11263697 3300013308 Unclassified 867
114 Ga0182008_10411933 3300014497 Bacteria 728
115 Ga0157376_10702137 3300014969 Bacteria 1017
116 Ga0157376_12295741 3300014969 Unclassified 579
117 Ga0209435_100003 3300025206 Bacteria 669534
118 Ga0209436_109595 3300025208 Bacteria 1829
119 Ga0207425_1002328 3300025245 Bacteria 6797
120 Ga0207425_1006561 3300025245 Bacteria 3169
121 Ga0209646_1000008 3300025246 Bacteria 669534
122 Ga0209026_1000007 3300025250 Bacteria 669534
123 Ga0209759_1000019 3300025256 Bacteria 357908
124 Ga0209129_1005722 3300025258 Bacteria 4277
125 Ga0209565_1000116 3300025263 Bacteria 114340
126 Ga0209565_1000461 3300025263 Bacteria 31259
127 Ga0209565_1009073 3300025263 Bacteria 2557
128 Ga0209673_1000305 3300025273 Bacteria 91144
129 Ga0209130_1000134 3300025284 Bacteria 119102
130 Ga0209130_1000202 3300025284 Bacteria 80333
131 Ga0209675_1001948 3300025291 Bacteria 11146
132 Ga0209675_1003408 3300025291 Bacteria 7575
133 Ga0209676_1000145 3300025292 Bacteria 174391
134 Ga0209676_1067671 3300025292 Bacteria 861
135 Ga0209025_1002204 3300025294 Bacteria 21559
136 Ga0209025_1002769 3300025294 Bacteria 17697
137 Ga0209025_1002831 3300025294 Bacteria 17445
138 Ga0209564_1001164 3300025295 Bacteria 30586
139 Ga0209564_1007853 3300025295 Bacteria 5408
140 Ga0209758_1006927 3300025297 Bacteria 7907
141 Ga0209050_1000023 3300025298 Bacteria 537172
142 Ga0209050_1003300 3300025298 Bacteria 12085
143 Ga0209050_1004117 3300025298 Bacteria 10127
144 Ga0209256_1000003 3300025299 Bacteria 1661127
145 Ga0209256_1060250 3300025299 Bacteria 886
146 Ga0209256_1065855 3300025299 Bacteria 829
147 Ga0207426_1000145 3300025302 Bacteria 191065
148 Ga0207426_1000618 3300025302 Bacteria 45326
149 Ga0209051_1000017 3300025303 Bacteria 537172
150 Ga0209257_1000041 3300025304 Bacteria 537172
151 Ga0209257_1003028 3300025304 Bacteria 15207
152 Ga0207642_10037216 3300025899 Bacteria 2095
153 Ga0207699_10318242 3300025906 Bacteria 1091
154 Ga0207705_10072578 3300025909 Bacteria 2497
155 Ga0207707_10015219 3300025912 Bacteria 6698
156 Ga0207707_10138077 3300025912 Bacteria 2131
157 Ga0207671_10707246 3300025914 Bacteria 801
158 Ga0207660_10029819 3300025917 Bacteria 3746
159 Ga0207660_10586492 3300025917 Unclassified 907
160 Ga0207649_10440032 3300025920 Unclassified 982
161 Ga0207652_10008807 3300025921 Bacteria 8126
162 Ga0207646_10625271 3300025922 Bacteria 966
163 Ga0207646_11343449 3300025922 Eukaryota 623
164 Ga0207650_10010119 3300025925 Bacteria 6462
165 Ga0207687_10810998 3300025927 Bacteria 798
166 Ga0207706_11150277 3300025933 Bacteria 647
167 Ga0207686_10364772 3300025934 Unclassified 1091
168 Ga0207670_11403598 3300025936 Bacteria 593
169 Ga0207669_10207367 3300025937 Bacteria 1428
170 Ga0207704_10264893 3300025938 Bacteria 1298
171 Ga0207661_10135879 3300025944 Bacteria 2111
172 Ga0207679_10086217 3300025945 Bacteria 2414
173 Ga0207679_10199525 3300025945 Bacteria 1670
174 Ga0207641_10238084 3300026088 Bacteria 1695
175 Ga0207648_10118378 3300026089 Bacteria 2328
176 Ga0207674_10044838 3300026116 Bacteria 4554
177 Ga0209984_1055171 3300027424 Unclassified 584
178 Ga0268266_10724415 3300028379 Bacteria 959
179 Ga0265337_1135790 3300028556 Unclassified 666
180 Ga0265326_10004049 3300028558 Bacteria 4737
181 Ga0265322_10002917 3300028654 Bacteria 5206
182 Ga0265338_10017684 3300028800 Bacteria 7666
183 Ga0265324_10002989 3300029957 Bacteria 8265
184 Ga0265339_10045126 3300031249 Bacteria 2427
185 Ga0265316_10007460 3300031344 Bacteria 10308
186 Ga0307513_10000020 3300031456 Bacteria 228745
187 Ga0307408_100005371 3300031548 Bacteria 8580
188 Ga0307516_10762926 3300031730 Bacteria 627
189 Ga0307412_11012913 3300031911 Bacteria 734
190 Ga0307414_10350908 3300032004 Bacteria 1266
191 Ga0307411_10592442 3300032005 Bacteria 952
192 Ga0373935_0432782 3300035692 Unclassified 948
193 Ga0373933_1015302 3300035724 Unclassified 546
194 Ga0373937_0102746 3300036401 Bacteria 2654
195 Ga0373937_0392552 3300036401 Bacteria 1316
196 Ga0395905_0476849 3300037471 Bacteria 1147
197 Ga0451791_1202851 3300041451 Bacteria 899
198 Ga0451800_1006086 3300041459 Bacteria 1274
199 Ga0451807_1046926 3300041486 Bacteria 562
200 Ga0451835_0243312 3300041492 Bacteria 1763
201 Ga0451839_0119291 3300041496 Bacteria 916
202 Ga0451853_0225720 3300041512 Bacteria 1387
203 Ga0451853_2704819 3300041512 Bacteria 931
204 Ga0453683_0033487 3300044673 Bacteria 3240
205 Ga0495656_0113130 3300046615 Bacteria 1272
206 Ga0495669_0165350 3300046684 Bacteria 1051
207 Ga0495686_0118238 3300047472 Bacteria 1582
208 Ga0496126_1121667 3300048929 Unclassified 583
209 nmdc:mga03683_665713_c1 3300050489 Bacteria 513
210 nmdc:mga03683_71288_c1 3300050489 Bacteria 1486
211 nmdc:mga03n38_335610_c1 3300050490 Bacteria 819
212 nmdc:mga00v17_145409_c1 3300050491 Bacteria 1521
213 nmdc:mga0k408_499164_c1 3300050493 Bacteria 721
214 nmdc:mga06z11_700881_c1 3300050494 Unclassified 617
215 nmdc:mga05p37_141378_c1 3300050507 Bacteria 2949
216 nmdc:mga05p37_309505_c1 3300050507 Bacteria 1873
217 nmdc:mga05p37_981275_c1 3300050507 Bacteria 900
218 nmdc:mga09592_15200_c1 3300050508 Bacteria 6290
219 nmdc:mga0qj67_502776_c1 3300050509 Unclassified 974
220 nmdc:mga06r32_132864_c1 3300050510 Bacteria 2462
221 nmdc:mga0n895_186952_c1 3300050512 Bacteria 2103
222 nmdc:mga0rr50_101207_c1 3300050513 Bacteria 2265
223 nmdc:mga0rr50_204482_c1 3300050513 Bacteria 1624
224 nmdc:mga0rr50_894652_c1 3300050513 Bacteria 757
225 nmdc:mga0a205_258705_c1 3300050515 Bacteria 1619
226 Ga0500643_197399 3300053087 Bacteria 540
227 Ga0500644_0001321 3300053088 Bacteria 6687
228 Ga0500583_0059654 3300053092 Bacteria 1797
229 Ga0500566_0132897 3300053094 Bacteria 1329
230 Ga0500660_084016 3300053100 Bacteria 1447
231 Ga0500593_001940 3300053117 Bacteria 7461
232 Ga0500628_010316 3300053129 Bacteria 1669
233 Ga0500616_0373866 3300053153 Bacteria 575
234 Ga0500645_000168 3300053730 Bacteria 51579
235 Ga0500645_000298 3300053730 Bacteria 35533
236 Ga0500645_038806 3300053730 Bacteria 1412
237 2509140225 2508501127 Bacteria 7037543
238 2511247196 2511231002 Bacteria 5042903
239 2841735915 2841734538 Bacteria 6784580
240 2856349295 2856342000 Bacteria 7176905
241 2869166207 2869162929 Bacteria 6399702
242 2871480104 2871474448 Bacteria 6806570
243 2878789042 2878788777 Bacteria 6567085
244 2885314615 2885312484 Bacteria 6415165
245 2888343890 2888343758 Bacteria 6611049
246 2924760340 2924754689 Bacteria 6774424
247 2937841017 2937836603 Bacteria 6811263
248 2937853952 2937848649 Bacteria 6983481
249 2958076218 2958071322 Bacteria 6815895
250 2970525593 2970524798 Bacteria 6840927
251 2970543045 2970540015 Bacteria 6977556
252 2977926067 2977922695 Bacteria 6956781
253 2977987162 2977986579 Bacteria 6581278
254 3004216610 3004211236 Bacteria 7417683
255 3004218821 3004218560 Bacteria 7421728
256 8004397910 8004395343 Bacteria 6620908
257 8004638751 8004633249 Bacteria 6723080
258 8055617414 8055617313 Bacteria 7548464
259 Ga0207702_12413251
260 JGI24740J21852_10010448
261 JGI25155J39150_1000085
262 JGI25156J39149_1000139
263 JGI25154J39366_1000154
264 JGI25157J39369_1000181
265 JGI25152J39213_1000108
266 JGI25150J39212_1005982
267 JGI25159J45721_1000660
268 JGI25159J45721_1003204
269 JGI25151J46595_10007180
270 JGI25151J46595_10031895
271 JGI25151J46595_10099663
272 JGI25160J50197_1000458
273 JGI25161J50226_1000335
274 Ga0055542_1000295
275 Ga0055526_1015658
276 Ga0055537_1000504
277 Ga0055537_1010174
278 Ga0055524_1000120
279 Ga0055524_1089075
280 Ga0055536_1027535
281 Ga0055534_1031264
282 Ga0055528_1000996
283 Ga0055530_10001942
284 Ga0055540_1000067
285 Ga0055531_10003115
286 Ga0055543_1000744
287 Ga0065165_1008422
288 Ga0070683_100049874
289 Ga0070670_100017303
290 Ga0068869_101693559
291 Ga0070680_100006980
292 Ga0070680_100293137
293 Ga0070682_100016167
294 Ga0070682_100198949
295 Ga0068868_101078038
296 Ga0070660_101058076
297 Ga0070689_100397609
298 Ga0070687_100651776
299 Ga0070661_100007666
300 Ga0070673_101122669
301 Ga0070659_100722550
302 Ga0070709_10356379
303 Ga0070708_101276410
304 Ga0070708_101646581
305 Ga0070662_101526851
306 Ga0070681_10003294
307 Ga0070681_10003649
308 Ga0070707_100147665
309 Ga0070698_100073362
310 Ga0070698_100271143
311 Ga0070699_100116313
312 Ga0070699_100148200
313 Ga0070699_100661198
314 Ga0070679_100013561
315 Ga0070679_100016726
316 Ga0070684_100000480
317 Ga0070684_101158004
318 Ga0070697_100366490
319 Ga0068853_101472835
320 Ga0070696_100303094
321 Ga0070696_100451784
322 Ga0070693_100138170
323 Ga0070693_100459268
324 Ga0070665_102170542
325 Ga0070664_100014935
326 Ga0068857_100090665
327 Ga0068866_10236761
328 Ga0068863_100232106
329 Ga0068860_101562295
330 Ga0081540_1133790
331 Ga0075368_10191953
332 Ga0075363_100155555
333 Ga0075363_100424776
334 Ga0075364_10113713
335 Ga0075364_10353985
336 Ga0075432_10031857
337 Ga0075362_10086406
338 Ga0075362_10120662
339 Ga0075362_10318995
340 Ga0075362_10740179
341 Ga0075367_10557858
342 Ga0075366_10056575
343 Ga0075366_10480601
344 Ga0075366_10527328
345 Ga0075370_10066215
346 Ga0075428_100781573
347 Ga0075430_100276005
348 Ga0075431_100070892
349 Ga0075434_100913916
350 Ga0075429_100011180
351 Ga0075436_100528808
352 Ga0079104_1020372
353 Ga0099826_10043692
354 Ga0075435_100030499
355 Ga0075435_100110927
356 Ga0075435_100226291
357 Ga0105245_10331607
358 Ga0114129_10085921
359 Ga0114129_10343152
360 Ga0114129_10518992
361 Ga0105243_12575934
362 Ga0105242_10410672
363 Ga0105249_12038009
364 Ga0105246_10424292
365 Ga0157373_10036060
366 Ga0157378_10318642
367 Ga0163162_11113796
368 Ga0163162_13046820
369 Ga0157372_11050893
370 Ga0157372_11555054
371 Ga0157375_11263697
372 Ga0182008_10411933
373 Ga0157376_10702137
374 Ga0157376_12295741
375 Ga0209435_100003
376 Ga0209436_109595
377 Ga0207425_1002328
378 Ga0207425_1006561
379 Ga0209646_1000008
380 Ga0209026_1000007
381 Ga0209759_1000019
382 Ga0209129_1005722
383 Ga0209565_1000116
384 Ga0209565_1000461
385 Ga0209565_1009073
386 Ga0209673_1000305
387 Ga0209130_1000134
388 Ga0209130_1000202
389 Ga0209675_1001948
390 Ga0209675_1003408
391 Ga0209676_1000145
392 Ga0209676_1067671
393 Ga0209025_1002204
394 Ga0209025_1002769
395 Ga0209025_1002831
396 Ga0209564_1001164
397 Ga0209564_1007853
398 Ga0209758_1006927
399 Ga0209050_1000023
400 Ga0209050_1003300
401 Ga0209050_1004117
402 Ga0209256_1000003
403 Ga0209256_1060250
404 Ga0209256_1065855
405 Ga0207426_1000145
406 Ga0207426_1000618
407 Ga0209051_1000017
408 Ga0209257_1000041
409 Ga0209257_1003028
410 Ga0207642_10037216
411 Ga0207699_10318242
412 Ga0207705_10072578
413 Ga0207707_10015219
414 Ga0207707_10138077
415 Ga0207671_10707246
416 Ga0207660_10029819
417 Ga0207660_10586492
418 Ga0207649_10440032
419 Ga0207652_10008807
420 Ga0207646_10625271
421 Ga0207646_11343449
422 Ga0207650_10010119
423 Ga0207687_10810998
424 Ga0207706_11150277
425 Ga0207686_10364772
426 Ga0207670_11403598
427 Ga0207669_10207367
428 Ga0207704_10264893
429 Ga0207661_10135879
430 Ga0207679_10086217
431 Ga0207679_10199525
432 Ga0207641_10238084
433 Ga0207648_10118378
434 Ga0207674_10044838
435 Ga0209984_1055171
436 Ga0268266_10724415
437 Ga0265337_1135790
438 Ga0265326_10004049
439 Ga0265322_10002917
440 Ga0265338_10017684
441 Ga0265324_10002989
442 Ga0265339_10045126
443 Ga0265316_10007460
444 Ga0307513_10000020
445 Ga0307408_100005371
446 Ga0307516_10762926
447 Ga0307412_11012913
448 Ga0307414_10350908
449 Ga0307411_10592442
450 Ga0373935_0432782
451 Ga0373933_1015302
452 Ga0373937_0102746
453 Ga0373937_0392552
454 Ga0395905_0476849
455 Ga0451791_1202851
456 Ga0451800_1006086
457 Ga0451807_1046926
458 Ga0451835_0243312
459 Ga0451839_0119291
460 Ga0451853_0225720
461 Ga0451853_2704819
462 Ga0453683_0033487
463 Ga0495656_0113130
464 Ga0495669_0165350
465 Ga0495686_0118238
466 Ga0496126_1121667
467 nmdc:mga03683_665713_c1
468 nmdc:mga03683_71288_c1
469 nmdc:mga03n38_335610_c1
470 nmdc:mga00v17_145409_c1
471 nmdc:mga0k408_499164_c1
472 nmdc:mga06z11_700881_c1
473 nmdc:mga05p37_141378_c1
474 nmdc:mga05p37_309505_c1
475 nmdc:mga05p37_981275_c1
476 nmdc:mga09592_15200_c1
477 nmdc:mga0qj67_502776_c1
478 nmdc:mga06r32_132864_c1
479 nmdc:mga0n895_186952_c1
480 nmdc:mga0rr50_101207_c1
481 nmdc:mga0rr50_204482_c1
482 nmdc:mga0rr50_894652_c1
483 nmdc:mga0a205_258705_c1
484 Ga0500643_197399
485 Ga0500644_0001321
486 Ga0500583_0059654
487 Ga0500566_0132897
488 Ga0500660_084016
489 Ga0500593_001940
490 Ga0500628_010316
491 Ga0500616_0373866
492 Ga0500645_000168
493 Ga0500645_000298
494 Ga0500645_038806
495 2509140225
496 2511247196
497 2841735915
498 2856349295
499 2869166207
500 2871480104
501 2878789042
502 2885314615
503 2888343890
504 2924760340
505 2937841017
506 2937853952
507 2958076218
508 2970525593
509 2970543045
510 2977926067
511 2977987162
512 3004216610
513 3004218821
514 8004397910
515 8004638751
516 8055617414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

139

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8276 1 122
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8236 1 122
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8229 1 122
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8182 4 125
4nb0-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8137 4 122
ID Description Score Start End Superfamily
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8444 5 54 3.30.720.120
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8252 8 52 3.30.720.120
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8203 4 125 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.808 7 124 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8072 4 125 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4S0ZUZ8-F1-model_v4 deleted 0.9752 1 125
AF-A6SWT0-F1-model_v4 Uncharacterized conserved protein 0.9734 1 125
AF-A0A2T4VEU5-F1-model_v4 VOC domain-containing protein 0.9717 2 123
AF-A0A2V8EBM5-F1-model_v4 Glyoxalase 0.9711 1 123
AF-A0A1Q3HA92-F1-model_v4 Glyoxalase 0.9681 1 123

Map