F368358

General Info

Members Datasets Scaffolds Average Seq Length
258 185 516 183

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0000008|Ga0495602_0000008_231680_232285
Length 201
Sequence LFLHQLFERQQNSRKEIMSTKTINQQQVPAGTWTVDPIHSSITFAVTHNGVTTFRSGFEAYEARLVGGEQPRLEGTVEVASIDIDEEMLKGHLLSPEFFDVQRFPQLRFASSEISVGEDGSLRVVGELEIHGESRKVEASGRFASLGADLAGNERVGLSIESTVDRRDFGLDWQAQLPSGGEVLDYAVTISVELELVTEEA

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
185 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 1.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 9.69
Rhizosphere 87.98
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0000008 3300048088 Bacteria 260157
2 JGI24740J21852_10002620 3300001979 Bacteria 8100
3 JGI25407J50210_10058568 3300003373 Bacteria 970
4 Ga0070658_10125411 3300005327 Bacteria 2137
5 Ga0070683_100098363 3300005329 Bacteria 2754
6 Ga0070670_100150143 3300005331 Bacteria 2017
7 Ga0070677_10000153 3300005333 Bacteria 23244
8 Ga0070666_10009423 3300005335 Bacteria 6088
9 Ga0070680_100021599 3300005336 Bacteria 5118
10 Ga0070682_100000086 3300005337 Bacteria 83703
11 Ga0070682_100000303 3300005337 Bacteria 34116
12 Ga0068868_100032286 3300005338 Bacteria 4027
13 Ga0070660_100125941 3300005339 Bacteria 2047
14 Ga0070661_100000633 3300005344 Bacteria 26147
15 Ga0070661_100958787 3300005344 Bacteria 708
16 Ga0070675_100000063 3300005354 Bacteria 64820
17 Ga0070688_100003080 3300005365 Bacteria 8520
18 Ga0070688_100033158 3300005365 Bacteria 3120
19 Ga0070688_100041350 3300005365 Bacteria 2829
20 Ga0070659_100003464 3300005366 Bacteria 11233
21 Ga0070667_100055887 3300005367 Bacteria 3333
22 Ga0070667_100210141 3300005367 Bacteria 1729
23 Ga0070714_100199767 3300005435 Bacteria 1829
24 Ga0070713_100000080 3300005436 Bacteria 60198
25 Ga0070713_100123164 3300005436 Bacteria 2276
26 Ga0070711_100140245 3300005439 Bacteria 1811
27 Ga0070663_100655720 3300005455 Unclassified 888
28 Ga0070678_100017734 3300005456 Bacteria 4593
29 Ga0070681_10022818 3300005458 Bacteria 6290
30 Ga0070685_10000340 3300005466 Bacteria 28675
31 Ga0070685_10009982 3300005466 Bacteria 4926
32 Ga0070679_100000570 3300005530 Bacteria 31264
33 Ga0070684_100038032 3300005535 Bacteria 4132
34 Ga0070684_100062924 3300005535 Bacteria 3251
35 Ga0070684_100310242 3300005535 Bacteria 1448
36 Ga0068853_100520448 3300005539 Bacteria 1124
37 Ga0070665_100000490 3300005548 Bacteria 56603
38 Ga0070665_100129673 3300005548 Bacteria 2524
39 Ga0070664_100037876 3300005564 Bacteria 4056
40 Ga0068857_100038576 3300005577 Bacteria 4231
41 Ga0068854_100000091 3300005578 Bacteria 63568
42 Ga0068856_100001180 3300005614 Bacteria 27504
43 Ga0068852_100000035 3300005616 Bacteria 99721
44 Ga0068852_100225069 3300005616 Bacteria 1786
45 Ga0068861_100366292 3300005719 Bacteria 1269
46 Ga0068851_10001419 3300005834 Bacteria 10483
47 Ga0068851_10003586 3300005834 Bacteria 6920
48 Ga0068870_10230553 3300005840 Bacteria 1138
49 Ga0068863_100775989 3300005841 Bacteria 955
50 Ga0068858_100000772 3300005842 Bacteria 33386
51 Ga0068858_100973191 3300005842 Bacteria 831
52 Ga0068860_100253155 3300005843 Bacteria 1715
53 Ga0068862_100125760 3300005844 Bacteria 2263
54 Ga0081538_10000010 3300005981 Bacteria 164857
55 Ga0081538_10072090 3300005981 Bacteria 1896
56 Ga0081540_1000564 3300005983 Bacteria 35930
57 Ga0081539_10004745 3300005985 Bacteria 14693
58 Ga0070715_10207964 3300006163 Bacteria 998
59 Ga0070712_100003110 3300006175 Bacteria 10236
60 Ga0097621_100808299 3300006237 Bacteria 869
61 Ga0075430_100045687 3300006846 Bacteria 3699
62 Ga0068865_100000260 3300006881 Bacteria 29219
63 Ga0075435_100393011 3300007076 Bacteria 1192
64 Ga0105245_10000262 3300009098 Bacteria 50073
65 Ga0105245_10007535 3300009098 Bacteria 9536
66 Ga0105247_10108821 3300009101 Bacteria 1781
67 Ga0105247_10559738 3300009101 Bacteria 842
68 Ga0105241_10097108 3300009174 Bacteria 2335
69 Ga0105242_10004002 3300009176 Bacteria 11454
70 Ga0105248_10000547 3300009177 Bacteria 42972
71 Ga0105248_10738981 3300009177 Bacteria 1110
72 Ga0105238_10000051 3300009551 Bacteria 141705
73 Ga0105249_10000708 3300009553 Bacteria 30229
74 Ga0105249_10006484 3300009553 Bacteria 10179
75 Ga0105239_10204170 3300010375 Bacteria 2214
76 Ga0157371_10029889 3300013102 Bacteria 3934
77 Ga0157369_10000348 3300013105 Bacteria 61516
78 Ga0157369_11103280 3300013105 Bacteria 811
79 Ga0157374_10015112 3300013296 Bacteria 6768
80 Ga0157374_10077329 3300013296 Bacteria 3149
81 Ga0157378_10026356 3300013297 Bacteria 5124
82 Ga0157372_10000435 3300013307 Bacteria 45997
83 Ga0157375_10162809 3300013308 Bacteria 2374
84 Ga0157375_10353922 3300013308 Bacteria 1634
85 Ga0157380_10000092 3300014326 Bacteria 48994
86 Ga0157380_10769013 3300014326 Bacteria 977
87 Ga0157379_10033747 3300014968 Bacteria 4565
88 Ga0157379_10095191 3300014968 Bacteria 2672
89 Ga0157376_10244112 3300014969 Bacteria 1674
90 Ga0157376_10442040 3300014969 Bacteria 1267
91 Ga0206356_10600948 3300020070 Bacteria 2955
92 Ga0206349_1652994 3300020075 Bacteria 1162
93 Ga0206353_11139743 3300020082 Bacteria 1292
94 Ga0207656_10000314 3300025321 Bacteria 16753
95 Ga0207656_10037458 3300025321 Bacteria 2041
96 Ga0207682_10000756 3300025893 Bacteria 14892
97 Ga0207710_10081226 3300025900 Bacteria 1504
98 Ga0207680_10008301 3300025903 Bacteria 5089
99 Ga0207643_10163733 3300025908 Bacteria 1339
100 Ga0207705_10041752 3300025909 Bacteria 3291
101 Ga0207654_10077084 3300025911 Bacteria 1997
102 Ga0207707_10020533 3300025912 Bacteria 5768
103 Ga0207693_10021324 3300025915 Bacteria 5149
104 Ga0207663_10423670 3300025916 Bacteria 1022
105 Ga0207660_10322535 3300025917 Unclassified 1234
106 Ga0207657_10321792 3300025919 Bacteria 1223
107 Ga0207657_10516806 3300025919 Bacteria 935
108 Ga0207649_10000333 3300025920 Bacteria 35819
109 Ga0207652_10000854 3300025921 Bacteria 28959
110 Ga0207694_10000035 3300025924 Bacteria 195870
111 Ga0207650_10057334 3300025925 Bacteria 2897
112 Ga0207659_10000054 3300025926 Bacteria 76823
113 Ga0207687_10000027 3300025927 Bacteria 168505
114 Ga0207687_10000058 3300025927 Bacteria 85860
115 Ga0207700_10000013 3300025928 Bacteria 230462
116 Ga0207664_10407393 3300025929 Bacteria 1210
117 Ga0207690_10003028 3300025932 Bacteria 10114
118 Ga0207686_10000440 3300025934 Bacteria 27916
119 Ga0207704_10002108 3300025938 Bacteria 8921
120 Ga0207711_10000019 3300025941 Bacteria 412779
121 Ga0207661_10008279 3300025944 Bacteria 7429
122 Ga0207661_10040297 3300025944 Bacteria 3671
123 Ga0207661_10053213 3300025944 Bacteria 3238
124 Ga0207661_10075662 3300025944 Bacteria 2763
125 Ga0207679_10011056 3300025945 Bacteria 5829
126 Ga0207667_10402383 3300025949 Bacteria 1394
127 Ga0207712_10000033 3300025961 Bacteria 209336
128 Ga0207712_10042335 3300025961 Bacteria 3135
129 Ga0207668_10021293 3300025972 Bacteria 4133
130 Ga0207640_10000140 3300025981 Bacteria 53451
131 Ga0207658_10005912 3300025986 Bacteria 8356
132 Ga0207658_10176212 3300025986 Bacteria 1766
133 Ga0207677_10001509 3300026023 Bacteria 12292
134 Ga0207703_10000597 3300026035 Bacteria 36654
135 Ga0207639_10204694 3300026041 Bacteria 1695
136 Ga0207702_10000737 3300026078 Bacteria 34960
137 Ga0207674_10046568 3300026116 Bacteria 4452
138 Ga0207675_100475637 3300026118 Bacteria 1241
139 Ga0207683_10070285 3300026121 Bacteria 3093
140 Ga0207698_10000044 3300026142 Bacteria 94471
141 Ga0207698_10047805 3300026142 Bacteria 3245
142 Ga0268266_10000076 3300028379 Bacteria 217644
143 Ga0268266_10001920 3300028379 Bacteria 23363
144 Ga0268266_10084798 3300028379 Bacteria 2767
145 Ga0268266_10368278 3300028379 Bacteria 1353
146 Ga0268265_10010484 3300028380 Bacteria 6258
147 Ga0268264_10214875 3300028381 Bacteria 1767
148 Ga0307405_10467210 3300031731 Bacteria 1004
149 Ga0307415_100014304 3300032126 Bacteria 4661
150 Ga0373933_0618499 3300035724 Unclassified 712
151 Ga0373937_0692766 3300036401 Bacteria 965
152 Ga0466963_0000035 3300044694 Bacteria 44364
153 Ga0466963_0017737 3300044694 Bacteria 4440
154 Ga0466963_0074254 3300044694 Bacteria 2293
155 Ga0466957_0001096 3300044842 Bacteria 13999
156 Ga0466958_0080849 3300045836 Bacteria 1999
157 Ga0466967_0000003 3300045976 Bacteria 169144
158 Ga0466967_0113686 3300045976 Bacteria 2491
159 Ga0466967_0155393 3300045976 Bacteria 2142
160 Ga0466967_1295222 3300045976 Bacteria 726
161 Ga0495592_0040546 3300046454 Bacteria 3495
162 Ga0495629_0000934 3300046459 Bacteria 23527
163 Ga0495641_0000001 3300046461 Bacteria 485224
164 Ga0495641_0014780 3300046461 Bacteria 4209
165 Ga0495653_0021594 3300046463 Bacteria 5215
166 Ga0495653_0532747 3300046463 Bacteria 729
167 Ga0495662_0000031 3300046476 Bacteria 47907
168 Ga0495606_0015106 3300046507 Bacteria 5974
169 Ga0495608_0000021 3300046511 Bacteria 168462
170 Ga0495608_0094311 3300046511 Bacteria 1933
171 Ga0495610_0064548 3300046512 Bacteria 1730
172 Ga0495628_0215526 3300046516 Bacteria 1443
173 Ga0495630_0000053 3300046517 Bacteria 93065
174 Ga0495630_0047979 3300046517 Bacteria 3195
175 Ga0495652_0000022 3300046529 Bacteria 178368
176 Ga0495640_0003562 3300046533 Bacteria 12507
177 Ga0495586_0000608 3300046535 Bacteria 20782
178 Ga0495587_0453648 3300046536 Bacteria 710
179 Ga0495667_0056080 3300046559 Bacteria 2591
180 Ga0495634_0133155 3300046642 Bacteria 1583
181 Ga0495625_0000117 3300046660 Bacteria 121901
182 Ga0495625_0506986 3300046660 Bacteria 737
183 Ga0495635_0000026 3300046663 Bacteria 142517
184 Ga0495588_0000496 3300046674 Bacteria 19288
185 Ga0495657_0000019 3300046675 Bacteria 168441
186 Ga0495657_0013264 3300046675 Bacteria 6086
187 Ga0495599_0039139 3300046678 Bacteria 2979
188 Ga0495647_0000096 3300046681 Bacteria 22160
189 Ga0495647_0003681 3300046681 Bacteria 4921
190 Ga0495658_0022946 3300046683 Bacteria 3307
191 Ga0495669_0000045 3300046684 Bacteria 84113
192 Ga0495669_0143147 3300046684 Unclassified 1129
193 Ga0495613_0000861 3300046689 Bacteria 23279
194 Ga0495624_0000085 3300046690 Bacteria 61809
195 Ga0495624_0000699 3300046690 Bacteria 26337
196 Ga0495624_0096769 3300046690 Bacteria 1818
197 Ga0495670_0005477 3300046691 Bacteria 6230
198 Ga0495649_0015120 3300046694 Bacteria 4399
199 Ga0495600_0009323 3300046809 Bacteria 6061
200 Ga0495600_0017169 3300046809 Bacteria 4601
201 Ga0495581_0094852 3300047315 Bacteria 1732
202 Ga0495604_0000081 3300047317 Bacteria 82621
203 Ga0495604_0001698 3300047317 Bacteria 18108
204 Ga0495604_0044651 3300047317 Bacteria 3460
205 Ga0495604_0726135 3300047317 Unclassified 629
206 Ga0495674_0131492 3300047319 Bacteria 2108
207 Ga0495676_0005949 3300047321 Bacteria 11200
208 Ga0495676_0167068 3300047321 Bacteria 1551
209 Ga0495676_0247793 3300047321 Unclassified 1217
210 Ga0495680_0230714 3300047322 Bacteria 1318
211 Ga0495675_0000141 3300047444 Bacteria 50168
212 Ga0495675_0033770 3300047444 Bacteria 3265
213 Ga0495679_039853 3300047446 Bacteria 1463
214 Ga0495593_0031920 3300047673 Bacteria 2874
215 Ga0496100_0000003 3300048903 Bacteria 360802
216 Ga0496101_0000003 3300048904 Bacteria 406565
217 Ga0496104_0000007 3300048907 Bacteria 524804
218 Ga0496104_0000120 3300048907 Bacteria 72797
219 Ga0496105_0000002 3300048908 Bacteria 753215
220 Ga0496105_0000020 3300048908 Bacteria 181484
221 Ga0496106_0000146 3300048909 Bacteria 52294
222 Ga0496107_0000026 3300048910 Bacteria 108989
223 Ga0496108_0000025 3300048911 Bacteria 177919
224 Ga0496108_0000032 3300048911 Bacteria 158930
225 Ga0496108_0087856 3300048911 Bacteria 2641
226 Ga0496109_0000070 3300048912 Bacteria 108889
227 Ga0496109_0000081 3300048912 Bacteria 99723
228 Ga0496109_0000884 3300048912 Bacteria 25037
229 Ga0496109_0624719 3300048912 Bacteria 1014
230 Ga0496110_0000003 3300048913 Bacteria 144124
231 Ga0496110_0015192 3300048913 Bacteria 6405
232 Ga0496110_0080947 3300048913 Bacteria 2895
233 Ga0496110_0651865 3300048913 Bacteria 953
234 Ga0496111_0000024 3300048914 Bacteria 62369
235 Ga0496111_0037156 3300048914 Bacteria 3486
236 Ga0496112_0000003 3300048915 Bacteria 660147
237 Ga0496112_0000668 3300048915 Bacteria 23904
238 Ga0496113_0000025 3300048916 Bacteria 64773
239 Ga0496114_0116934 3300048917 Bacteria 2290
240 Ga0496119_0225644 3300048922 Bacteria 956
241 Ga0496120_0009861 3300048923 Bacteria 6729
242 Ga0496124_0079374 3300048927 Bacteria 2703
243 Ga0496125_0110556 3300048928 Bacteria 1992
244 Ga0501323_042531 3300049539 Unclassified 670
245 Ga0501042_0054259 3300049578 Bacteria 2858
246 Ga0501073_0674432 3300049589 Bacteria 713
247 nmdc:mga0qj67_117584_c1 3300050509 Bacteria 2149
248 nmdc:mga0rr50_445475_c1 3300050513 Bacteria 1097
249 Ga0495601_0000096 3300053077 Bacteria 48420
250 Ga0495612_0001210 3300053078 Bacteria 10641
251 Ga0495612_0007572 3300053078 Bacteria 4438
252 Ga0495655_0008260 3300053083 Bacteria 1970
253 Ga0495595_0000004 3300053084 Bacteria 260821
254 Ga0495595_0038007 3300053084 Bacteria 2191
255 Ga0495619_0000080 3300053085 Bacteria 72201
256 Ga0495619_0000336 3300053085 Bacteria 32967
257 Ga0500641_0001689 3300053096 Bacteria 7846
258 Ga0500614_000204 3300053123 Bacteria 15618
259 Ga0495602_0000008
260 JGI24740J21852_10002620
261 JGI25407J50210_10058568
262 Ga0070658_10125411
263 Ga0070683_100098363
264 Ga0070670_100150143
265 Ga0070677_10000153
266 Ga0070666_10009423
267 Ga0070680_100021599
268 Ga0070682_100000086
269 Ga0070682_100000303
270 Ga0068868_100032286
271 Ga0070660_100125941
272 Ga0070661_100000633
273 Ga0070661_100958787
274 Ga0070675_100000063
275 Ga0070688_100003080
276 Ga0070688_100033158
277 Ga0070688_100041350
278 Ga0070659_100003464
279 Ga0070667_100055887
280 Ga0070667_100210141
281 Ga0070714_100199767
282 Ga0070713_100000080
283 Ga0070713_100123164
284 Ga0070711_100140245
285 Ga0070663_100655720
286 Ga0070678_100017734
287 Ga0070681_10022818
288 Ga0070685_10000340
289 Ga0070685_10009982
290 Ga0070679_100000570
291 Ga0070684_100038032
292 Ga0070684_100062924
293 Ga0070684_100310242
294 Ga0068853_100520448
295 Ga0070665_100000490
296 Ga0070665_100129673
297 Ga0070664_100037876
298 Ga0068857_100038576
299 Ga0068854_100000091
300 Ga0068856_100001180
301 Ga0068852_100000035
302 Ga0068852_100225069
303 Ga0068861_100366292
304 Ga0068851_10001419
305 Ga0068851_10003586
306 Ga0068870_10230553
307 Ga0068863_100775989
308 Ga0068858_100000772
309 Ga0068858_100973191
310 Ga0068860_100253155
311 Ga0068862_100125760
312 Ga0081538_10000010
313 Ga0081538_10072090
314 Ga0081540_1000564
315 Ga0081539_10004745
316 Ga0070715_10207964
317 Ga0070712_100003110
318 Ga0097621_100808299
319 Ga0075430_100045687
320 Ga0068865_100000260
321 Ga0075435_100393011
322 Ga0105245_10000262
323 Ga0105245_10007535
324 Ga0105247_10108821
325 Ga0105247_10559738
326 Ga0105241_10097108
327 Ga0105242_10004002
328 Ga0105248_10000547
329 Ga0105248_10738981
330 Ga0105238_10000051
331 Ga0105249_10000708
332 Ga0105249_10006484
333 Ga0105239_10204170
334 Ga0157371_10029889
335 Ga0157369_10000348
336 Ga0157369_11103280
337 Ga0157374_10015112
338 Ga0157374_10077329
339 Ga0157378_10026356
340 Ga0157372_10000435
341 Ga0157375_10162809
342 Ga0157375_10353922
343 Ga0157380_10000092
344 Ga0157380_10769013
345 Ga0157379_10033747
346 Ga0157379_10095191
347 Ga0157376_10244112
348 Ga0157376_10442040
349 Ga0206356_10600948
350 Ga0206349_1652994
351 Ga0206353_11139743
352 Ga0207656_10000314
353 Ga0207656_10037458
354 Ga0207682_10000756
355 Ga0207710_10081226
356 Ga0207680_10008301
357 Ga0207643_10163733
358 Ga0207705_10041752
359 Ga0207654_10077084
360 Ga0207707_10020533
361 Ga0207693_10021324
362 Ga0207663_10423670
363 Ga0207660_10322535
364 Ga0207657_10321792
365 Ga0207657_10516806
366 Ga0207649_10000333
367 Ga0207652_10000854
368 Ga0207694_10000035
369 Ga0207650_10057334
370 Ga0207659_10000054
371 Ga0207687_10000027
372 Ga0207687_10000058
373 Ga0207700_10000013
374 Ga0207664_10407393
375 Ga0207690_10003028
376 Ga0207686_10000440
377 Ga0207704_10002108
378 Ga0207711_10000019
379 Ga0207661_10008279
380 Ga0207661_10040297
381 Ga0207661_10053213
382 Ga0207661_10075662
383 Ga0207679_10011056
384 Ga0207667_10402383
385 Ga0207712_10000033
386 Ga0207712_10042335
387 Ga0207668_10021293
388 Ga0207640_10000140
389 Ga0207658_10005912
390 Ga0207658_10176212
391 Ga0207677_10001509
392 Ga0207703_10000597
393 Ga0207639_10204694
394 Ga0207702_10000737
395 Ga0207674_10046568
396 Ga0207675_100475637
397 Ga0207683_10070285
398 Ga0207698_10000044
399 Ga0207698_10047805
400 Ga0268266_10000076
401 Ga0268266_10001920
402 Ga0268266_10084798
403 Ga0268266_10368278
404 Ga0268265_10010484
405 Ga0268264_10214875
406 Ga0307405_10467210
407 Ga0307415_100014304
408 Ga0373933_0618499
409 Ga0373937_0692766
410 Ga0466963_0000035
411 Ga0466963_0017737
412 Ga0466963_0074254
413 Ga0466957_0001096
414 Ga0466958_0080849
415 Ga0466967_0000003
416 Ga0466967_0113686
417 Ga0466967_0155393
418 Ga0466967_1295222
419 Ga0495592_0040546
420 Ga0495629_0000934
421 Ga0495641_0000001
422 Ga0495641_0014780
423 Ga0495653_0021594
424 Ga0495653_0532747
425 Ga0495662_0000031
426 Ga0495606_0015106
427 Ga0495608_0000021
428 Ga0495608_0094311
429 Ga0495610_0064548
430 Ga0495628_0215526
431 Ga0495630_0000053
432 Ga0495630_0047979
433 Ga0495652_0000022
434 Ga0495640_0003562
435 Ga0495586_0000608
436 Ga0495587_0453648
437 Ga0495667_0056080
438 Ga0495634_0133155
439 Ga0495625_0000117
440 Ga0495625_0506986
441 Ga0495635_0000026
442 Ga0495588_0000496
443 Ga0495657_0000019
444 Ga0495657_0013264
445 Ga0495599_0039139
446 Ga0495647_0000096
447 Ga0495647_0003681
448 Ga0495658_0022946
449 Ga0495669_0000045
450 Ga0495669_0143147
451 Ga0495613_0000861
452 Ga0495624_0000085
453 Ga0495624_0000699
454 Ga0495624_0096769
455 Ga0495670_0005477
456 Ga0495649_0015120
457 Ga0495600_0009323
458 Ga0495600_0017169
459 Ga0495581_0094852
460 Ga0495604_0000081
461 Ga0495604_0001698
462 Ga0495604_0044651
463 Ga0495604_0726135
464 Ga0495674_0131492
465 Ga0495676_0005949
466 Ga0495676_0167068
467 Ga0495676_0247793
468 Ga0495680_0230714
469 Ga0495675_0000141
470 Ga0495675_0033770
471 Ga0495679_039853
472 Ga0495593_0031920
473 Ga0496100_0000003
474 Ga0496101_0000003
475 Ga0496104_0000007
476 Ga0496104_0000120
477 Ga0496105_0000002
478 Ga0496105_0000020
479 Ga0496106_0000146
480 Ga0496107_0000026
481 Ga0496108_0000025
482 Ga0496108_0000032
483 Ga0496108_0087856
484 Ga0496109_0000070
485 Ga0496109_0000081
486 Ga0496109_0000884
487 Ga0496109_0624719
488 Ga0496110_0000003
489 Ga0496110_0015192
490 Ga0496110_0080947
491 Ga0496110_0651865
492 Ga0496111_0000024
493 Ga0496111_0037156
494 Ga0496112_0000003
495 Ga0496112_0000668
496 Ga0496113_0000025
497 Ga0496114_0116934
498 Ga0496119_0225644
499 Ga0496120_0009861
500 Ga0496124_0079374
501 Ga0496125_0110556
502 Ga0501323_042531
503 Ga0501042_0054259
504 Ga0501073_0674432
505 nmdc:mga0qj67_117584_c1
506 nmdc:mga0rr50_445475_c1
507 Ga0495601_0000096
508 Ga0495612_0001210
509 Ga0495612_0007572
510 Ga0495655_0008260
511 Ga0495595_0000004
512 Ga0495595_0038007
513 Ga0495619_0000080
514 Ga0495619_0000336
515 Ga0500641_0001689
516 Ga0500614_000204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

33

196

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.9186 14 182
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.8792 14 182
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.8763 17 177
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.8757 14 182
6w3w-assembly1.cif.gz_A an enumerative algorithm for de novo design of proteins with diverse pocket structures 0.8669 91 124
ID Description Score Start End Superfamily
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9186 14 182 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8816 17 177 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8812 14 182 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8792 14 182 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8712 14 182 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A838V6I3-F1-model_v4 YceI family protein 0.982 2 183
AF-A0A537YKF7-F1-model_v4 YceI family protein 0.9732 1 183
AF-A0A838V6I3-F1-model_v4 YceI family protein 0.9715 2 183
AF-A0A7V9M6X5-F1-model_v4 YceI family protein 0.9711 12 182
AF-A0A537YKF7-F1-model_v4 YceI family protein 0.9679 1 183

Map