F368307

General Info

Members Datasets Scaffolds Average Seq Length
258 110 248 284

Family's Representative Sequence

Representative Sequence 3300046458|Ga0495591_000402|Ga0495591_000402_16315_17247
Length 310
Sequence VEYELAVHIMSELKVHARPCDIEPMVQIEEIRAAFASRLKKSLAEKGIDQWGAGARLAEMTKVTPKAASKWLNGESIPGPAKMQAIAENLGVKIEWLQHGSGDGPGMLVDQPVVGDSLTAADKIREMLAGKKLGDDRLQKLLSVAEGTDQDDTIEVLVNDAYKPGIGKVGDEVWIAHYDVRGALGGGEVAHDFPEMLQDVRVSPSQLRSMGVEFKEHYHLKVITGWGQSMTPTIKHGDPCLVDISIKEFIGDGIYYFSYQGFQYIKRLQMKGKDKFKMISDNRKHKAEDIFIDETYIQARVLFVWNGNLV

Samples

Sample ID Description Type Environment
1 2511231011 Pseudomonas sp. GM30 Isolate Nodule
2 2511231015 Pseudomonas sp. GM49 Isolate Nodule
3 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
4 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
5 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
6 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
7 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
8 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
9 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
10 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
14 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
23 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
24 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
25 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
29 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
30 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
31 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
37 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
38 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
39 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
40 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
41 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
42 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
43 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
44 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
45 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
46 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
47 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
48 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
49 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
50 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
51 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
52 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
53 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
54 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
55 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
56 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
57 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
58 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
59 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
60 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
61 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
62 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
63 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
64 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
67 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
68 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
69 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
70 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
71 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
72 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
73 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
74 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
75 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
79 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
80 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
81 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
82 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
85 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
94 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
95 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
109 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
110 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 0
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 1.94
Rhizoplane 2.71
Rhizosphere 89.92
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10067198 3300005288 Bacteria 5772
2 Ga0075364_10097345 3300006051 Bacteria 1957
3 Ga0075432_10000228 3300006058 Bacteria 14986
4 Ga0075432_10000321 3300006058 Bacteria 13559
5 Ga0075432_10000731 3300006058 Bacteria 10152
6 Ga0099823_1000067 3300006944 Bacteria 49708
7 Ga0105251_10001391 3300009011 Bacteria 20919
8 Ga0105251_10006359 3300009011 Bacteria 7543
9 Ga0105244_10003648 3300009036 Bacteria 10901
10 Ga0105244_10010764 3300009036 Bacteria 5527
11 Ga0105244_10032867 3300009036 Bacteria 2742
12 Ga0157373_10002734 3300013100 Bacteria 13360
13 Ga0157371_10000333 3300013102 Bacteria 60809
14 Ga0157371_10000334 3300013102 Bacteria 60797
15 Ga0157371_10002221 3300013102 Bacteria 18780
16 Ga0157370_10025510 3300013104 Bacteria 5852
17 Ga0157370_10050823 3300013104 Bacteria 3961
18 Ga0157370_10090570 3300013104 Bacteria 2872
19 Ga0157370_10098348 3300013104 Bacteria 2744
20 Ga0157369_10002428 3300013105 Bacteria 22391
21 Ga0157369_10003082 3300013105 Bacteria 19917
22 Ga0157369_10033108 3300013105 Bacteria 5681
23 Ga0182008_10002637 3300014497 Bacteria 11130
24 Ga0182008_10010126 3300014497 Bacteria 5055
25 Ga0182008_10023883 3300014497 Bacteria 3117
26 Ga0182008_10038361 3300014497 Bacteria 2395
27 Ga0182006_1001178 3300015261 Bacteria 16423
28 Ga0182006_1001903 3300015261 Bacteria 11904
29 Ga0182006_1002716 3300015261 Bacteria 9492
30 Ga0182007_10001931 3300015262 Bacteria 10725
31 Ga0182007_10026547 3300015262 Bacteria 2006
32 Ga0182005_1000396 3300015265 Bacteria 23771
33 Ga0182005_1000448 3300015265 Bacteria 21912
34 Ga0182005_1001292 3300015265 Bacteria 10288
35 Ga0182005_1004163 3300015265 Bacteria 4729
36 Ga0207696_1000045 3300025711 Bacteria 296484
37 Ga0207655_1000094 3300025728 Bacteria 196748
38 Ga0207713_1004785 3300025735 Bacteria 8699
39 Ga0207713_1011186 3300025735 Bacteria 4905
40 Ga0209281_1000015 3300027111 Bacteria 590084
41 Ga0209389_1000038 3300027296 Bacteria 125072
42 Ga0207428_10001451 3300027907 Bacteria 24809
43 Ga0207428_10006930 3300027907 Bacteria 10388
44 Ga0307511_10152327 3300030521 Bacteria 1323
45 Ga0307408_100003303 3300031548 Bacteria 11089
46 Ga0307405_10019535 3300031731 Bacteria 3766
47 Ga0307413_10040960 3300031824 Bacteria 2708
48 Ga0307412_10000173 3300031911 Bacteria 45901
49 Ga0307412_10000976 3300031911 Bacteria 16351
50 Ga0307412_10022591 3300031911 Bacteria 3858
51 Ga0439438_000107 3300041405 Bacteria 38582
52 Ga0439466_0012129 3300041411 Bacteria 3181
53 Ga0439466_0071687 3300041411 Bacteria 1102
54 Ga0439452_000241 3300042010 Bacteria 37760
55 Ga0439452_002875 3300042010 Bacteria 6187
56 Ga0450920_001911 3300042122 Bacteria 3499
57 Ga0450905_000001 3300042142 Bacteria 51289
58 Ga0450907_000217 3300042146 Bacteria 20404
59 Ga0450910_000050 3300042147 Bacteria 12267
60 Ga0450908_000026 3300042184 Bacteria 34631
61 Ga0495627_000369 3300046453 Bacteria 41831
62 Ga0495592_0000277 3300046454 Bacteria 43977
63 Ga0495590_0000048 3300046457 Bacteria 116368
64 Ga0495591_000298 3300046458 Bacteria 45382
65 Ga0495591_000402 3300046458 Bacteria 36129
66 Ga0495591_000522 3300046458 Bacteria 30008
67 Ga0495638_0001371 3300046460 Bacteria 22322
68 Ga0495638_0001415 3300046460 Bacteria 21799
69 Ga0495638_0009502 3300046460 Bacteria 6820
70 Ga0495638_0033334 3300046460 Bacteria 3294
71 Ga0495653_0000245 3300046463 Bacteria 43673
72 Ga0495650_0000923 3300046471 Bacteria 34487
73 Ga0495650_0001902 3300046471 Bacteria 18512
74 Ga0495650_0036666 3300046471 Bacteria 2143
75 Ga0495650_0038902 3300046471 Bacteria 2056
76 Ga0495605_0001170 3300046474 Bacteria 17419
77 Ga0495605_0004084 3300046474 Bacteria 8614
78 Ga0495605_0005049 3300046474 Bacteria 7711
79 Ga0495605_0043407 3300046474 Bacteria 2229
80 Ga0495584_0000099 3300046491 Bacteria 57784
81 Ga0495584_0001321 3300046491 Bacteria 15063
82 Ga0495584_0007162 3300046491 Bacteria 5826
83 Ga0495584_0038370 3300046491 Bacteria 2421
84 Ga0495585_0000182 3300046492 Bacteria 66842
85 Ga0495585_0003768 3300046492 Bacteria 10119
86 Ga0495585_0039394 3300046492 Bacteria 2656
87 Ga0495596_0000122 3300046500 Bacteria 53601
88 Ga0495596_0000349 3300046500 Bacteria 29914
89 Ga0495607_0000326 3300046501 Bacteria 49364
90 Ga0495607_0000404 3300046501 Bacteria 43821
91 Ga0495607_0003351 3300046501 Bacteria 12287
92 Ga0495607_0004282 3300046501 Bacteria 10549
93 Ga0495607_0011878 3300046501 Bacteria 5769
94 Ga0495583_0000371 3300046506 Bacteria 69919
95 Ga0495583_0005178 3300046506 Bacteria 8979
96 Ga0495606_0000796 3300046507 Bacteria 48127
97 Ga0495606_0000910 3300046507 Bacteria 43886
98 Ga0495606_0004128 3300046507 Bacteria 14749
99 Ga0495610_0000383 3300046512 Bacteria 45677
100 Ga0495610_0000516 3300046512 Bacteria 38838
101 Ga0495610_0000630 3300046512 Bacteria 34615
102 Ga0495616_0007271 3300046513 Bacteria 6629
103 Ga0495616_0016418 3300046513 Bacteria 4098
104 Ga0495620_0000138 3300046515 Bacteria 59518
105 Ga0495620_0001461 3300046515 Bacteria 14145
106 Ga0495630_0007919 3300046517 Bacteria 7620
107 Ga0495631_0000140 3300046518 Bacteria 49175
108 Ga0495632_0000276 3300046519 Bacteria 50343
109 Ga0495632_0000611 3300046519 Bacteria 32999
110 Ga0495632_0001370 3300046519 Bacteria 20470
111 Ga0495632_0002581 3300046519 Bacteria 13671
112 Ga0495632_0016894 3300046519 Bacteria 4044
113 Ga0495632_0022924 3300046519 Bacteria 3341
114 Ga0495632_0034531 3300046519 Bacteria 2587
115 Ga0495632_0041094 3300046519 Bacteria 2325
116 Ga0495637_0000030 3300046520 Bacteria 138704
117 Ga0495637_0000191 3300046520 Bacteria 47977
118 Ga0495637_0003646 3300046520 Bacteria 8155
119 Ga0495637_0006885 3300046520 Bacteria 5678
120 Ga0495637_0098105 3300046520 Bacteria 1148
121 Ga0495643_0018928 3300046522 Bacteria 3988
122 Ga0495643_0158547 3300046522 Bacteria 1115
123 Ga0495644_0000006 3300046523 Bacteria 113088
124 Ga0495644_0000022 3300046523 Bacteria 79714
125 Ga0495644_0001671 3300046523 Bacteria 9005
126 Ga0495644_0003688 3300046523 Bacteria 6028
127 Ga0495648_0011184 3300046524 Bacteria 6779
128 Ga0495648_0039031 3300046524 Bacteria 3027
129 Ga0495648_0140108 3300046524 Bacteria 1274
130 Ga0495666_0000041 3300046526 Bacteria 47296
131 Ga0495666_0004773 3300046526 Bacteria 6854
132 Ga0495642_0000042 3300046528 Bacteria 75891
133 Ga0495654_0000177 3300046530 Bacteria 62703
134 Ga0495654_0000275 3300046530 Bacteria 46540
135 Ga0495654_0000309 3300046530 Bacteria 42970
136 Ga0495654_0003281 3300046530 Bacteria 9979
137 Ga0495654_0008167 3300046530 Bacteria 5798
138 Ga0495654_0014304 3300046530 Bacteria 4225
139 Ga0495654_0018993 3300046530 Bacteria 3597
140 Ga0495654_0020956 3300046530 Bacteria 3404
141 Ga0495654_0092195 3300046530 Bacteria 1404
142 Ga0495609_0000011 3300046538 Bacteria 334377
143 Ga0495609_0000037 3300046538 Bacteria 185912
144 Ga0495609_0000043 3300046538 Bacteria 166590
145 Ga0495609_0000301 3300046538 Bacteria 45226
146 Ga0495597_0002121 3300046542 Bacteria 13126
147 Ga0495597_0007003 3300046542 Bacteria 5778
148 Ga0495597_0024267 3300046542 Bacteria 2800
149 Ga0495597_0067383 3300046542 Bacteria 1548
150 Ga0495597_0095930 3300046542 Bacteria 1254
151 Ga0495597_0119661 3300046542 Bacteria 1098
152 Ga0495656_0056489 3300046615 Bacteria 1696
153 Ga0495668_0000886 3300046616 Bacteria 33702
154 Ga0495668_0001599 3300046616 Bacteria 21230
155 Ga0495668_0004612 3300046616 Bacteria 9689
156 Ga0495611_0008498 3300046648 Bacteria 4342
157 Ga0495625_0001201 3300046660 Bacteria 32943
158 Ga0495625_0008956 3300046660 Bacteria 8452
159 Ga0495625_0045218 3300046660 Bacteria 3184
160 Ga0495635_0051144 3300046663 Bacteria 2848
161 Ga0495659_0000099 3300046664 Bacteria 38226
162 Ga0495661_0000024 3300046665 Bacteria 188844
163 Ga0495661_0019011 3300046665 Bacteria 4507
164 Ga0495661_0086574 3300046665 Bacteria 1793
165 Ga0495661_0125044 3300046665 Bacteria 1416
166 Ga0495669_0086122 3300046684 Bacteria 1446
167 Ga0495670_0013050 3300046691 Bacteria 4085
168 Ga0495670_0089829 3300046691 Bacteria 1572
169 Ga0495671_0000172 3300046692 Bacteria 57446
170 Ga0495671_0000205 3300046692 Bacteria 51902
171 Ga0495671_0000477 3300046692 Bacteria 31095
172 Ga0495671_0005676 3300046692 Bacteria 7279
173 Ga0495671_0020229 3300046692 Bacteria 3509
174 Ga0495671_0082076 3300046692 Bacteria 1579
175 Ga0495671_0095913 3300046692 Bacteria 1451
176 Ga0495649_0000140 3300046694 Bacteria 62872
177 Ga0495649_0000189 3300046694 Bacteria 54079
178 Ga0495649_0004048 3300046694 Bacteria 9652
179 Ga0495649_0011530 3300046694 Bacteria 5180
180 Ga0495649_0048718 3300046694 Bacteria 2303
181 Ga0495649_0104383 3300046694 Bacteria 1505
182 Ga0495589_0000374 3300046794 Bacteria 34286
183 Ga0495589_0000708 3300046794 Bacteria 21718
184 Ga0495589_0009780 3300046794 Bacteria 4979
185 Ga0495589_0015137 3300046794 Bacteria 3972
186 Ga0495660_0000185 3300046810 Bacteria 67242
187 Ga0495660_0000241 3300046810 Bacteria 53414
188 Ga0495660_0000398 3300046810 Bacteria 37497
189 Ga0495660_0000648 3300046810 Bacteria 27008
190 Ga0495660_0000778 3300046810 Bacteria 23878
191 Ga0495660_0001694 3300046810 Bacteria 14749
192 Ga0495660_0013255 3300046810 Bacteria 4775
193 Ga0495660_0016776 3300046810 Bacteria 4220
194 Ga0495660_0035873 3300046810 Bacteria 2768
195 Ga0495660_0064102 3300046810 Bacteria 1965
196 Ga0495604_0000657 3300047317 Bacteria 29371
197 Ga0495636_0009232 3300047318 Bacteria 3882
198 Ga0495672_0059804 3300047320 Bacteria 2203
199 Ga0495672_0111051 3300047320 Bacteria 1471
200 Ga0495676_0000141 3300047321 Bacteria 55004
201 Ga0495680_0000524 3300047322 Bacteria 43233
202 Ga0495680_0042310 3300047322 Bacteria 3616
203 Ga0495683_0000172 3300047323 Bacteria 63287
204 Ga0495683_0010926 3300047323 Bacteria 4788
205 Ga0495683_0024786 3300047323 Bacteria 3077
206 Ga0495683_0077240 3300047323 Bacteria 1628
207 Ga0495675_0070075 3300047444 Bacteria 2213
208 Ga0495679_000249 3300047446 Bacteria 44622
209 Ga0495679_006646 3300047446 Bacteria 4946
210 Ga0495679_008331 3300047446 Bacteria 4225
211 Ga0495673_0000276 3300047469 Bacteria 69967
212 Ga0495673_0001208 3300047469 Bacteria 21516
213 Ga0495673_0001513 3300047469 Bacteria 18324
214 Ga0495673_0013391 3300047469 Bacteria 4310
215 Ga0495673_0021247 3300047469 Bacteria 3211
216 Ga0495681_0000142 3300047470 Bacteria 60399
217 Ga0495681_0000233 3300047470 Bacteria 46046
218 Ga0495681_0002255 3300047470 Bacteria 13860
219 Ga0495681_0005674 3300047470 Bacteria 8313
220 Ga0495681_0006872 3300047470 Bacteria 7388
221 Ga0495681_0008302 3300047470 Bacteria 6523
222 Ga0495681_0015748 3300047470 Bacteria 4269
223 Ga0495681_0037912 3300047470 Bacteria 2368
224 Ga0495684_0022251 3300047471 Bacteria 4881
225 Ga0495626_0000238 3300048091 Bacteria 63755
226 Ga0495626_0000297 3300048091 Bacteria 53415
227 Ga0495626_0059162 3300048091 Bacteria 1749
228 Ga0495626_0070127 3300048091 Bacteria 1577
229 Ga0496111_0275977 3300048914 Bacteria 1247
230 Ga0496113_0257138 3300048916 Bacteria 1395
231 Ga0496115_0087191 3300048918 Bacteria 2547
232 Ga0496116_0000207 3300048919 Bacteria 111531
233 Ga0496117_0260985 3300048920 Bacteria 939
234 Ga0496119_0061006 3300048922 Bacteria 2255
235 Ga0496121_0002034 3300048924 Bacteria 32019
236 Ga0496122_0055966 3300048925 Bacteria 2946
237 Ga0496123_0060416 3300048926 Bacteria 2444
238 Ga0496124_0000421 3300048927 Bacteria 75739
239 Ga0496124_0001227 3300048927 Bacteria 39540
240 Ga0495678_000407 3300049459 Bacteria 43484
241 Ga0495678_001450 3300049459 Bacteria 18662
242 Ga0495678_002118 3300049459 Bacteria 14094
243 Ga0495678_007315 3300049459 Bacteria 5740
244 Ga0495678_054232 3300049459 Bacteria 1535
245 Ga0495682_0000123 3300049460 Bacteria 67837
246 Ga0495682_0013248 3300049460 Bacteria 3143
247 Ga0495682_0047852 3300049460 Bacteria 1559
248 Ga0500659_0001313 3300053135 Bacteria 15897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015265 Ga0182005_1004163 Ga0182005_10041631 239
2 3300046520 Ga0495637_0006885 Ga0495637_0006885_2466_3329 242
3 iso_pu_bacteria 3007803356 3007804112 244
4 3300031824 Ga0307413_10040960 Ga0307413_100409603 247
5 3300031911 Ga0307412_10022591 Ga0307412_100225913 247
6 3300046460 Ga0495638_0009502 Ga0495638_0009502_5137_5940 247
7 3300006944 Ga0099823_1000067 Ga0099823_100006739 248
8 3300027296 Ga0209389_1000038 Ga0209389_100003839 248
9 3300046458 Ga0495591_000522 Ga0495591_000522_5033_5896 248
10 3300047469 Ga0495673_0000276 Ga0495673_0000276_52968_53831 248
11 3300047470 Ga0495681_0037912 Ga0495681_0037912_1413_2276 248
12 3300048091 Ga0495626_0000238 Ga0495626_0000238_16644_17507 248
13 3300053135 Ga0500659_0001313 Ga0500659_0001313_9507_10337 248
14 3300046500 Ga0495596_0000122 Ga0495596_0000122_25740_26582 249
15 3300046530 Ga0495654_0000177 Ga0495654_0000177_17111_17953 249
16 3300046616 Ga0495668_0000886 Ga0495668_0000886_8184_9026 249
17 3300049460 Ga0495682_0000123 Ga0495682_0000123_43073_43957 250
18 3300013102 Ga0157371_10000334 Ga0157371_1000033422 251
19 3300014497 Ga0182008_10038361 Ga0182008_100383614 251
20 3300046491 Ga0495584_0001321 Ga0495584_0001321_5538_6350 251
21 3300046530 Ga0495654_0000275 Ga0495654_0000275_16013_16825 251
22 3300046616 Ga0495668_0004612 Ga0495668_0004612_4792_5613 251
23 iso_pu_bacteria 2842843487 2842848709 251
24 3300046530 Ga0495654_0092195 Ga0495654_0092195_25_876 252
25 3300013102 Ga0157371_10000333 Ga0157371_1000033326 253
26 3300046501 Ga0495607_0003351 Ga0495607_0003351_8882_9739 254
27 3300046512 Ga0495610_0000383 Ga0495610_0000383_9909_10766 254
28 3300046520 Ga0495637_0000030 Ga0495637_0000030_20033_20890 254
29 3300046530 Ga0495654_0008167 Ga0495654_0008167_2512_3369 254
30 3300046692 Ga0495671_0000205 Ga0495671_0000205_48616_49473 254
31 iso_pu_bacteria 2599185155 2599328836 254
32 3300046507 Ga0495606_0000796 Ga0495606_0000796_33704_34570 255
33 3300046542 Ga0495597_0024267 Ga0495597_0024267_1859_2692 255
34 3300009011 Ga0105251_10001391 Ga0105251_100013914 256
35 3300009036 Ga0105244_10032867 Ga0105244_100328673 256
36 3300013104 Ga0157370_10090570 Ga0157370_100905703 256
37 3300013105 Ga0157369_10002428 Ga0157369_1000242816 256
38 3300015261 Ga0182006_1001178 Ga0182006_100117833 256
39 3300015261 Ga0182006_1002716 Ga0182006_10027161 256
40 3300025728 Ga0207655_1000094 Ga0207655_1000094190 256
41 3300025735 Ga0207713_1004785 Ga0207713_10047857 256
42 3300041411 Ga0439466_0071687 Ga0439466_0071687_71_907 256
43 3300042010 Ga0439452_000241 Ga0439452_000241_35344_36198 256
44 3300042010 Ga0439452_002875 Ga0439452_002875_4496_5350 256
45 3300042142 Ga0450905_000001 Ga0450905_000001_15296_16150 256
46 3300046458 Ga0495591_000298 Ga0495591_000298_33717_34565 256
47 3300046501 Ga0495607_0004282 Ga0495607_0004282_9452_10306 256
48 3300048920 Ga0496117_0260985 Ga0496117_0260985_61_915 256
49 3300046492 Ga0495585_0003768 Ga0495585_0003768_2650_3513 257
50 3300046501 Ga0495607_0000326 Ga0495607_0000326_36670_37530 257
51 3300046513 Ga0495616_0007271 Ga0495616_0007271_5028_5888 257
52 3300046515 Ga0495620_0000138 Ga0495620_0000138_16633_17487 257
53 3300046519 Ga0495632_0001370 Ga0495632_0001370_17783_18643 257
54 3300046519 Ga0495632_0002581 Ga0495632_0002581_632_1492 257
55 3300046520 Ga0495637_0000191 Ga0495637_0000191_2830_3684 257
56 3300046530 Ga0495654_0018993 Ga0495654_0018993_759_1613 257
57 3300046538 Ga0495609_0000043 Ga0495609_0000043_21604_22464 257
58 3300046694 Ga0495649_0004048 Ga0495649_0004048_7067_7927 257
59 3300046694 Ga0495649_0048718 Ga0495649_0048718_1392_2246 257
60 3300047321 Ga0495676_0000141 Ga0495676_0000141_22519_23379 257
61 3300047446 Ga0495679_006646 Ga0495679_006646_1544_2407 257
62 3300047446 Ga0495679_008331 Ga0495679_008331_2151_3005 257
63 3300047470 Ga0495681_0006872 Ga0495681_0006872_147_1001 257
64 3300047470 Ga0495681_0008302 Ga0495681_0008302_4853_5716 257
65 3300046474 Ga0495605_0004084 Ga0495605_0004084_266_1132 258
66 3300046538 Ga0495609_0000011 Ga0495609_0000011_118145_119011 258
67 3300046692 Ga0495671_0000477 Ga0495671_0000477_1114_1968 259
68 3300047469 Ga0495673_0021247 Ga0495673_0021247_27_887 259
69 3300013100 Ga0157373_10002734 Ga0157373_1000273419 260
70 3300046794 Ga0495589_0000374 Ga0495589_0000374_20117_20977 260
71 iso_pu_bacteria 2600255283 2601624673 260
72 3300006058 Ga0075432_10000731 Ga0075432_1000073116 261
73 3300009011 Ga0105251_10006359 Ga0105251_100063594 261
74 3300025735 Ga0207713_1011186 Ga0207713_10111866 261
75 3300027907 Ga0207428_10006930 Ga0207428_1000693016 261
76 3300046524 Ga0495648_0140108 Ga0495648_0140108_157_1011 261
77 3300046616 Ga0495668_0001599 Ga0495668_0001599_18859_19713 261
78 3300047470 Ga0495681_0000142 Ga0495681_0000142_16755_17609 261
79 3300049460 Ga0495682_0013248 Ga0495682_0013248_671_1525 261
80 3300015262 Ga0182007_10026547 Ga0182007_100265473 262
81 3300015265 Ga0182005_1000396 Ga0182005_100039624 262
82 3300015265 Ga0182005_1001292 Ga0182005_100129210 262
83 3300031731 Ga0307405_10019535 Ga0307405_100195355 262
84 3300046474 Ga0495605_0001170 Ga0495605_0001170_7628_8485 262
85 3300046474 Ga0495605_0005049 Ga0495605_0005049_2256_3122 262
86 3300046506 Ga0495583_0000371 Ga0495583_0000371_51961_52845 262
87 3300046507 Ga0495606_0000910 Ga0495606_0000910_32622_33479 262
88 3300046515 Ga0495620_0001461 Ga0495620_0001461_12791_13675 262
89 3300046518 Ga0495631_0000140 Ga0495631_0000140_16421_17305 262
90 3300046519 Ga0495632_0022924 Ga0495632_0022924_1279_2163 262
91 3300046523 Ga0495644_0001671 Ga0495644_0001671_3867_4751 262
92 3300046526 Ga0495666_0000041 Ga0495666_0000041_36645_37508 262
93 3300046530 Ga0495654_0014304 Ga0495654_0014304_725_1591 262
94 3300046542 Ga0495597_0067383 Ga0495597_0067383_646_1512 262
95 3300046694 Ga0495649_0104383 Ga0495649_0104383_115_981 262
96 3300046794 Ga0495589_0000708 Ga0495589_0000708_2582_3445 262
97 3300046810 Ga0495660_0000778 Ga0495660_0000778_953_1837 262
98 3300046810 Ga0495660_0001694 Ga0495660_0001694_13277_14143 262
99 3300047322 Ga0495680_0000524 Ga0495680_0000524_32623_33486 262
100 3300047323 Ga0495683_0010926 Ga0495683_0010926_1468_2337 262
101 3300047469 Ga0495673_0001513 Ga0495673_0001513_1246_2130 262
102 3300047470 Ga0495681_0005674 Ga0495681_0005674_1250_2113 262
103 3300048091 Ga0495626_0000297 Ga0495626_0000297_13636_14502 262
104 3300048927 Ga0496124_0001227 Ga0496124_0001227_11124_11987 262
105 3300049459 Ga0495678_000407 Ga0495678_000407_2814_3698 262
106 3300006058 Ga0075432_10000321 Ga0075432_100003214 263
107 3300030521 Ga0307511_10152327 Ga0307511_101523271 263
108 3300046457 Ga0495590_0000048 Ga0495590_0000048_9652_10506 263
109 3300046463 Ga0495653_0000245 Ga0495653_0000245_16684_17532 263
110 3300046471 Ga0495650_0038902 Ga0495650_0038902_1183_2031 263
111 3300046501 Ga0495607_0011878 Ga0495607_0011878_1730_2578 263
112 3300046519 Ga0495632_0000276 Ga0495632_0000276_28224_29111 263
113 3300046520 Ga0495637_0098105 Ga0495637_0098105_44_892 263
114 3300046542 Ga0495597_0002121 Ga0495597_0002121_2846_3694 263
115 3300046542 Ga0495597_0095930 Ga0495597_0095930_12_860 263
116 3300046665 Ga0495661_0086574 Ga0495661_0086574_826_1674 263
117 3300046691 Ga0495670_0089829 Ga0495670_0089829_53_901 263
118 3300046694 Ga0495649_0000189 Ga0495649_0000189_16230_17078 263
119 3300046810 Ga0495660_0000398 Ga0495660_0000398_1190_2077 263
120 3300046810 Ga0495660_0016776 Ga0495660_0016776_1826_2674 263
121 3300046810 Ga0495660_0064102 Ga0495660_0064102_221_1069 263
122 3300047323 Ga0495683_0000172 Ga0495683_0000172_19144_19992 263
123 3300047323 Ga0495683_0077240 Ga0495683_0077240_327_1175 263
124 3300047470 Ga0495681_0002255 Ga0495681_0002255_8585_9433 263
125 3300049459 Ga0495678_007315 Ga0495678_007315_4659_5507 263
126 3300025711 Ga0207696_1000045 Ga0207696_100004556 267
127 3300046501 Ga0495607_0000404 Ga0495607_0000404_5423_6322 267
128 iso_pu_bacteria 3007866637 3007869561 267
129 3300013102 Ga0157371_10002221 Ga0157371_1000222113 268
130 3300046458 Ga0495591_000402 Ga0495591_000402_16315_17247 268
131 3300046520 Ga0495637_0003646 Ga0495637_0003646_963_1865 268
132 3300048914 Ga0496111_0275977 Ga0496111_0275977_124_1056 268
133 3300048927 Ga0496124_0000421 Ga0496124_0000421_17848_18780 268
134 iso_pu_bacteria 2511231011 2511296087 268
135 iso_pu_bacteria 2599185307 2599971392 268
136 3300009036 Ga0105244_10010764 Ga0105244_100107649 270
137 3300046460 Ga0495638_0001371 Ga0495638_0001371_10232_11098 270
138 3300046471 Ga0495650_0036666 Ga0495650_0036666_799_1665 270
139 3300046694 Ga0495649_0000140 Ga0495649_0000140_41564_42472 270
140 3300046810 Ga0495660_0000185 Ga0495660_0000185_43384_44292 270
141 3300049459 Ga0495678_001450 Ga0495678_001450_10389_11255 270
142 iso_pu_bacteria 2511231015 2511318450 270
143 iso_pu_bacteria 2599185318 2600037413 270
144 iso_pu_bacteria 2791355520 2794597476 270
145 3300006051 Ga0075364_10097345 Ga0075364_100973453 271
146 3300014497 Ga0182008_10010126 Ga0182008_100101262 271
147 3300015265 Ga0182005_1000448 Ga0182005_100044835 271
148 3300046500 Ga0495596_0000349 Ga0495596_0000349_14424_15335 271
149 3300046519 Ga0495632_0041094 Ga0495632_0041094_619_1530 271
150 3300046523 Ga0495644_0000022 Ga0495644_0000022_65275_66186 271
151 3300046542 Ga0495597_0007003 Ga0495597_0007003_1695_2606 271
152 3300046665 Ga0495661_0019011 Ga0495661_0019011_2964_3875 271
153 3300046692 Ga0495671_0095913 Ga0495671_0095913_315_1226 271
154 3300046810 Ga0495660_0035873 Ga0495660_0035873_1470_2381 271
155 3300047320 Ga0495672_0059804 Ga0495672_0059804_1097_2008 271
156 3300048091 Ga0495626_0059162 Ga0495626_0059162_434_1345 271
157 3300049459 Ga0495678_002118 Ga0495678_002118_1929_2840 271
158 3300013104 Ga0157370_10025510 Ga0157370_100255104 272
159 3300013104 Ga0157370_10050823 Ga0157370_100508236 272
160 3300013105 Ga0157369_10003082 Ga0157369_1000308233 272
161 3300013105 Ga0157369_10033108 Ga0157369_100331086 272
162 3300014497 Ga0182008_10002637 Ga0182008_1000263717 272
163 3300031911 Ga0307412_10000976 Ga0307412_1000097615 272
164 3300041405 Ga0439438_000107 Ga0439438_000107_14144_15010 272
165 3300041411 Ga0439466_0012129 Ga0439466_0012129_1054_1917 272
166 3300046453 Ga0495627_000369 Ga0495627_000369_31696_32562 272
167 3300046454 Ga0495592_0000277 Ga0495592_0000277_5679_6545 272
168 3300046491 Ga0495584_0038370 Ga0495584_0038370_902_1765 272
169 3300046492 Ga0495585_0000182 Ga0495585_0000182_39769_40635 272
170 3300046517 Ga0495630_0007919 Ga0495630_0007919_5090_5962 272
171 3300046519 Ga0495632_0034531 Ga0495632_0034531_150_1016 272
172 3300046523 Ga0495644_0000006 Ga0495644_0000006_10911_11774 272
173 3300046524 Ga0495648_0011184 Ga0495648_0011184_5180_6052 272
174 3300046526 Ga0495666_0004773 Ga0495666_0004773_3681_4553 272
175 3300046660 Ga0495625_0001201 Ga0495625_0001201_16736_17602 272
176 3300046663 Ga0495635_0051144 Ga0495635_0051144_1752_2624 272
177 3300046692 Ga0495671_0000172 Ga0495671_0000172_37812_38684 272
178 3300046794 Ga0495589_0009780 Ga0495589_0009780_2299_3165 272
179 3300046810 Ga0495660_0000648 Ga0495660_0000648_24094_24960 272
180 3300047317 Ga0495604_0000657 Ga0495604_0000657_10229_11095 272
181 3300047322 Ga0495680_0042310 Ga0495680_0042310_1104_1976 272
182 3300047444 Ga0495675_0070075 Ga0495675_0070075_29_901 272
183 3300047470 Ga0495681_0000233 Ga0495681_0000233_12206_13072 272
184 3300047471 Ga0495684_0022251 Ga0495684_0022251_1671_2543 272
185 3300048918 Ga0496115_0087191 Ga0496115_0087191_593_1465 272
186 3300048919 Ga0496116_0000207 Ga0496116_0000207_16514_17380 272
187 3300048922 Ga0496119_0061006 Ga0496119_0061006_294_1160 272
188 3300046471 Ga0495650_0001902 Ga0495650_0001902_1185_2063 273
189 3300046491 Ga0495584_0000099 Ga0495584_0000099_40421_41299 273
190 3300046507 Ga0495606_0004128 Ga0495606_0004128_266_1138 273
191 3300046512 Ga0495610_0000516 Ga0495610_0000516_28977_29849 273
192 3300046519 Ga0495632_0016894 Ga0495632_0016894_2017_2889 273
193 3300046522 Ga0495643_0158547 Ga0495643_0158547_112_984 273
194 3300046538 Ga0495609_0000037 Ga0495609_0000037_75523_76395 273
195 3300046648 Ga0495611_0008498 Ga0495611_0008498_1221_2093 273
196 3300046665 Ga0495661_0000024 Ga0495661_0000024_20872_21750 273
197 3300046692 Ga0495671_0005676 Ga0495671_0005676_1225_2097 273
198 3300046810 Ga0495660_0000241 Ga0495660_0000241_51372_52250 273
199 3300047446 Ga0495679_000249 Ga0495679_000249_35390_36268 273
200 3300047469 Ga0495673_0001208 Ga0495673_0001208_16656_17534 273
201 3300048916 Ga0496113_0257138 Ga0496113_0257138_395_1282 273
202 3300048924 Ga0496121_0002034 Ga0496121_0002034_19467_20354 273
203 3300048925 Ga0496122_0055966 Ga0496122_0055966_1239_2126 273
204 3300048926 Ga0496123_0060416 Ga0496123_0060416_583_1470 273
205 3300005288 Ga0065714_10067198 Ga0065714_100671985 274
206 3300006058 Ga0075432_10000228 Ga0075432_100002288 274
207 3300009036 Ga0105244_10003648 Ga0105244_1000364813 274
208 3300013104 Ga0157370_10098348 Ga0157370_100983482 274
209 3300014497 Ga0182008_10023883 Ga0182008_100238835 274
210 3300015261 Ga0182006_1001903 Ga0182006_100190312 274
211 3300015262 Ga0182007_10001931 Ga0182007_100019319 274
212 3300027111 Ga0209281_1000015 Ga0209281_1000015466 274
213 3300027907 Ga0207428_10001451 Ga0207428_1000145132 274
214 3300031548 Ga0307408_100003303 Ga0307408_10000330312 274
215 3300031911 Ga0307412_10000173 Ga0307412_1000017323 274
216 3300042122 Ga0450920_001911 Ga0450920_001911_1200_2075 274
217 3300042146 Ga0450907_000217 Ga0450907_000217_18021_18896 274
218 3300042147 Ga0450910_000050 Ga0450910_000050_9654_10529 274
219 3300042184 Ga0450908_000026 Ga0450908_000026_825_1700 274
220 3300046460 Ga0495638_0001415 Ga0495638_0001415_10824_11696 274
221 3300046460 Ga0495638_0033334 Ga0495638_0033334_1591_2463 274
222 3300046471 Ga0495650_0000923 Ga0495650_0000923_2529_3401 274
223 3300046474 Ga0495605_0043407 Ga0495605_0043407_661_1533 274
224 3300046491 Ga0495584_0007162 Ga0495584_0007162_2768_3640 274
225 3300046492 Ga0495585_0039394 Ga0495585_0039394_398_1270 274
226 3300046506 Ga0495583_0005178 Ga0495583_0005178_7830_8702 274
227 3300046512 Ga0495610_0000630 Ga0495610_0000630_18171_19043 274
228 3300046513 Ga0495616_0016418 Ga0495616_0016418_2689_3561 274
229 3300046519 Ga0495632_0000611 Ga0495632_0000611_31342_32214 274
230 3300046522 Ga0495643_0018928 Ga0495643_0018928_256_1128 274
231 3300046523 Ga0495644_0003688 Ga0495644_0003688_983_1855 274
232 3300046524 Ga0495648_0039031 Ga0495648_0039031_2029_2901 274
233 3300046528 Ga0495642_0000042 Ga0495642_0000042_41621_42493 274
234 3300046530 Ga0495654_0000309 Ga0495654_0000309_2104_2976 274
235 3300046530 Ga0495654_0003281 Ga0495654_0003281_4151_5023 274
236 3300046530 Ga0495654_0020956 Ga0495654_0020956_1820_2692 274
237 3300046538 Ga0495609_0000301 Ga0495609_0000301_33369_34241 274
238 3300046542 Ga0495597_0119661 Ga0495597_0119661_63_935 274
239 3300046615 Ga0495656_0056489 Ga0495656_0056489_675_1547 274
240 3300046660 Ga0495625_0008956 Ga0495625_0008956_687_1559 274
241 3300046660 Ga0495625_0045218 Ga0495625_0045218_663_1535 274
242 3300046664 Ga0495659_0000099 Ga0495659_0000099_34154_35026 274
243 3300046665 Ga0495661_0125044 Ga0495661_0125044_417_1289 274
244 3300046684 Ga0495669_0086122 Ga0495669_0086122_451_1323 274
245 3300046691 Ga0495670_0013050 Ga0495670_0013050_1018_1890 274
246 3300046692 Ga0495671_0020229 Ga0495671_0020229_162_1034 274
247 3300046692 Ga0495671_0082076 Ga0495671_0082076_658_1530 274
248 3300046694 Ga0495649_0011530 Ga0495649_0011530_3632_4504 274
249 3300046794 Ga0495589_0015137 Ga0495589_0015137_538_1410 274
250 3300046810 Ga0495660_0013255 Ga0495660_0013255_150_1022 274
251 3300047318 Ga0495636_0009232 Ga0495636_0009232_2179_3051 274
252 3300047320 Ga0495672_0111051 Ga0495672_0111051_465_1337 274
253 3300047323 Ga0495683_0024786 Ga0495683_0024786_150_1022 274
254 3300047469 Ga0495673_0013391 Ga0495673_0013391_556_1428 274
255 3300047470 Ga0495681_0015748 Ga0495681_0015748_2813_3685 274
256 3300048091 Ga0495626_0070127 Ga0495626_0070127_556_1428 274
257 3300049459 Ga0495678_054232 Ga0495678_054232_150_1022 274
258 3300049460 Ga0495682_0047852 Ga0495682_0047852_538_1410 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

39

97

0.92

PF00717

Peptidase_S24

Peptidase S24-like

183

302

0.84

Feature Viewer

pLDDT pTM Quality
67.65 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map