F368463

General Info

Members Datasets Scaffolds Average Seq Length
258 158 516 245

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221559|2643818739
Length 290
Sequence AEPAFVLHTRPWRETSLLVEVLSRNHGRIGLVARGVQGPKKQLLRAALQPLQWIRFDAVQMGEMARLTAAEALDAAPRLSGDGMLAGFYLNELTLRLAPRNDPLPDLFAAYEQARARLGSDASPGWTLRRFERDLLDALGFGFDWHHDGDGAAIDPAARYRLDPEHGPRRLLSDRGHADRSGAATGQALLALADDRLPSTDDLAGLRRAMRGVLAHHLGPRGLKSWELLAELARVAPRAKPGASATATDETTTGEVMPGEAMPDDVVLDEVMPDEVMPDDREPDTDSRDG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
75 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
90 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
98 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
99 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
140 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
141 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
142 2643221559 Lysobacter sp. Root559 Isolate Unclassified
143 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
144 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
145 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
146 2643221573 Lysobacter sp. Root604 Isolate Unclassified
147 2643221586 Lysobacter sp. Root667 Isolate Unclassified
148 2643221612 Lysobacter sp. Root76 Isolate Unclassified
149 2643221695 Lysobacter sp. Root494 Isolate Unclassified
150 2643221720 Lysobacter sp. Root916 Isolate Unclassified
151 2643221727 Lysobacter sp. Root96 Isolate Unclassified
152 2643221728 Lysobacter sp. Root983 Isolate Unclassified
153 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
154 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
155 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
156 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
157 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
158 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.41
Metatranscriptomes 0
Isolates 6.59

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 22.09
Nodule 0
Rhizoplane 3.49
Rhizosphere 56.2
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10016448 3300003320 Bacteria 31308
2 Ga0055537_1000306 3300003773 Bacteria 33928
3 Ga0055524_1004882 3300003775 Bacteria 6092
4 Ga0055524_1009915 3300003775 Bacteria 3831
5 Ga0055536_1001400 3300003781 Bacteria 14570
6 Ga0055536_1008916 3300003781 Bacteria 4233
7 Ga0055536_1028530 3300003781 Bacteria 1518
8 Ga0055534_1000388 3300003784 Bacteria 27515
9 Ga0055528_1000867 3300003790 Bacteria 20519
10 Ga0055528_1001434 3300003790 Bacteria 14584
11 Ga0055530_10002733 3300003791 Bacteria 10932
12 Ga0055531_10002202 3300003794 Bacteria 13259
13 Ga0055531_10006458 3300003794 Bacteria 6655
14 Ga0055531_10008163 3300003794 Bacteria 5577
15 Ga0055531_10014542 3300003794 Bacteria 3536
16 Ga0055531_10021811 3300003794 Bacteria 2468
17 Ga0065715_10029858 3300005293 Bacteria 1891
18 Ga0065715_10091456 3300005293 Bacteria 5783
19 Ga0068869_100079355 3300005334 Bacteria 2446
20 Ga0068868_100075928 3300005338 Bacteria 2686
21 Ga0070661_100097116 3300005344 Bacteria 2187
22 Ga0070692_10376986 3300005345 Unclassified 889
23 Ga0070669_100182545 3300005353 Bacteria 1642
24 Ga0070701_10119625 3300005438 Bacteria 1482
25 Ga0070663_100000372 3300005455 Bacteria 23558
26 Ga0068867_100147099 3300005459 Bacteria 1848
27 Ga0068853_100000696 3300005539 Bacteria 23230
28 Ga0068853_100032825 3300005539 Bacteria 4400
29 Ga0068853_100203281 3300005539 Bacteria 1803
30 Ga0070672_100011466 3300005543 Bacteria 6182
31 Ga0070672_100015298 3300005543 Bacteria 5460
32 Ga0070665_100000512 3300005548 Bacteria 55689
33 Ga0070665_100036244 3300005548 Bacteria 4962
34 Ga0068855_100058777 3300005563 Bacteria 4501
35 Ga0068855_100509613 3300005563 Bacteria 1307
36 Ga0068856_100359665 3300005614 Bacteria 1474
37 Ga0068852_100203095 3300005616 Bacteria 1876
38 Ga0068852_100617783 3300005616 Bacteria 1089
39 Ga0068852_100622474 3300005616 Unclassified 1085
40 Ga0068852_100622555 3300005616 Bacteria 1085
41 Ga0068858_100068485 3300005842 Bacteria 3289
42 Ga0075364_10000037 3300006051 Bacteria 47111
43 Ga0105240_10009014 3300009093 Bacteria 14171
44 Ga0105240_10010222 3300009093 Bacteria 13208
45 Ga0105240_10016314 3300009093 Bacteria 10061
46 Ga0105243_10411820 3300009148 Bacteria 1258
47 Ga0105248_10000457 3300009177 Bacteria 46486
48 Ga0105248_10012880 3300009177 Bacteria 9223
49 Ga0105237_10002511 3300009545 Bacteria 22722
50 Ga0105249_10000707 3300009553 Bacteria 30264
51 Ga0105239_10000022 3300010375 Bacteria 257744
52 Ga0105239_10009236 3300010375 Bacteria 11149
53 Ga0105239_10038993 3300010375 Bacteria 5204
54 Ga0105239_10420643 3300010375 Bacteria 1514
55 Ga0157371_10059313 3300013102 Bacteria 2713
56 Ga0157370_10176966 3300013104 Bacteria 1983
57 Ga0157374_10117148 3300013296 Bacteria 2567
58 Ga0157378_10030199 3300013297 Bacteria 4788
59 Ga0157375_10003676 3300013308 Bacteria 13318
60 Ga0157375_10077337 3300013308 Bacteria 3357
61 Ga0182008_10014100 3300014497 Bacteria 4191
62 Ga0157376_10052237 3300014969 Bacteria 3398
63 Ga0163161_10028216 3300017792 Bacteria 3984
64 Ga0207425_1012348 3300025245 Bacteria 2008
65 Ga0209565_1000119 3300025263 Bacteria 112825
66 Ga0209673_1000866 3300025273 Bacteria 39283
67 Ga0209673_1047029 3300025273 Bacteria 1173
68 Ga0209675_1000048 3300025291 Bacteria 221457
69 Ga0209675_1005300 3300025291 Bacteria 5430
70 Ga0209675_1015067 3300025291 Bacteria 2316
71 Ga0209676_1000472 3300025292 Bacteria 67063
72 Ga0209676_1000857 3300025292 Bacteria 39244
73 Ga0209676_1001048 3300025292 Bacteria 31833
74 Ga0209676_1002293 3300025292 Bacteria 13961
75 Ga0209676_1006272 3300025292 Bacteria 5918
76 Ga0209676_1006491 3300025292 Bacteria 5758
77 Ga0209676_1006984 3300025292 Bacteria 5428
78 Ga0209025_1001267 3300025294 Bacteria 34816
79 Ga0209025_1013136 3300025294 Bacteria 5229
80 Ga0209025_1035573 3300025294 Bacteria 2248
81 Ga0209025_1036704 3300025294 Bacteria 2189
82 Ga0209025_1068668 3300025294 Bacteria 1272
83 Ga0209564_1000106 3300025295 Bacteria 216131
84 Ga0209564_1012188 3300025295 Bacteria 3769
85 Ga0209564_1014645 3300025295 Bacteria 3244
86 Ga0209758_1025359 3300025297 Bacteria 2605
87 Ga0209050_1001432 3300025298 Bacteria 25688
88 Ga0209050_1033487 3300025298 Bacteria 1557
89 Ga0209256_1001506 3300025299 Bacteria 23600
90 Ga0209256_1004781 3300025299 Bacteria 8237
91 Ga0209256_1007727 3300025299 Bacteria 5207
92 Ga0209051_1007281 3300025303 Bacteria 6073
93 Ga0209051_1034679 3300025303 Bacteria 1888
94 Ga0209257_1000255 3300025304 Bacteria 123098
95 Ga0209257_1000715 3300025304 Bacteria 51044
96 Ga0209257_1001117 3300025304 Bacteria 34675
97 Ga0209257_1003071 3300025304 Bacteria 15043
98 Ga0209257_1003627 3300025304 Bacteria 12981
99 Ga0209257_1026561 3300025304 Bacteria 1948
100 Ga0209257_1028262 3300025304 Bacteria 1849
101 Ga0207695_10005349 3300025913 Bacteria 17073
102 Ga0207695_10008040 3300025913 Bacteria 13278
103 Ga0207695_10012767 3300025913 Bacteria 10057
104 Ga0207671_10004702 3300025914 Bacteria 12904
105 Ga0207652_10342170 3300025921 Bacteria 1350
106 Ga0207681_10025235 3300025923 Bacteria 3821
107 Ga0207659_10211204 3300025926 Bacteria 1555
108 Ga0207644_10364660 3300025931 Bacteria 1176
109 Ga0207709_10304921 3300025935 Bacteria 1186
110 Ga0207691_10003987 3300025940 Bacteria 14334
111 Ga0207691_10027247 3300025940 Bacteria 5361
112 Ga0207711_10000938 3300025941 Bacteria 28108
113 Ga0207689_10226984 3300025942 Bacteria 1543
114 Ga0207679_10314521 3300025945 Bacteria 1354
115 Ga0207667_10098593 3300025949 Bacteria 3015
116 Ga0207667_10492028 3300025949 Bacteria 1244
117 Ga0207651_10391177 3300025960 Bacteria 1181
118 Ga0207658_10000050 3300025986 Bacteria 129714
119 Ga0207658_10027287 3300025986 Bacteria 4010
120 Ga0207639_10001639 3300026041 Bacteria 15076
121 Ga0207678_10001234 3300026067 Bacteria 23558
122 Ga0207702_11009733 3300026078 Bacteria 825
123 Ga0207648_10059186 3300026089 Bacteria 3341
124 Ga0207674_10092989 3300026116 Bacteria 3005
125 Ga0207698_10428005 3300026142 Bacteria 1272
126 Ga0207698_10865922 3300026142 Bacteria 909
127 Ga0209974_10028878 3300027876 Bacteria 1837
128 Ga0268266_10000001 3300028379 Bacteria 4040580
129 Ga0268266_10638276 3300028379 Bacteria 1024
130 Ga0316180_1038155 3300030736 Bacteria 961
131 Ga0316182_1329806 3300030745 Bacteria 1167
132 Ga0307408_100055557 3300031548 Bacteria 2867
133 Ga0307405_10128661 3300031731 Bacteria 1746
134 Ga0307413_10007974 3300031824 Bacteria 4962
135 Ga0307413_10188144 3300031824 Bacteria 1480
136 Ga0307413_10517893 3300031824 Bacteria 961
137 Ga0307412_10056214 3300031911 Bacteria 2622
138 Ga0307416_100542057 3300032002 Bacteria 1235
139 Ga0307414_10015482 3300032004 Bacteria 4603
140 Ga0307414_10046675 3300032004 Bacteria 2975
141 Ga0307414_10166501 3300032004 Bacteria 1757
142 Ga0307414_10784341 3300032004 Bacteria 868
143 Ga0307411_10215197 3300032005 Bacteria 1487
144 Ga0307415_100782832 3300032126 Bacteria 869
145 Ga0307507_10095478 3300033179 Bacteria 2521
146 Ga0373950_0013221 3300034818 Bacteria 1373
147 Ga0395898_0490270 3300037466 Bacteria 1169
148 Ga0395905_0110072 3300037471 Bacteria 2586
149 Ga0436365_0981243 3300039437 Bacteria 1709
150 Ga0436365_1340318 3300039437 Bacteria 6203
151 Ga0439436_0005772 3300041404 Bacteria 3791
152 Ga0439436_0005945 3300041404 Bacteria 3741
153 Ga0439436_0013854 3300041404 Bacteria 2437
154 Ga0439436_0039637 3300041404 Bacteria 1352
155 Ga0439436_0080152 3300041404 Bacteria 909
156 Ga0439439_0005835 3300041406 Bacteria 2831
157 Ga0439439_0044230 3300041406 Bacteria 1159
158 Ga0439465_0001022 3300041413 Bacteria 8908
159 Ga0451837_1083830 3300041494 Bacteria 1239
160 Ga0439445_0010076 3300042004 Bacteria 2231
161 Ga0439432_007793 3300042006 Bacteria 3776
162 Ga0439432_009398 3300042006 Bacteria 3411
163 Ga0439432_068240 3300042006 Bacteria 1087
164 Ga0439449_0000402 3300042007 Bacteria 16035
165 Ga0439449_0015974 3300042007 Bacteria 2821
166 Ga0439449_0028436 3300042007 Bacteria 2083
167 Ga0439449_0081452 3300042007 Bacteria 1194
168 Ga0439462_0087690 3300042015 Bacteria 852
169 Ga0495663_0040924 3300046525 Bacteria 1409
170 Ga0495598_0000663 3300046537 Bacteria 6522
171 Ga0495621_0003468 3300046539 Bacteria 4352
172 Ga0495656_0008092 3300046615 Bacteria 3743
173 Ga0495656_0063857 3300046615 Bacteria 1615
174 Ga0495656_0120215 3300046615 Bacteria 1239
175 Ga0495659_0034021 3300046664 Bacteria 1790
176 Ga0495636_0002202 3300047318 Bacteria 7481
177 Ga0495615_0012671 3300048090 Bacteria 1744
178 Ga0496100_0581265 3300048903 Bacteria 868
179 Ga0496101_0325766 3300048904 Bacteria 1206
180 Ga0496103_0047931 3300048906 Bacteria 2640
181 Ga0496104_0039443 3300048907 Bacteria 4422
182 Ga0496105_0009026 3300048908 Bacteria 7781
183 Ga0496107_0135758 3300048910 Bacteria 1817
184 Ga0496108_0647339 3300048911 Bacteria 919
185 Ga0496115_0000153 3300048918 Bacteria 64207
186 Ga0496115_0005675 3300048918 Bacteria 9083
187 Ga0496116_0039802 3300048919 Bacteria 3244
188 Ga0496117_0000476 3300048920 Bacteria 66684
189 Ga0496117_0005501 3300048920 Bacteria 13273
190 Ga0496117_0042635 3300048920 Bacteria 3310
191 Ga0496117_0088538 3300048920 Bacteria 2003
192 Ga0496118_0000403 3300048921 Bacteria 72390
193 Ga0496118_0012209 3300048921 Bacteria 8275
194 Ga0496118_0012728 3300048921 Bacteria 8041
195 Ga0496118_0024308 3300048921 Bacteria 5234
196 Ga0496119_0000868 3300048922 Bacteria 39828
197 Ga0496119_0006239 3300048922 Bacteria 11136
198 Ga0496120_0001305 3300048923 Bacteria 30984
199 Ga0496120_0003544 3300048923 Bacteria 14111
200 Ga0496121_0001970 3300048924 Bacteria 32682
201 Ga0496121_0054581 3300048924 Bacteria 3336
202 Ga0496121_0101997 3300048924 Bacteria 2212
203 Ga0496122_0000126 3300048925 Bacteria 178362
204 Ga0496122_0000560 3300048925 Bacteria 76145
205 Ga0496122_0086346 3300048925 Bacteria 2160
206 Ga0496123_0000647 3300048926 Bacteria 58089
207 Ga0496123_0007301 3300048926 Bacteria 10482
208 Ga0496123_0046583 3300048926 Bacteria 2939
209 Ga0496124_0016353 3300048927 Bacteria 7058
210 Ga0496124_0117778 3300048927 Bacteria 2127
211 Ga0496125_0036877 3300048928 Bacteria 4259
212 Ga0496125_0045704 3300048928 Bacteria 3681
213 Ga0496126_0000199 3300048929 Bacteria 133742
214 Ga0496126_0002725 3300048929 Bacteria 23349
215 Ga0496126_0155109 3300048929 Bacteria 1960
216 Ga0496126_0515205 3300048929 Bacteria 954
217 Ga0501031_0001587 3300049568 Bacteria 14184
218 Ga0501031_0106763 3300049568 Bacteria 1828
219 Ga0501032_0020481 3300049569 Bacteria 4605
220 Ga0501033_0044682 3300049570 Bacteria 3297
221 Ga0501034_0002793 3300049571 Bacteria 20426
222 Ga0501034_0488004 3300049571 Bacteria 1147
223 Ga0501036_0033768 3300049572 Bacteria 4327
224 Ga0501037_0004911 3300049573 Bacteria 9732
225 Ga0501038_0019115 3300049574 Bacteria 6178
226 Ga0501039_0066943 3300049575 Bacteria 2789
227 Ga0501043_0090295 3300049579 Bacteria 2408
228 Ga0501043_0096414 3300049579 Unclassified 2324
229 Ga0501046_0000225 3300049580 Bacteria 58907
230 Ga0501047_0001964 3300049581 Bacteria 19745
231 Ga0501047_0294874 3300049581 Bacteria 1465
232 Ga0501048_0153609 3300049582 Bacteria 1628
233 Ga0501070_0160587 3300049586 Bacteria 1853
234 Ga0501070_0227454 3300049586 Bacteria 1529
235 Ga0501073_0029843 3300049589 Bacteria 3896
236 Ga0501044_0039239 3300049823 Bacteria 4940
237 Ga0501044_0091159 3300049823 Bacteria 3074
238 nmdc:mga00v17_370_c1 3300050491 Bacteria 25524
239 Ga0500610_0001511 3300053079 Bacteria 7977
240 Ga0500651_0000691 3300053093 Bacteria 16746
241 Ga0500588_0026075 3300053146 Bacteria 1631
242 2643818739 2643221559 Bacteria 4424915
243 2525555785 2524614729 Bacteria 3091755
244 2572255261 2571042365 Bacteria 3289345
245 2630650799 2627854209 Bacteria 3093011
246 2643878393 2643221573 Bacteria 4784121
247 2643940990 2643221586 Bacteria 4446529
248 2644079968 2643221612 Bacteria 4361984
249 2644529956 2643221695 Bacteria 3441323
250 2644659697 2643221720 Bacteria 4694283
251 2644695563 2643221727 Bacteria 4415595
252 2644700558 2643221728 Bacteria 4797149
253 2939591272 2939589442 Bacteria 4214238
254 2974308078 2974307012 Bacteria 4172388
255 2977248810 2977247770 Bacteria 4160543
256 2984516715 2984514374 Bacteria 4172479
257 2987608303 2987605356 Bacteria 4187822
258 8003016307 8003014200 Bacteria 4059994
259 rootH2_10016448
260 Ga0055537_1000306
261 Ga0055524_1004882
262 Ga0055524_1009915
263 Ga0055536_1001400
264 Ga0055536_1008916
265 Ga0055536_1028530
266 Ga0055534_1000388
267 Ga0055528_1000867
268 Ga0055528_1001434
269 Ga0055530_10002733
270 Ga0055531_10002202
271 Ga0055531_10006458
272 Ga0055531_10008163
273 Ga0055531_10014542
274 Ga0055531_10021811
275 Ga0065715_10029858
276 Ga0065715_10091456
277 Ga0068869_100079355
278 Ga0068868_100075928
279 Ga0070661_100097116
280 Ga0070692_10376986
281 Ga0070669_100182545
282 Ga0070701_10119625
283 Ga0070663_100000372
284 Ga0068867_100147099
285 Ga0068853_100000696
286 Ga0068853_100032825
287 Ga0068853_100203281
288 Ga0070672_100011466
289 Ga0070672_100015298
290 Ga0070665_100000512
291 Ga0070665_100036244
292 Ga0068855_100058777
293 Ga0068855_100509613
294 Ga0068856_100359665
295 Ga0068852_100203095
296 Ga0068852_100617783
297 Ga0068852_100622474
298 Ga0068852_100622555
299 Ga0068858_100068485
300 Ga0075364_10000037
301 Ga0105240_10009014
302 Ga0105240_10010222
303 Ga0105240_10016314
304 Ga0105243_10411820
305 Ga0105248_10000457
306 Ga0105248_10012880
307 Ga0105237_10002511
308 Ga0105249_10000707
309 Ga0105239_10000022
310 Ga0105239_10009236
311 Ga0105239_10038993
312 Ga0105239_10420643
313 Ga0157371_10059313
314 Ga0157370_10176966
315 Ga0157374_10117148
316 Ga0157378_10030199
317 Ga0157375_10003676
318 Ga0157375_10077337
319 Ga0182008_10014100
320 Ga0157376_10052237
321 Ga0163161_10028216
322 Ga0207425_1012348
323 Ga0209565_1000119
324 Ga0209673_1000866
325 Ga0209673_1047029
326 Ga0209675_1000048
327 Ga0209675_1005300
328 Ga0209675_1015067
329 Ga0209676_1000472
330 Ga0209676_1000857
331 Ga0209676_1001048
332 Ga0209676_1002293
333 Ga0209676_1006272
334 Ga0209676_1006491
335 Ga0209676_1006984
336 Ga0209025_1001267
337 Ga0209025_1013136
338 Ga0209025_1035573
339 Ga0209025_1036704
340 Ga0209025_1068668
341 Ga0209564_1000106
342 Ga0209564_1012188
343 Ga0209564_1014645
344 Ga0209758_1025359
345 Ga0209050_1001432
346 Ga0209050_1033487
347 Ga0209256_1001506
348 Ga0209256_1004781
349 Ga0209256_1007727
350 Ga0209051_1007281
351 Ga0209051_1034679
352 Ga0209257_1000255
353 Ga0209257_1000715
354 Ga0209257_1001117
355 Ga0209257_1003071
356 Ga0209257_1003627
357 Ga0209257_1026561
358 Ga0209257_1028262
359 Ga0207695_10005349
360 Ga0207695_10008040
361 Ga0207695_10012767
362 Ga0207671_10004702
363 Ga0207652_10342170
364 Ga0207681_10025235
365 Ga0207659_10211204
366 Ga0207644_10364660
367 Ga0207709_10304921
368 Ga0207691_10003987
369 Ga0207691_10027247
370 Ga0207711_10000938
371 Ga0207689_10226984
372 Ga0207679_10314521
373 Ga0207667_10098593
374 Ga0207667_10492028
375 Ga0207651_10391177
376 Ga0207658_10000050
377 Ga0207658_10027287
378 Ga0207639_10001639
379 Ga0207678_10001234
380 Ga0207702_11009733
381 Ga0207648_10059186
382 Ga0207674_10092989
383 Ga0207698_10428005
384 Ga0207698_10865922
385 Ga0209974_10028878
386 Ga0268266_10000001
387 Ga0268266_10638276
388 Ga0316180_1038155
389 Ga0316182_1329806
390 Ga0307408_100055557
391 Ga0307405_10128661
392 Ga0307413_10007974
393 Ga0307413_10188144
394 Ga0307413_10517893
395 Ga0307412_10056214
396 Ga0307416_100542057
397 Ga0307414_10015482
398 Ga0307414_10046675
399 Ga0307414_10166501
400 Ga0307414_10784341
401 Ga0307411_10215197
402 Ga0307415_100782832
403 Ga0307507_10095478
404 Ga0373950_0013221
405 Ga0395898_0490270
406 Ga0395905_0110072
407 Ga0436365_0981243
408 Ga0436365_1340318
409 Ga0439436_0005772
410 Ga0439436_0005945
411 Ga0439436_0013854
412 Ga0439436_0039637
413 Ga0439436_0080152
414 Ga0439439_0005835
415 Ga0439439_0044230
416 Ga0439465_0001022
417 Ga0451837_1083830
418 Ga0439445_0010076
419 Ga0439432_007793
420 Ga0439432_009398
421 Ga0439432_068240
422 Ga0439449_0000402
423 Ga0439449_0015974
424 Ga0439449_0028436
425 Ga0439449_0081452
426 Ga0439462_0087690
427 Ga0495663_0040924
428 Ga0495598_0000663
429 Ga0495621_0003468
430 Ga0495656_0008092
431 Ga0495656_0063857
432 Ga0495656_0120215
433 Ga0495659_0034021
434 Ga0495636_0002202
435 Ga0495615_0012671
436 Ga0496100_0581265
437 Ga0496101_0325766
438 Ga0496103_0047931
439 Ga0496104_0039443
440 Ga0496105_0009026
441 Ga0496107_0135758
442 Ga0496108_0647339
443 Ga0496115_0000153
444 Ga0496115_0005675
445 Ga0496116_0039802
446 Ga0496117_0000476
447 Ga0496117_0005501
448 Ga0496117_0042635
449 Ga0496117_0088538
450 Ga0496118_0000403
451 Ga0496118_0012209
452 Ga0496118_0012728
453 Ga0496118_0024308
454 Ga0496119_0000868
455 Ga0496119_0006239
456 Ga0496120_0001305
457 Ga0496120_0003544
458 Ga0496121_0001970
459 Ga0496121_0054581
460 Ga0496121_0101997
461 Ga0496122_0000126
462 Ga0496122_0000560
463 Ga0496122_0086346
464 Ga0496123_0000647
465 Ga0496123_0007301
466 Ga0496123_0046583
467 Ga0496124_0016353
468 Ga0496124_0117778
469 Ga0496125_0036877
470 Ga0496125_0045704
471 Ga0496126_0000199
472 Ga0496126_0002725
473 Ga0496126_0155109
474 Ga0496126_0515205
475 Ga0501031_0001587
476 Ga0501031_0106763
477 Ga0501032_0020481
478 Ga0501033_0044682
479 Ga0501034_0002793
480 Ga0501034_0488004
481 Ga0501036_0033768
482 Ga0501037_0004911
483 Ga0501038_0019115
484 Ga0501039_0066943
485 Ga0501043_0090295
486 Ga0501043_0096414
487 Ga0501046_0000225
488 Ga0501047_0001964
489 Ga0501047_0294874
490 Ga0501048_0153609
491 Ga0501070_0160587
492 Ga0501070_0227454
493 Ga0501073_0029843
494 Ga0501044_0039239
495 Ga0501044_0091159
496 nmdc:mga00v17_370_c1
497 Ga0500610_0001511
498 Ga0500651_0000691
499 Ga0500588_0026075
500 2643818739
501 2525555785
502 2572255261
503 2630650799
504 2643878393
505 2643940990
506 2644079968
507 2644529956
508 2644659697
509 2644695563
510 2644700558
511 2939591272
512 2974308078
513 2977248810
514 2984516715
515 2987608303
516 8003016307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11967

RecO_N

Recombination protein O N terminal

1

76

0.94

PF02565

RecO_C

Recombination protein O C terminal

78

227

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.9247 6 232
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.9017 6 232
7ymo-assembly1.cif.gz_A crystal structure of the recombination mediator protein reco from campylobacter jejuni 0.7604 3 213
7ymo-assembly1.cif.gz_A crystal structure of the recombination mediator protein reco from campylobacter jejuni 0.7509 3 213
1u5k-assembly1.cif.gz_B recombinational repair protein reco 0.7431 2 228
ID Description Score Start End Superfamily
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9091 3 82 2.40.50.140
af_P0A7H3_79_242_1.20.1440.120 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Recombination protein O, C-terminal domain 0.8997 83 232 1.20.1440.120
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8981 3 82 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8824 1 81 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8234 1 81 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1G3F5S8-F1-model_v4 DNA repair protein RecO 0.9807 63 235 GO:0006302
GO:0006310
GO:0043590
AF-A0A0G9HJN1-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9794 1 230 GO:0006302
GO:0006310
GO:0043590
AF-A0A0G9HJN1-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.971 1 230 GO:0006302
GO:0006310
GO:0043590
AF-A0A3D3S8E5-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9613 1 234 GO:0006302
GO:0006310
GO:0043590
AF-A0A534AGH9-F1-model_v4 DNA repair protein RecO 0.9609 52 237 GO:0006302
GO:0006310
GO:0043590

Map