F368262

General Info

Members Datasets Scaffolds Average Seq Length
258 177 220 277

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0484461|Ga0451793_0484461_286_1248
Length 320
Sequence MEAPAAHQPKKADTGLCGRDCAPPSKVNRTLLRSMVIRVSLGSAEETTGAAKALRIATVNVNGIRAAYKRGMADWLAERDVDILCLQEVRAPDAVVRGLLGDEWHILHAEAEAKGRAGVAIASRMAPAATREHIGDEYFATSGRWVEADFKVSVDGAEKMLTVVSAYVHSGEVDTPKQVDKYRFLDVMTERLPALKQQSDFVLVVGDLNVGHTTLDIKNWKGNVKRAGFLPDERAYFDRFFSDEIGYTDVARKLAGDVPGPYTWWSWRGQAFDNDSGWRIDYHLATPGLAERAVTAVVDRAATYDSRFSDHAPVVVDYQF

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221572 Leifsonia sp. Root60 Isolate Unclassified
5 2643221619 Agromyces sp. Root81 Isolate Unclassified
6 2643221649 Leifsonia sp. Root4 Isolate Unclassified
7 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
8 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
9 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
10 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
11 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
12 2739367653 Kocuria sp. OV113 Isolate Unclassified
13 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
14 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
15 2773857759 Microbacterium sp. 1294 Isolate Unclassified
16 2808606372 Agromyces sp. 23-23 Isolate Unclassified
17 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
18 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
19 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
20 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
21 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
22 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
23 2857727296 Kocuria sp. R-72562 Isolate Unclassified
24 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
25 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
26 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
27 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
28 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
29 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
30 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
31 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
32 2920879853 Kocuria salina CV6 Isolate Unclassified
33 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
34 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
35 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
36 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
94 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
95 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
96 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
97 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
170 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
177 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.4
Metatranscriptomes 3.88
Isolates 14.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 12.02
Nodule 0
Rhizoplane 6.59
Rhizosphere 62.79
Stem 0
Stem Tuber 0
Unclassified 18.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10023313 3300001979 Bacteria 2116
2 rootL2_10058012 3300003322 Bacteria 1986
3 Ga0055539_1000027 3300003752 Bacteria 258020
4 Ga0055533_1000020 3300003756 Bacteria 353998
5 Ga0055525_1000605 3300003759 Bacteria 15142
6 Ga0055525_1002425 3300003759 Bacteria 1914
7 Ga0055527_1000003 3300003760 Bacteria 705001
8 Ga0055542_1000066 3300003762 Bacteria 154802
9 Ga0055529_1000006 3300003763 Bacteria 416978
10 Ga0055541_1002587 3300003841 Bacteria 3574
11 Ga0065714_10011347 3300005288 Bacteria 2183
12 Ga0065714_10067905 3300005288 Bacteria 5121
13 Ga0070658_10006173 3300005327 Bacteria 9716
14 Ga0070658_10159699 3300005327 Bacteria 1891
15 Ga0070671_100107803 3300005355 Bacteria 2339
16 Ga0070684_100262746 3300005535 Bacteria 1579
17 Ga0070665_100307026 3300005548 Bacteria 1590
18 Ga0068862_100222306 3300005844 Bacteria 1710
19 Ga0075365_10018611 3300006038 Bacteria 4274
20 Ga0105244_10017010 3300009036 Bacteria 4122
21 Ga0105243_10040367 3300009148 Bacteria 3645
22 Ga0105243_10042745 3300009148 Bacteria 3549
23 Ga0157369_10002805 3300013105 Bacteria 20805
24 Ga0157369_10348268 3300013105 Bacteria 1539
25 Ga0157369_10549684 3300013105 Bacteria 1193
26 Ga0157372_10127978 3300013307 Bacteria 2921
27 Ga0157380_10015545 3300014326 Bacteria 5595
28 Ga0197907_11200671 3300020069 Bacteria 1607
29 Ga0206350_10648578 3300020080 Bacteria 1269
30 Ga0209566_100043 3300025225 Bacteria 266609
31 Ga0209674_100001 3300025226 Bacteria 4013750
32 Ga0209672_100003 3300025228 Bacteria 1560476
33 Ga0209147_100287 3300025229 Bacteria 42863
34 Ga0209563_100001 3300025230 Bacteria 4013775
35 Ga0209563_103601 3300025230 Bacteria 3159
36 Ga0209258_103217 3300025242 Bacteria 3648
37 Ga0209677_100001 3300025253 Bacteria 4013787
38 Ga0209148_1000004 3300025254 Bacteria 1844481
39 Ga0209233_1022821 3300025261 Bacteria 1595
40 Ga0209455_1000046 3300025272 Bacteria 382681
41 Ga0207655_1001398 3300025728 Bacteria 22553
42 Ga0207644_10167039 3300025931 Bacteria 1715
43 Ga0207709_10009911 3300025935 Bacteria 5247
44 Ga0207709_10025449 3300025935 Bacteria 3388
45 Ga0207702_10089910 3300026078 Bacteria 2686
46 Ga0207675_100036502 3300026118 Bacteria 4584
47 Ga0207683_10294337 3300026121 Bacteria 1485
48 Ga0268265_10216784 3300028380 Bacteria 1672
49 Ga0307513_10001682 3300031456 Bacteria 31664
50 Ga0307408_100204030 3300031548 Bacteria 1602
51 Ga0316579_10000185 3300031691 Bacteria 18097
52 Ga0307405_10065536 3300031731 Bacteria 2313
53 Ga0307405_10236031 3300031731 Bacteria 1351
54 Ga0307410_10060812 3300031852 Bacteria 2583
55 Ga0307410_10077366 3300031852 Bacteria 2325
56 Ga0307406_10047738 3300031901 Bacteria 2700
57 Ga0307407_10037384 3300031903 Bacteria 2682
58 Ga0307412_10037537 3300031911 Bacteria 3114
59 Ga0307412_10097359 3300031911 Bacteria 2073
60 Ga0307412_10466100 3300031911 Bacteria 1044
61 Ga0307412_10598996 3300031911 Bacteria 933
62 Ga0307409_100010208 3300031995 Bacteria 5821
63 Ga0307409_100093544 3300031995 Bacteria 2471
64 Ga0307409_100121123 3300031995 Bacteria 2216
65 Ga0307416_100011163 3300032002 Bacteria 5972
66 Ga0307416_100863107 3300032002 Bacteria 1004
67 Ga0307415_100689945 3300032126 Bacteria 920
68 Ga0395899_0017170 3300037312 Bacteria 5514
69 Ga0395899_0040937 3300037312 Bacteria 3464
70 Ga0395899_0042766 3300037312 Bacteria 3381
71 Ga0395900_0041436 3300037418 Bacteria 4747
72 Ga0395900_0150558 3300037418 Bacteria 2377
73 Ga0395900_0217426 3300037418 Bacteria 1928
74 Ga0395900_0241617 3300037418 Bacteria 1811
75 Ga0395898_0006756 3300037466 Bacteria 12220
76 Ga0395898_0037791 3300037466 Bacteria 4787
77 Ga0395898_0064635 3300037466 Bacteria 3548
78 Ga0395905_0048752 3300037471 Bacteria 3968
79 Ga0395901_0003996 3300038443 Bacteria 14852
80 Ga0395901_0028870 3300038443 Bacteria 5706
81 Ga0395901_0161481 3300038443 Bacteria 2353
82 Ga0451789_0490690 3300041443 Bacteria 1137
83 Ga0451793_0484461 3300041452 Bacteria 1593
84 Ga0451797_0092862 3300041453 Bacteria 1125
85 Ga0451795_0877241 3300041456 Bacteria 1399
86 Ga0451806_802248 3300041462 Bacteria 1248
87 Ga0451807_2675902 3300041486 Bacteria 818
88 Ga0451833_0539519 3300041491 Bacteria 1885
89 Ga0451843_1022985 3300041509 Bacteria 3253
90 Ga0466972_0044888 3300044658 Bacteria 2142
91 Ga0466965_0044763 3300044683 Bacteria 2188
92 Ga0466965_0096840 3300044683 Bacteria 1506
93 Ga0466966_0062073 3300044684 Bacteria 2356
94 Ga0466966_0197519 3300044684 Bacteria 1218
95 Ga0466966_0286383 3300044684 Bacteria 991
96 Ga0466961_0073904 3300044693 Bacteria 2161
97 Ga0466971_0051619 3300044719 Bacteria 1851
98 Ga0466968_0048765 3300044735 Bacteria 1803
99 Ga0466970_0010160 3300044765 Bacteria 4770
100 Ga0466970_0049982 3300044765 Bacteria 2230
101 Ga0466960_0059484 3300044901 Bacteria 1869
102 Ga0466959_0028315 3300045049 Bacteria 4155
103 Ga0466959_0211211 3300045049 Bacteria 1349
104 Ga0466958_0019538 3300045836 Bacteria 3945
105 Ga0466967_0212807 3300045976 Bacteria 1834
106 Ga0495590_0000261 3300046457 Bacteria 28801
107 Ga0495638_0076455 3300046460 Bacteria 2040
108 Ga0495686_0029982 3300047472 Bacteria 3535
109 Ga0495626_0042291 3300048091 Bacteria 2141
110 Ga0496100_0045554 3300048903 Bacteria 2815
111 Ga0496100_0460935 3300048903 Bacteria 975
112 Ga0496102_0117381 3300048905 Bacteria 2483
113 Ga0496103_0185141 3300048906 Bacteria 1338
114 Ga0496104_0033841 3300048907 Bacteria 4763
115 Ga0496105_0233206 3300048908 Bacteria 1495
116 Ga0496109_0611446 3300048912 Bacteria 1026
117 Ga0496114_0078580 3300048917 Bacteria 2784
118 Ga0496114_0376859 3300048917 Bacteria 1256
119 Ga0496115_0051938 3300048918 Bacteria 3287
120 Ga0496115_0320358 3300048918 Bacteria 1268
121 Ga0496116_0103430 3300048919 Bacteria 1695
122 Ga0496117_0003899 3300048920 Bacteria 16913
123 Ga0496117_0027313 3300048920 Bacteria 4449
124 Ga0496117_0029834 3300048920 Bacteria 4197
125 Ga0496118_0010728 3300048921 Bacteria 9033
126 Ga0496118_0164476 3300048921 Bacteria 1366
127 Ga0496119_0004797 3300048922 Bacteria 13271
128 Ga0496119_0021431 3300048922 Bacteria 4673
129 Ga0496122_0000795 3300048925 Bacteria 60495
130 Ga0496122_0001647 3300048925 Bacteria 34658
131 Ga0496122_0001685 3300048925 Bacteria 34241
132 Ga0496122_0027452 3300048925 Bacteria 4866
133 Ga0496123_0000802 3300048926 Bacteria 50829
134 Ga0496123_0000951 3300048926 Bacteria 45055
135 Ga0496123_0022645 3300048926 Bacteria 4834
136 Ga0496124_0012436 3300048927 Bacteria 8402
137 Ga0496125_0000128 3300048928 Bacteria 163865
138 Ga0496125_0000859 3300048928 Bacteria 48719
139 Ga0496125_0055918 3300048928 Bacteria 3210
140 Ga0496126_0018502 3300048929 Bacteria 6899
141 Ga0496126_0027217 3300048929 Bacteria 5465
142 Ga0496126_0064486 3300048929 Bacteria 3281
143 Ga0496126_0115298 3300048929 Bacteria 2336
144 Ga0501312_007457 3300049528 Bacteria 1394
145 Ga0501312_013504 3300049528 Bacteria 1137
146 Ga0501315_006412 3300049531 Bacteria 1308
147 Ga0501316_004615 3300049532 Bacteria 1390
148 Ga0501316_007190 3300049532 Bacteria 1204
149 Ga0501317_001582 3300049533 Bacteria 1990
150 Ga0501318_001693 3300049534 Bacteria 1788
151 Ga0501321_004247 3300049537 Bacteria 1361
152 Ga0501031_0005740 3300049568 Bacteria 8087
153 Ga0501032_0001797 3300049569 Bacteria 16930
154 Ga0501033_0017462 3300049570 Bacteria 5420
155 Ga0501033_0040394 3300049570 Bacteria 3483
156 Ga0501033_0053391 3300049570 Bacteria 2993
157 Ga0501034_0014897 3300049571 Bacteria 7996
158 Ga0501034_0020535 3300049571 Bacteria 6745
159 Ga0501034_0295299 3300049571 Bacteria 1558
160 Ga0501036_0006146 3300049572 Bacteria 9741
161 Ga0501036_0020525 3300049572 Bacteria 5548
162 Ga0501037_0003716 3300049573 Bacteria 11080
163 Ga0501038_0088714 3300049574 Bacteria 2595
164 Ga0501039_0002824 3300049575 Bacteria 12980
165 Ga0501039_0011903 3300049575 Bacteria 6630
166 Ga0501040_0000815 3300049576 Bacteria 19447
167 Ga0501041_0048516 3300049577 Bacteria 2586
168 Ga0501042_0257023 3300049578 Bacteria 1261
169 Ga0501043_0003423 3300049579 Bacteria 13031
170 Ga0501043_0048540 3300049579 Bacteria 3337
171 Ga0501046_0003656 3300049580 Bacteria 14081
172 Ga0501046_0034599 3300049580 Bacteria 4075
173 Ga0501046_0036416 3300049580 Bacteria 3959
174 Ga0501046_0135184 3300049580 Bacteria 1868
175 Ga0501047_0008940 3300049581 Bacteria 9457
176 Ga0501047_0093314 3300049581 Bacteria 2889
177 Ga0501047_0108810 3300049581 Bacteria 2654
178 Ga0501048_0014933 3300049582 Bacteria 5744
179 Ga0501048_0037061 3300049582 Bacteria 3502
180 Ga0501068_0002949 3300049584 Bacteria 9064
181 Ga0501068_0097653 3300049584 Bacteria 1818
182 Ga0501069_0027327 3300049585 Bacteria 3127
183 Ga0501070_0000050 3300049586 Bacteria 103310
184 Ga0501070_0002470 3300049586 Bacteria 16196
185 Ga0501070_0183843 3300049586 Bacteria 1720
186 Ga0501070_0407440 3300049586 Bacteria 1099
187 Ga0501071_0021147 3300049587 Bacteria 4531
188 Ga0501073_0055118 3300049589 Bacteria 2782
189 Ga0501074_0015161 3300049590 Bacteria 5605
190 Ga0501077_0182870 3300049593 Bacteria 1332
191 Ga0501079_0023307 3300049741 Bacteria 4751
192 Ga0501080_0000025 3300049742 Bacteria 89908
193 Ga0501080_0067594 3300049742 Bacteria 3324
194 Ga0501035_0016735 3300049822 Bacteria 6761
195 Ga0501035_0018172 3300049822 Bacteria 6477
196 Ga0501035_0035797 3300049822 Bacteria 4503
197 Ga0501035_0140382 3300049822 Bacteria 2101
198 Ga0501044_0049901 3300049823 Bacteria 4319
199 Ga0501044_0133249 3300049823 Bacteria 2478
200 Ga0501044_0341070 3300049823 Bacteria 1419
201 Ga0501045_0011000 3300049824 Bacteria 6341
202 Ga0501045_0033949 3300049824 Bacteria 3702
203 Ga0501045_0512918 3300049824 Bacteria 890
204 nmdc:mga00v17_1044_c1 3300050491 Bacteria 14681
205 nmdc:mga08y16_639447_c1 3300050511 Bacteria 1069
206 Ga0500568_0007170 3300053139 Bacteria 5498
207 Ga0500573_0007302 3300053140 Bacteria 6025
208 Ga0500573_0028483 3300053140 Bacteria 3217
209 Ga0500573_0070209 3300053140 Bacteria 1999
210 Ga0500588_0047734 3300053146 Bacteria 1321
211 Ga0500616_0000109 3300053153 Bacteria 152604
212 Ga0500616_0000217 3300053153 Bacteria 90189
213 Ga0500616_0008307 3300053153 Bacteria 6466
214 Ga0500616_0016433 3300053153 Bacteria 4213
215 Ga0500645_035531 3300053730 Bacteria 1484
216 Ga0501082_0025999 3300060353 Bacteria 5045
217 Ga0501082_0185537 3300060353 Bacteria 1810
218 Ga0501082_0678027 3300060353 Bacteria 902
219 Ga0466962_0054102 3300061719 Bacteria 1918
220 Ga0530510_0077227 3300061734 Bacteria 2420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041453 Ga0451797_0092862 Ga0451797_0092862_393_1109 238
2 3300053153 Ga0500616_0008307 Ga0500616_0008307_830_1588 242
3 3300049528 Ga0501312_007457 Ga0501312_007457_44_796 245
4 3300049532 Ga0501316_004615 Ga0501316_004615_627_1379 245
5 3300031731 Ga0307405_10236031 Ga0307405_102360312 251
6 3300031852 Ga0307410_10077366 Ga0307410_100773662 251
7 3300032126 Ga0307415_100689945 Ga0307415_1006899451 251
8 3300041486 Ga0451807_2675902 Ga0451807_2675902_36_803 251
9 3300049570 Ga0501033_0053391 Ga0501033_0053391_1266_2072 251
10 3300049572 Ga0501036_0006146 Ga0501036_0006146_8078_8884 251
11 3300049575 Ga0501039_0011903 Ga0501039_0011903_2140_2946 251
12 3300049576 Ga0501040_0000815 Ga0501040_0000815_16422_17228 251
13 3300049577 Ga0501041_0048516 Ga0501041_0048516_1728_2534 251
14 3300049580 Ga0501046_0034599 Ga0501046_0034599_632_1438 251
15 3300049582 Ga0501048_0037061 Ga0501048_0037061_1066_1872 251
16 3300049584 Ga0501068_0097653 Ga0501068_0097653_336_1142 251
17 3300049587 Ga0501071_0021147 Ga0501071_0021147_2113_2919 251
18 3300049590 Ga0501074_0015161 Ga0501074_0015161_2422_3228 251
19 3300049741 Ga0501079_0023307 Ga0501079_0023307_1869_2675 251
20 3300049822 Ga0501035_0016735 Ga0501035_0016735_4356_5162 251
21 3300049824 Ga0501045_0011000 Ga0501045_0011000_3914_4720 251
22 3300049824 Ga0501045_0512918 Ga0501045_0512918_32_835 251
23 3300060353 Ga0501082_0025999 Ga0501082_0025999_1873_2679 251
24 3300060353 Ga0501082_0678027 Ga0501082_0678027_31_834 251
25 3300061734 Ga0530510_0077227 Ga0530510_0077227_692_1498 251
26 3300013105 Ga0157369_10549684 Ga0157369_105496842 252
27 3300046457 Ga0495590_0000261 Ga0495590_0000261_21096_21866 255
28 3300047472 Ga0495686_0029982 Ga0495686_0029982_751_1536 255
29 3300049589 Ga0501073_0055118 Ga0501073_0055118_75_842 255
30 3300050511 nmdc:mga08y16_639447_c1 nmdc:mga08y16_639447_c1_289_1056 255
31 iso_pu_bacteria 2643221681 2644456814 259
32 iso_pu_bacteria 2984592036 2984594945 259
33 3300005535 Ga0070684_100262746 Ga0070684_1002627461 262
34 3300013105 Ga0157369_10348268 Ga0157369_103482682 262
35 3300013307 Ga0157372_10127978 Ga0157372_101279784 262
36 3300026078 Ga0207702_10089910 Ga0207702_100899102 262
37 3300038443 Ga0395901_0161481 Ga0395901_0161481_726_1532 262
38 3300041509 Ga0451843_1022985 Ga0451843_1022985_417_1259 262
39 3300045976 Ga0466967_0212807 Ga0466967_0212807_415_1290 262
40 3300046460 Ga0495638_0076455 Ga0495638_0076455_732_1550 262
41 iso_pu_bacteria 2728369276 2729907997 262
42 3300031691 Ga0316579_10000185 Ga0316579_1000018512 263
43 3300041443 Ga0451789_0490690 Ga0451789_0490690_59_973 263
44 3300041456 Ga0451795_0877241 Ga0451795_0877241_45_872 263
45 3300048912 Ga0496109_0611446 Ga0496109_0611446_65_886 263
46 3300048925 Ga0496122_0027452 Ga0496122_0027452_1296_2111 263
47 3300048926 Ga0496123_0022645 Ga0496123_0022645_1068_1883 263
48 3300049578 Ga0501042_0257023 Ga0501042_0257023_126_962 263
49 3300049579 Ga0501043_0048540 Ga0501043_0048540_1302_2105 263
50 3300049580 Ga0501046_0135184 Ga0501046_0135184_913_1716 263
51 3300049581 Ga0501047_0093314 Ga0501047_0093314_1438_2241 263
52 3300049585 Ga0501069_0027327 Ga0501069_0027327_1681_2484 263
53 3300049586 Ga0501070_0002470 Ga0501070_0002470_2230_3033 263
54 3300049593 Ga0501077_0182870 Ga0501077_0182870_192_995 263
55 3300049742 Ga0501080_0000025 Ga0501080_0000025_1470_2273 263
56 3300050491 nmdc:mga00v17_1044_c1 nmdc:mga00v17_1044_c1_734_1549 263
57 3300053153 Ga0500616_0000217 Ga0500616_0000217_32704_33528 263
58 3300009036 Ga0105244_10017010 Ga0105244_100170103 264
59 3300009148 Ga0105243_10042745 Ga0105243_100427452 264
60 3300031456 Ga0307513_10001682 Ga0307513_1000168223 264
61 3300005355 Ga0070671_100107803 Ga0070671_1001078033 265
62 3300025931 Ga0207644_10167039 Ga0207644_101670392 265
63 3300041491 Ga0451833_0539519 Ga0451833_0539519_481_1347 265
64 3300048917 Ga0496114_0376859 Ga0496114_0376859_63_887 265
65 3300048920 Ga0496117_0027313 Ga0496117_0027313_3429_4259 265
66 3300048925 Ga0496122_0000795 Ga0496122_0000795_3217_4023 265
67 3300048925 Ga0496122_0001647 Ga0496122_0001647_33166_33996 265
68 3300048926 Ga0496123_0000951 Ga0496123_0000951_30645_31451 265
69 3300048928 Ga0496125_0000128 Ga0496125_0000128_116293_117123 265
70 3300048928 Ga0496125_0000859 Ga0496125_0000859_32097_32909 265
71 3300048929 Ga0496126_0018502 Ga0496126_0018502_2361_3185 265
72 3300053139 Ga0500568_0007170 Ga0500568_0007170_3039_3836 265
73 iso_pu_bacteria 2739367653 2739603983 265
74 iso_pu_bacteria 2811994880 2812364499 265
75 iso_pu_bacteria 2816332305 2817509715 265
76 iso_pu_bacteria 2857727296 2857728547 265
77 iso_pu_bacteria 2920879853 2920883404 265
78 iso_pu_bacteria 2946024296 2946024882 265
79 3300003322 rootL2_10058012 rootL2_100580122 266
80 3300049532 Ga0501316_007190 Ga0501316_007190_284_1126 266
81 iso_pu_bacteria 2537561592 2537900761 266
82 iso_pu_bacteria 2893684298 2893686305 266
83 3300031731 Ga0307405_10065536 Ga0307405_100655363 267
84 3300037312 Ga0395899_0040937 Ga0395899_0040937_895_1740 267
85 3300037312 Ga0395899_0042766 Ga0395899_0042766_1793_2638 267
86 3300037418 Ga0395900_0241617 Ga0395900_0241617_894_1739 267
87 3300037466 Ga0395898_0006756 Ga0395898_0006756_422_1249 267
88 3300037466 Ga0395898_0037791 Ga0395898_0037791_1653_2480 267
89 3300037466 Ga0395898_0064635 Ga0395898_0064635_244_1089 267
90 3300037471 Ga0395905_0048752 Ga0395905_0048752_2067_2912 267
91 3300038443 Ga0395901_0003996 Ga0395901_0003996_3198_4025 267
92 3300038443 Ga0395901_0028870 Ga0395901_0028870_3810_4655 267
93 3300045049 Ga0466959_0211211 Ga0466959_0211211_378_1205 267
94 iso_pu_bacteria 2857479173 2857480297 267
95 iso_pu_bacteria 2857632687 2857633725 267
96 iso_pu_bacteria 2870801768 2870803254 267
97 iso_pu_bacteria 2870804320 2870805298 267
98 iso_pu_bacteria 2906799679 2906801901 267
99 iso_pu_bacteria 2919051321 2919052771 267
100 3300031548 Ga0307408_100204030 Ga0307408_1002040302 268
101 3300031852 Ga0307410_10060812 Ga0307410_100608122 268
102 3300031901 Ga0307406_10047738 Ga0307406_100477383 268
103 3300031903 Ga0307407_10037384 Ga0307407_100373843 268
104 3300031911 Ga0307412_10037537 Ga0307412_100375372 268
105 3300031911 Ga0307412_10097359 Ga0307412_100973593 268
106 3300031995 Ga0307409_100010208 Ga0307409_1000102084 268
107 3300031995 Ga0307409_100121123 Ga0307409_1001211233 268
108 3300032002 Ga0307416_100011163 Ga0307416_1000111633 268
109 3300041452 Ga0451793_0484461 Ga0451793_0484461_286_1248 268
110 3300049528 Ga0501312_013504 Ga0501312_013504_25_900 268
111 3300049531 Ga0501315_006412 Ga0501315_006412_255_1130 268
112 3300049533 Ga0501317_001582 Ga0501317_001582_679_1554 268
113 3300049534 Ga0501318_001693 Ga0501318_001693_396_1271 268
114 3300049537 Ga0501321_004247 Ga0501321_004247_230_1105 268
115 iso_pu_bacteria 2905926851 2905928325 268
116 iso_pu_bacteria 2946003308 2946003712 268
117 iso_pu_bacteria 2643221553 2643786681 271
118 iso_pu_bacteria 2643221724 2644681361 271
119 iso_pu_bacteria 2728369380 2730230206 271
120 iso_pu_bacteria 2747842429 2747951664 271
121 iso_pu_bacteria 2904430863 2904433543 272
122 3300025728 Ga0207655_1001398 Ga0207655_100139814 273
123 3300025935 Ga0207709_10009911 Ga0207709_100099112 273
124 3300044658 Ga0466972_0044888 Ga0466972_0044888_385_1206 273
125 3300044684 Ga0466966_0062073 Ga0466966_0062073_1317_2138 273
126 3300044693 Ga0466961_0073904 Ga0466961_0073904_988_1809 273
127 3300044719 Ga0466971_0051619 Ga0466971_0051619_228_1049 273
128 3300044901 Ga0466960_0059484 Ga0466960_0059484_335_1156 273
129 3300045836 Ga0466958_0019538 Ga0466958_0019538_713_1534 273
130 3300061719 Ga0466962_0054102 Ga0466962_0054102_836_1657 273
131 iso_pu_bacteria 2643221572 2643874544 273
132 iso_pu_bacteria 2643221669 2644381600 273
133 iso_pu_bacteria 2773857759 2774383570 273
134 iso_pu_bacteria 2895660088 2895663440 273
135 3300049571 Ga0501034_0295299 Ga0501034_0295299_406_1233 274
136 3300049823 Ga0501044_0133249 Ga0501044_0133249_740_1567 274
137 iso_pu_bacteria 2844841374 2844841465 274
138 iso_pu_bacteria 2844852863 2844856499 274
139 iso_pu_bacteria 2966921586 2966921931 274
140 iso_pu_bacteria 8056037122 8056037369 274
141 3300031911 Ga0307412_10466100 Ga0307412_104661001 275
142 3300032002 Ga0307416_100863107 Ga0307416_1008631071 275
143 iso_pu_bacteria 2643221619 2644111659 275
144 iso_pu_bacteria 2808606372 2808902966 275
145 3300005548 Ga0070665_100307026 Ga0070665_1003070262 276
146 3300006038 Ga0075365_10018611 Ga0075365_100186113 276
147 3300044735 Ga0466968_0048765 Ga0466968_0048765_945_1787 276
148 3300048091 Ga0495626_0042291 Ga0495626_0042291_1057_1899 276
149 3300048920 Ga0496117_0003899 Ga0496117_0003899_8116_9039 276
150 3300048921 Ga0496118_0164476 Ga0496118_0164476_20_865 276
151 3300048922 Ga0496119_0004797 Ga0496119_0004797_4923_5822 276
152 3300048925 Ga0496122_0001685 Ga0496122_0001685_8913_9782 276
153 3300048926 Ga0496123_0000802 Ga0496123_0000802_24631_25500 276
154 3300048927 Ga0496124_0012436 Ga0496124_0012436_2762_3631 276
155 3300048928 Ga0496125_0055918 Ga0496125_0055918_1049_1918 276
156 3300048929 Ga0496126_0115298 Ga0496126_0115298_530_1399 276
157 3300053140 Ga0500573_0028483 Ga0500573_0028483_2272_3117 276
158 3300053140 Ga0500573_0070209 Ga0500573_0070209_130_990 276
159 iso_pu_bacteria 2585428094 2587863796 276
160 iso_pu_bacteria 2643221649 2644277642 276
161 3300005327 Ga0070658_10006173 Ga0070658_100061733 277
162 3300031995 Ga0307409_100093544 Ga0307409_1000935442 277
163 3300048922 Ga0496119_0021431 Ga0496119_0021431_3754_4635 277
164 3300053140 Ga0500573_0007302 Ga0500573_0007302_2897_3742 277
165 3300053153 Ga0500616_0016433 Ga0500616_0016433_84_944 277
166 3300001979 JGI24740J21852_10023313 JGI24740J21852_100233131 278
167 3300003752 Ga0055539_1000027 Ga0055539_1000027236 278
168 3300003756 Ga0055533_1000020 Ga0055533_1000020236 278
169 3300003759 Ga0055525_1000605 Ga0055525_10006054 278
170 3300003759 Ga0055525_1002425 Ga0055525_10024252 278
171 3300003760 Ga0055527_1000003 Ga0055527_10000034 278
172 3300003762 Ga0055542_1000066 Ga0055542_1000066134 278
173 3300003763 Ga0055529_1000006 Ga0055529_10000064 278
174 3300003841 Ga0055541_1002587 Ga0055541_10025872 278
175 3300005288 Ga0065714_10011347 Ga0065714_100113473 278
176 3300005288 Ga0065714_10067905 Ga0065714_100679053 278
177 3300005327 Ga0070658_10159699 Ga0070658_101596992 278
178 3300005844 Ga0068862_100222306 Ga0068862_1002223062 278
179 3300009148 Ga0105243_10040367 Ga0105243_100403673 278
180 3300013105 Ga0157369_10002805 Ga0157369_100028054 278
181 3300014326 Ga0157380_10015545 Ga0157380_100155455 278
182 3300020069 Ga0197907_11200671 Ga0197907_112006712 278
183 3300020080 Ga0206350_10648578 Ga0206350_106485781 278
184 3300025225 Ga0209566_100043 Ga0209566_100043147 278
185 3300025226 Ga0209674_100001 Ga0209674_1000013663 278
186 3300025228 Ga0209672_100003 Ga0209672_100003843 278
187 3300025229 Ga0209147_100287 Ga0209147_10028737 278
188 3300025230 Ga0209563_100001 Ga0209563_1000013663 278
189 3300025230 Ga0209563_103601 Ga0209563_1036013 278
190 3300025242 Ga0209258_103217 Ga0209258_1032173 278
191 3300025253 Ga0209677_100001 Ga0209677_1000013663 278
192 3300025254 Ga0209148_1000004 Ga0209148_10000041138 278
193 3300025261 Ga0209233_1022821 Ga0209233_10228212 278
194 3300025272 Ga0209455_1000046 Ga0209455_1000046157 278
195 3300025935 Ga0207709_10025449 Ga0207709_100254492 278
196 3300026118 Ga0207675_100036502 Ga0207675_1000365024 278
197 3300026121 Ga0207683_10294337 Ga0207683_102943372 278
198 3300028380 Ga0268265_10216784 Ga0268265_102167842 278
199 3300031911 Ga0307412_10598996 Ga0307412_105989961 278
200 3300037312 Ga0395899_0017170 Ga0395899_0017170_2486_3322 278
201 3300037418 Ga0395900_0041436 Ga0395900_0041436_2486_3322 278
202 3300037418 Ga0395900_0150558 Ga0395900_0150558_62_898 278
203 3300037418 Ga0395900_0217426 Ga0395900_0217426_36_872 278
204 3300041462 Ga0451806_802248 Ga0451806_802248_367_1215 278
205 3300044683 Ga0466965_0044763 Ga0466965_0044763_618_1454 278
206 3300044683 Ga0466965_0096840 Ga0466965_0096840_625_1461 278
207 3300044684 Ga0466966_0197519 Ga0466966_0197519_35_883 278
208 3300044684 Ga0466966_0286383 Ga0466966_0286383_71_907 278
209 3300044765 Ga0466970_0010160 Ga0466970_0010160_843_1679 278
210 3300044765 Ga0466970_0049982 Ga0466970_0049982_427_1263 278
211 3300045049 Ga0466959_0028315 Ga0466959_0028315_366_1202 278
212 3300048903 Ga0496100_0045554 Ga0496100_0045554_841_1680 278
213 3300048903 Ga0496100_0460935 Ga0496100_0460935_63_911 278
214 3300048905 Ga0496102_0117381 Ga0496102_0117381_1592_2431 278
215 3300048906 Ga0496103_0185141 Ga0496103_0185141_83_922 278
216 3300048907 Ga0496104_0033841 Ga0496104_0033841_2154_2993 278
217 3300048908 Ga0496105_0233206 Ga0496105_0233206_20_868 278
218 3300048917 Ga0496114_0078580 Ga0496114_0078580_1182_2021 278
219 3300048918 Ga0496115_0051938 Ga0496115_0051938_67_915 278
220 3300048918 Ga0496115_0320358 Ga0496115_0320358_188_1036 278
221 3300048919 Ga0496116_0103430 Ga0496116_0103430_171_1007 278
222 3300048920 Ga0496117_0029834 Ga0496117_0029834_2857_3693 278
223 3300048921 Ga0496118_0010728 Ga0496118_0010728_3486_4322 278
224 3300048929 Ga0496126_0027217 Ga0496126_0027217_927_1766 278
225 3300048929 Ga0496126_0064486 Ga0496126_0064486_2224_3063 278
226 3300049568 Ga0501031_0005740 Ga0501031_0005740_130_975 278
227 3300049569 Ga0501032_0001797 Ga0501032_0001797_14388_15233 278
228 3300049570 Ga0501033_0017462 Ga0501033_0017462_1570_2415 278
229 3300049570 Ga0501033_0040394 Ga0501033_0040394_1171_2007 278
230 3300049571 Ga0501034_0014897 Ga0501034_0014897_5745_6581 278
231 3300049571 Ga0501034_0020535 Ga0501034_0020535_5592_6437 278
232 3300049572 Ga0501036_0020525 Ga0501036_0020525_1698_2543 278
233 3300049573 Ga0501037_0003716 Ga0501037_0003716_3232_4077 278
234 3300049574 Ga0501038_0088714 Ga0501038_0088714_181_1026 278
235 3300049575 Ga0501039_0002824 Ga0501039_0002824_5664_6509 278
236 3300049579 Ga0501043_0003423 Ga0501043_0003423_10489_11334 278
237 3300049580 Ga0501046_0003656 Ga0501046_0003656_3887_4732 278
238 3300049580 Ga0501046_0036416 Ga0501046_0036416_1736_2572 278
239 3300049581 Ga0501047_0008940 Ga0501047_0008940_1905_2750 278
240 3300049581 Ga0501047_0108810 Ga0501047_0108810_1086_1922 278
241 3300049582 Ga0501048_0014933 Ga0501048_0014933_2904_3749 278
242 3300049584 Ga0501068_0002949 Ga0501068_0002949_1401_2246 278
243 3300049586 Ga0501070_0000050 Ga0501070_0000050_9352_10188 278
244 3300049586 Ga0501070_0183843 Ga0501070_0183843_308_1153 278
245 3300049586 Ga0501070_0407440 Ga0501070_0407440_249_1085 278
246 3300049742 Ga0501080_0067594 Ga0501080_0067594_2308_3153 278
247 3300049822 Ga0501035_0018172 Ga0501035_0018172_156_992 278
248 3300049822 Ga0501035_0035797 Ga0501035_0035797_3350_4195 278
249 3300049822 Ga0501035_0140382 Ga0501035_0140382_1197_2033 278
250 3300049823 Ga0501044_0049901 Ga0501044_0049901_1698_2543 278
251 3300049823 Ga0501044_0341070 Ga0501044_0341070_39_875 278
252 3300049824 Ga0501045_0033949 Ga0501045_0033949_1010_1855 278
253 3300053146 Ga0500588_0047734 Ga0500588_0047734_338_1177 278
254 3300053153 Ga0500616_0000109 Ga0500616_0000109_54188_55024 278
255 3300053730 Ga0500645_035531 Ga0500645_035531_25_861 278
256 3300060353 Ga0501082_0185537 Ga0501082_0185537_698_1543 278
257 iso_pu_bacteria 2751185788 2753302652 278
258 iso_pu_bacteria 8046352972 8046355693 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

57

311

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lpm-assembly1.cif.gz_A crystal structure of ap endonuclease from deinococcus radioduran 0.9452 4 278
6lpm-assembly1.cif.gz_A crystal structure of ap endonuclease from deinococcus radioduran 0.9379 4 278
4b5m-assembly2.cif.gz_B neisseria ap endonuclease bound to the substrate with a cytosine orphan base 0.9328 6 276
3w2y-assembly2.cif.gz_D crystal structure of dna uridine endonuclease mth212 mutant w205s 0.9326 4 278
4b5h-assembly1.cif.gz_A substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions 0.9317 6 276
ID Description Score Start End Superfamily
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9323 6 276 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9251 4 278 3.60.10.10
5cfeA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9226 6 278 3.60.10.10
5cfeA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9191 6 278 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9182 4 278 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A6H3KAI3-F1-model_v4 deleted 0.9955 5 278
AF-A0A6H3KAI3-F1-model_v4 deleted 0.9777 5 278
AF-A0A349CZS5-F1-model_v4 Exodeoxyribonuclease III 0.9735 6 194 GO:0006281
GO:0008311
GO:0046872
AF-A0A7X7J9X9-F1-model_v4 Exodeoxyribonuclease III 0.9728 119 278 GO:0006281
GO:0008311
GO:0046872
AF-A0A5N7UZH7-F1-model_v4 deleted 0.9708 6 156

Feature Viewer

pLDDT pTM Quality
95.25 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map