F368476

General Info

Members Datasets Scaffolds Average Seq Length
258 188 239 360

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876813258
Length 432
Sequence VLNAFGSPLAIENVPDPLLGTGEVIIDVVASRVLAYANEVLSGERKYLLELPVVPGPGAIGRIRATGPDATRLRPGDWVYCDPTVRSRDNALSPDIALQGLTAGSEGGLRLQRYFHDGAWAEQMRLPTENAVSIGDIDEKDAGRWCALGTLLVPYGGFLAVQLQAGEIALVNGATGSFGSAAVAVALAMGAQCVIATGRNEQALTELTRRFGARVRTVPMRGDEADDRARILQAAPGPIDCVLDILPPVASAVQVRTAVLAVRPHGRVVLMGGVGMQGGAGLDLPYPWMMRNGITLRGQWMYPPHAAILMAGLIRAGLVDLDHFEIAAFGLDRANEAVAHAAAHSGXXXXXXXXXXXXXXXXXXXXXXDPAAIGPAACWRSGADDVADDVMDFERLVDLGEPFGAVGGAAAAALVERQXXXXATGWSLLRAP

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
7 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
8 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
9 2855730933 Achromobacter sp. HZ28 Isolate Nodule
10 2855767633 Achromobacter sp. HZ34 Isolate Nodule
11 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
12 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
13 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
14 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
15 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
16 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
17 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
18 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
182 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
185 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
186 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
187 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
188 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.64
Metatranscriptomes 0
Isolates 7.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.83
Nodule 4.26
Rhizoplane 2.71
Rhizosphere 62.4
Stem 0
Stem Tuber 0
Unclassified 12.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000549 3300003215 Bacteria 23413
2 rootH1_10039163 3300003316 Bacteria 15334
3 rootH1_10160845 3300003323 Bacteria 3226
4 Ga0055532_1000276 3300003758 Bacteria 33326
5 Ga0055527_1003642 3300003760 Bacteria 2240
6 Ga0055535_1000172 3300003761 Bacteria 69740
7 Ga0055542_1000219 3300003762 Bacteria 69781
8 Ga0055529_1000235 3300003763 Bacteria 69781
9 Ga0058692_1002555 3300003856 Bacteria 6023
10 Ga0058692_1013940 3300003856 Bacteria 1856
11 Ga0055543_1008580 3300004625 Bacteria 2254
12 Ga0065165_1000779 3300005262 Bacteria 42728
13 Ga0070670_100257475 3300005331 Bacteria 1521
14 Ga0068869_100022285 3300005334 Bacteria 4363
15 Ga0068869_100056145 3300005334 Bacteria 2871
16 Ga0068869_100169554 3300005334 Bacteria 1704
17 Ga0070666_10137113 3300005335 Bacteria 1703
18 Ga0070689_100054568 3300005340 Bacteria 3094
19 Ga0070674_100302896 3300005356 Bacteria 1275
20 Ga0070714_100038353 3300005435 Bacteria 4028
21 Ga0070663_100087529 3300005455 Bacteria 2302
22 Ga0070678_100036617 3300005456 Bacteria 3436
23 Ga0070681_10052065 3300005458 Bacteria 4083
24 Ga0070706_100120474 3300005467 Bacteria 2446
25 Ga0068853_100114567 3300005539 Bacteria 2398
26 Ga0070665_100062371 3300005548 Bacteria 3738
27 Ga0070665_100313979 3300005548 Bacteria 1571
28 Ga0068855_100019654 3300005563 Bacteria 8112
29 Ga0068854_100033465 3300005578 Bacteria 3584
30 Ga0068856_100000223 3300005614 Bacteria 61437
31 Ga0068856_100024184 3300005614 Bacteria 5910
32 Ga0068856_100050757 3300005614 Bacteria 4089
33 Ga0068852_100265869 3300005616 Bacteria 1649
34 Ga0068859_100059219 3300005617 Bacteria 3858
35 Ga0068864_100016299 3300005618 Bacteria 6186
36 Ga0068861_100101262 3300005719 Bacteria 2291
37 Ga0068861_100404983 3300005719 Bacteria 1212
38 Ga0068863_100108539 3300005841 Bacteria 2641
39 Ga0068863_100299359 3300005841 Bacteria 1560
40 Ga0068858_100018333 3300005842 Bacteria 6554
41 Ga0068858_100051823 3300005842 Bacteria 3797
42 Ga0068860_100241415 3300005843 Bacteria 1757
43 Ga0081455_10007271 3300005937 Bacteria 11685
44 Ga0081455_10007953 3300005937 Bacteria 11090
45 Ga0081455_10069950 3300005937 Bacteria 2916
46 Ga0081540_1001309 3300005983 Bacteria 21732
47 Ga0081540_1007690 3300005983 Bacteria 7641
48 Ga0081540_1011824 3300005983 Bacteria 5800
49 Ga0081539_10068922 3300005985 Bacteria 1906
50 Ga0081539_10097753 3300005985 Bacteria 1503
51 Ga0070717_10033558 3300006028 Bacteria 4141
52 Ga0075365_10031906 3300006038 Bacteria 3383
53 Ga0075365_10061903 3300006038 Bacteria 2501
54 Ga0075368_10008163 3300006042 Bacteria 3719
55 Ga0075363_100000880 3300006048 Bacteria 10553
56 Ga0075363_100033735 3300006048 Bacteria 2668
57 Ga0075364_10009208 3300006051 Bacteria 5918
58 Ga0075367_10015848 3300006178 Bacteria 4106
59 Ga0075367_10020665 3300006178 Bacteria 3670
60 Ga0075369_10078319 3300006186 Bacteria 1463
61 Ga0075370_10031920 3300006353 Bacteria 2942
62 Ga0075370_10110918 3300006353 Bacteria 1593
63 Ga0075370_10122992 3300006353 Bacteria 1512
64 Ga0075433_10328472 3300006852 Bacteria 1353
65 Ga0075434_100079758 3300006871 Bacteria 3270
66 Ga0097620_100059220 3300006931 Bacteria 3858
67 Ga0075435_100022886 3300007076 Bacteria 4824
68 Ga0105240_10000005 3300009093 Bacteria 702630
69 Ga0105240_10109552 3300009093 Bacteria 3344
70 Ga0105245_10051742 3300009098 Bacteria 3682
71 Ga0105247_10201753 3300009101 Bacteria 1337
72 Ga0105241_10010905 3300009174 Bacteria 6667
73 Ga0105241_10028160 3300009174 Bacteria 4185
74 Ga0105248_10053320 3300009177 Bacteria 4538
75 Ga0105248_10072957 3300009177 Bacteria 3858
76 Ga0105237_10045179 3300009545 Bacteria 4434
77 Ga0105237_10065589 3300009545 Bacteria 3627
78 Ga0105238_10087204 3300009551 Bacteria 3108
79 Ga0105239_10002672 3300010375 Bacteria 22471
80 Ga0105239_10023031 3300010375 Bacteria 6866
81 Ga0105239_10087454 3300010375 Bacteria 3435
82 Ga0105239_10510037 3300010375 Bacteria 1368
83 Ga0157370_10000163 3300013104 Bacteria 81428
84 Ga0157372_10254547 3300013307 Bacteria 2038
85 Ga0157379_10112641 3300014968 Bacteria 2445
86 Ga0213875_10000800 3300021388 Bacteria 23523
87 Ga0209672_100030 3300025228 Bacteria 337051
88 Ga0209147_100036 3300025229 Bacteria 337052
89 Ga0209258_100056 3300025242 Bacteria 337051
90 Ga0209026_1000535 3300025250 Bacteria 26193
91 Ga0209148_1000105 3300025254 Bacteria 210795
92 Ga0209148_1000155 3300025254 Bacteria 143807
93 Ga0209565_1026159 3300025263 Bacteria 1173
94 Ga0209455_1000061 3300025272 Bacteria 337052
95 Ga0209455_1003131 3300025272 Bacteria 6024
96 Ga0209673_1000108 3300025273 Bacteria 183732
97 Ga0209758_1001732 3300025297 Bacteria 24300
98 Ga0209257_1009538 3300025304 Bacteria 5161
99 Ga0207688_10012904 3300025901 Bacteria 4542
100 Ga0207680_10094884 3300025903 Bacteria 1905
101 Ga0207647_10007950 3300025904 Bacteria 7624
102 Ga0207647_10040059 3300025904 Bacteria 2952
103 Ga0207645_10149084 3300025907 Bacteria 1526
104 Ga0207643_10041215 3300025908 Bacteria 2602
105 Ga0207643_10081680 3300025908 Bacteria 1873
106 Ga0207705_10321293 3300025909 Bacteria 1189
107 Ga0207654_10011101 3300025911 Bacteria 4584
108 Ga0207654_10036655 3300025911 Bacteria 2742
109 Ga0207695_10000011 3300025913 Bacteria 910221
110 Ga0207695_10017177 3300025913 Bacteria 8433
111 Ga0207695_10203500 3300025913 Bacteria 1893
112 Ga0207671_10002302 3300025914 Bacteria 20628
113 Ga0207671_10093760 3300025914 Bacteria 2265
114 Ga0207649_10157811 3300025920 Bacteria 1569
115 Ga0207694_10004185 3300025924 Bacteria 11320
116 Ga0207694_10254335 3300025924 Bacteria 1438
117 Ga0207687_10141132 3300025927 Bacteria 1828
118 Ga0207691_10119678 3300025940 Bacteria 2335
119 Ga0207711_10221546 3300025941 Bacteria 1730
120 Ga0207689_10079187 3300025942 Bacteria 2701
121 Ga0207667_10007333 3300025949 Bacteria 13274
122 Ga0207667_10016189 3300025949 Bacteria 8430
123 Ga0207668_10050098 3300025972 Bacteria 2875
124 Ga0207668_10099734 3300025972 Bacteria 2155
125 Ga0207640_10273666 3300025981 Bacteria 1322
126 Ga0207703_10029106 3300026035 Bacteria 4357
127 Ga0207639_10037132 3300026041 Bacteria 3617
128 Ga0207678_10118823 3300026067 Bacteria 2256
129 Ga0207678_10243684 3300026067 Bacteria 1539
130 Ga0207702_10000252 3300026078 Bacteria 62099
131 Ga0207702_10067760 3300026078 Bacteria 3064
132 Ga0207675_100050867 3300026118 Bacteria 3867
133 Ga0207675_100064738 3300026118 Bacteria 3417
134 Ga0207675_100338403 3300026118 Bacteria 1473
135 Ga0207675_100441910 3300026118 Bacteria 1287
136 Ga0207683_10103145 3300026121 Bacteria 2547
137 Ga0207698_10228210 3300026142 Bacteria 1688
138 Ga0209371_1000017 3300027312 Bacteria 625776
139 Ga0209371_1000103 3300027312 Bacteria 149486
140 Ga0209371_1000387 3300027312 Bacteria 46537
141 Ga0209371_1005939 3300027312 Bacteria 4689
142 Ga0209371_1006357 3300027312 Bacteria 4391
143 Ga0268266_10004455 3300028379 Bacteria 13397
144 Ga0268266_10006881 3300028379 Bacteria 10350
145 Ga0268266_10011633 3300028379 Bacteria 7640
146 Ga0268266_10253482 3300028379 Bacteria 1628
147 Ga0268265_10086486 3300028380 Bacteria 2491
148 Ga0268264_10229040 3300028381 Bacteria 1715
149 Ga0307517_10000369 3300028786 Bacteria 77795
150 Ga0307517_10163380 3300028786 Bacteria 1487
151 Ga0307515_10023324 3300028794 Bacteria 10849
152 Ga0268256_1000036 3300030500 Bacteria 370250
153 Ga0268256_1000119 3300030500 Bacteria 114623
154 Ga0268256_1000420 3300030500 Bacteria 38284
155 Ga0268256_1006904 3300030500 Bacteria 4144
156 Ga0265325_10001590 3300031241 Bacteria 15835
157 Ga0265339_10002393 3300031249 Bacteria 13463
158 Ga0265316_10027614 3300031344 Bacteria 4695
159 Ga0307408_100276472 3300031548 Bacteria 1397
160 Ga0265313_10001032 3300031595 Bacteria 27079
161 Ga0307508_10028978 3300031616 Bacteria 5005
162 Ga0265314_10008285 3300031711 Bacteria 8920
163 Ga0307412_10201150 3300031911 Bacteria 1513
164 Ga0307409_100116193 3300031995 Bacteria 2254
165 Ga0307416_100301562 3300032002 Bacteria 1593
166 Ga0307510_10006740 3300033180 Bacteria 13693
167 Ga0307510_10212885 3300033180 Bacteria 1453
168 Ga0395899_0000065 3300037312 Bacteria 205510
169 Ga0395900_0000339 3300037418 Bacteria 69082
170 Ga0395898_0000565 3300037466 Bacteria 69082
171 Ga0395898_0027365 3300037466 Bacteria 5726
172 Ga0395905_0033714 3300037471 Bacteria 4809
173 Ga0436364_1005383 3300037853 Bacteria 2674
174 Ga0436364_1562947 3300037853 Bacteria 33891
175 Ga0436365_0962981 3300039437 Bacteria 2474
176 Ga0436361_0507638 3300039447 Bacteria 3347
177 Ga0451789_1234897 3300041443 Bacteria 1779
178 Ga0439463_001270 3300042016 Bacteria 6743
179 Ga0466966_0011372 3300044684 Bacteria 5903
180 Ga0466970_0003795 3300044765 Bacteria 7399
181 Ga0466958_0002400 3300045836 Bacteria 9382
182 Ga0495603_0142249 3300046455 Bacteria 1395
183 Ga0495629_0122793 3300046459 Bacteria 1809
184 Ga0495638_0099062 3300046460 Bacteria 1745
185 Ga0495639_0032155 3300046475 Bacteria 2339
186 Ga0495639_0112163 3300046475 Bacteria 1295
187 Ga0495607_0119492 3300046501 Bacteria 1386
188 Ga0495583_0022742 3300046506 Bacteria 3189
189 Ga0495616_0089099 3300046513 Bacteria 1464
190 Ga0495632_0077131 3300046519 Bacteria 1593
191 Ga0495632_0111198 3300046519 Bacteria 1286
192 Ga0495644_0042001 3300046523 Bacteria 1722
193 Ga0495625_0179850 3300046660 Bacteria 1407
194 Ga0495635_0138354 3300046663 Bacteria 1659
195 Ga0495661_0100831 3300046665 Bacteria 1625
196 Ga0495588_0009550 3300046674 Bacteria 4488
197 Ga0495669_0060812 3300046684 Bacteria 1708
198 Ga0495683_0111300 3300047323 Bacteria 1307
199 Ga0495686_0031719 3300047472 Unclassified 3423
200 Ga0496102_0052218 3300048905 Bacteria 3724
201 Ga0496103_0004703 3300048906 Bacteria 8261
202 Ga0496106_0055551 3300048909 Bacteria 2993
203 Ga0496109_0125588 3300048912 Bacteria 2392
204 Ga0496113_0248453 3300048916 Unclassified 1420
205 Ga0496117_0024118 3300048920 Bacteria 4822
206 Ga0496118_0000378 3300048921 Bacteria 74801
207 Ga0496121_0000616 3300048924 Bacteria 66339
208 Ga0496121_0031651 3300048924 Bacteria 4828
209 Ga0496121_0074918 3300048924 Bacteria 2705
210 Ga0496121_0079103 3300048924 Bacteria 2611
211 Ga0496121_0211532 3300048924 Bacteria 1373
212 Ga0496122_0001717 3300048925 Bacteria 33994
213 Ga0496122_0136796 3300048925 Bacteria 1542
214 Ga0496123_0000211 3300048926 Bacteria 118697
215 Ga0496124_0001697 3300048927 Bacteria 31139
216 Ga0496124_0025173 3300048927 Bacteria 5395
217 Ga0496125_0005040 3300048928 Bacteria 14904
218 Ga0496125_0084824 3300048928 Bacteria 2403
219 Ga0496126_0004475 3300048929 Bacteria 16682
220 Ga0496126_0104782 3300048929 Bacteria 2470
221 Ga0496126_0205621 3300048929 Bacteria 1660
222 Ga0496126_0234832 3300048929 Bacteria 1534
223 Ga0501067_0016488 3300049583 Bacteria 4082
224 nmdc:mga03n38_2163_c1 3300050490 Bacteria 5983
225 nmdc:mga03n38_74018_c1 3300050490 Bacteria 1583
226 nmdc:mga00v17_63066_c1 3300050491 Bacteria 2282
227 nmdc:mga06z11_9282_c1 3300050494 Bacteria 4139
228 nmdc:mga06r32_440962_c1 3300050510 Bacteria 1282
229 Ga0500641_0028712 3300053096 Bacteria 2174
230 Ga0500554_010878 3300053102 Bacteria 2235
231 Ga0500595_002327 3300053119 Bacteria 9499
232 Ga0500595_017961 3300053119 Bacteria 2597
233 Ga0500655_019392 3300053133 Bacteria 1267
234 Ga0500590_110836 3300053148 Bacteria 1302
235 Ga0500622_0045681 3300053156 Bacteria 2267
236 Ga0500627_0081571 3300053158 Bacteria 1442
237 Ga0500638_019715 3300053162 Bacteria 3165
238 Ga0500637_0001603 3300053178 Bacteria 9697
239 Ga0500552_000109 3300053733 Bacteria 6937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0022742 Ga0495583_0022742_620_1717 341
2 3300004625 Ga0055543_1008580 Ga0055543_10085803 342
3 3300005262 Ga0065165_1000779 Ga0065165_10007795 342
4 3300003316 rootH1_10039163 rootH1_100391638 343
5 3300003323 rootH1_10160845 rootH1_101608452 343
6 3300025250 Ga0209026_1000535 Ga0209026_10005356 345
7 3300048905 Ga0496102_0052218 Ga0496102_0052218_1218_2297 348
8 3300048906 Ga0496103_0004703 Ga0496103_0004703_493_1572 348
9 3300048920 Ga0496117_0024118 Ga0496117_0024118_14_1093 348
10 3300048921 Ga0496118_0000378 Ga0496118_0000378_10240_11319 348
11 3300005842 Ga0068858_100051823 Ga0068858_1000518235 349
12 3300027312 Ga0209371_1000387 Ga0209371_100038739 349
13 3300030500 Ga0268256_1000420 Ga0268256_10004205 349
14 3300009093 Ga0105240_10000005 Ga0105240_10000005150 350
15 3300013104 Ga0157370_10000163 Ga0157370_1000016376 350
16 3300025913 Ga0207695_10000011 Ga0207695_10000011765 350
17 3300048924 Ga0496121_0031651 Ga0496121_0031651_1517_2602 350
18 3300048925 Ga0496122_0136796 Ga0496122_0136796_46_1146 350
19 iso_pu_bacteria 2917736166 2917736484 350
20 3300010375 Ga0105239_10002672 Ga0105239_1000267215 351
21 3300046475 Ga0495639_0112163 Ga0495639_0112163_123_1214 351
22 3300048916 Ga0496113_0248453 Ga0496113_0248453_60_1160 351
23 3300048925 Ga0496122_0001717 Ga0496122_0001717_12145_13245 351
24 3300048926 Ga0496123_0000211 Ga0496123_0000211_12305_13405 351
25 3300048927 Ga0496124_0001697 Ga0496124_0001697_8249_9349 351
26 3300048928 Ga0496125_0005040 Ga0496125_0005040_163_1281 351
27 3300053096 Ga0500641_0028712 Ga0500641_0028712_252_1337 351
28 3300005983 Ga0081540_1007690 Ga0081540_10076905 352
29 iso_pu_bacteria 2922386360 2922392184 352
30 3300025924 Ga0207694_10254335 Ga0207694_102543352 353
31 3300050490 nmdc:mga03n38_74018_c1 nmdc:mga03n38_74018_c1_255_1340 353
32 3300037312 Ga0395899_0000065 Ga0395899_0000065_21337_22428 354
33 3300037418 Ga0395900_0000339 Ga0395900_0000339_21337_22428 354
34 3300037466 Ga0395898_0000565 Ga0395898_0000565_46655_47746 354
35 3300031241 Ga0265325_10001590 Ga0265325_100015907 355
36 3300031249 Ga0265339_10002393 Ga0265339_1000239314 355
37 3300031344 Ga0265316_10027614 Ga0265316_100276145 355
38 3300031595 Ga0265313_10001032 Ga0265313_1000103222 355
39 3300046519 Ga0495632_0111198 Ga0495632_0111198_15_1082 355
40 iso_pu_bacteria 2513237141 2513892745 355
41 iso_pu_bacteria 2599185307 2599973262 355
42 iso_pu_bacteria 2808606384 2808972772 355
43 iso_pu_bacteria 2808606390 2809007754 355
44 iso_pu_bacteria 2808606391 2809014706 355
45 iso_pu_bacteria 2855730933 2855736227 355
46 iso_pu_bacteria 2855767633 2855773164 355
47 iso_pu_bacteria 2863421361 2863423303 355
48 3300005985 Ga0081539_10097753 Ga0081539_100977531 356
49 3300025304 Ga0209257_1009538 Ga0209257_10095382 356
50 3300044684 Ga0466966_0011372 Ga0466966_0011372_3629_4702 356
51 3300044765 Ga0466970_0003795 Ga0466970_0003795_2046_3119 356
52 3300049583 Ga0501067_0016488 Ga0501067_0016488_1477_2547 356
53 iso_pu_bacteria 2513237101 2513691603 356
54 iso_pu_bacteria 2524023210 2524467641 356
55 iso_pu_bacteria 2721755755 2723845970 356
56 iso_pu_bacteria 2874604998 2874609368 356
57 iso_pu_bacteria 2876808645 2876813258 356
58 iso_pu_bacteria 2879110137 2879110414 356
59 iso_pu_bacteria 2922361189 2922367929 356
60 iso_pu_bacteria 8006964411 8006968756 356
61 3300005937 Ga0081455_10007953 Ga0081455_100079535 357
62 3300021388 Ga0213875_10000800 Ga0213875_1000080011 357
63 3300037853 Ga0436364_1562947 Ga0436364_1562947_12939_14012 357
64 iso_pu_bacteria 2939602548 2939606423 357
65 3300003758 Ga0055532_1000276 Ga0055532_100027632 359
66 3300003760 Ga0055527_1003642 Ga0055527_10036422 359
67 3300003761 Ga0055535_1000172 Ga0055535_100017243 359
68 3300003762 Ga0055542_1000219 Ga0055542_100021944 359
69 3300003763 Ga0055529_1000235 Ga0055529_100023544 359
70 3300003856 Ga0058692_1002555 Ga0058692_10025556 359
71 3300003856 Ga0058692_1013940 Ga0058692_10139401 359
72 3300005435 Ga0070714_100038353 Ga0070714_1000383533 359
73 3300005458 Ga0070681_10052065 Ga0070681_100520652 359
74 3300005467 Ga0070706_100120474 Ga0070706_1001204741 359
75 3300005539 Ga0068853_100114567 Ga0068853_1001145672 359
76 3300005614 Ga0068856_100000223 Ga0068856_10000022348 359
77 3300005841 Ga0068863_100299359 Ga0068863_1002993592 359
78 3300005937 Ga0081455_10007271 Ga0081455_100072718 359
79 3300005985 Ga0081539_10068922 Ga0081539_100689222 359
80 3300006028 Ga0070717_10033558 Ga0070717_100335582 359
81 3300006038 Ga0075365_10061903 Ga0075365_100619033 359
82 3300013307 Ga0157372_10254547 Ga0157372_102545471 359
83 3300025228 Ga0209672_100030 Ga0209672_100030115 359
84 3300025229 Ga0209147_100036 Ga0209147_100036224 359
85 3300025242 Ga0209258_100056 Ga0209258_100056115 359
86 3300025254 Ga0209148_1000105 Ga0209148_1000105114 359
87 3300025254 Ga0209148_1000155 Ga0209148_100015593 359
88 3300025263 Ga0209565_1026159 Ga0209565_10261591 359
89 3300025272 Ga0209455_1000061 Ga0209455_1000061224 359
90 3300025272 Ga0209455_1003131 Ga0209455_10031314 359
91 3300025273 Ga0209673_1000108 Ga0209673_100010861 359
92 3300025297 Ga0209758_1001732 Ga0209758_100173214 359
93 3300025909 Ga0207705_10321293 Ga0207705_103212931 359
94 3300025911 Ga0207654_10036655 Ga0207654_100366552 359
95 3300025913 Ga0207695_10203500 Ga0207695_102035001 359
96 3300025949 Ga0207667_10007333 Ga0207667_100073339 359
97 3300026067 Ga0207678_10243684 Ga0207678_102436841 359
98 3300026078 Ga0207702_10000252 Ga0207702_1000025225 359
99 3300027312 Ga0209371_1000017 Ga0209371_100001736 359
100 3300027312 Ga0209371_1000103 Ga0209371_100010325 359
101 3300027312 Ga0209371_1005939 Ga0209371_10059398 359
102 3300027312 Ga0209371_1006357 Ga0209371_10063572 359
103 3300030500 Ga0268256_1000036 Ga0268256_1000036100 359
104 3300030500 Ga0268256_1000119 Ga0268256_100011963 359
105 3300030500 Ga0268256_1006904 Ga0268256_10069041 359
106 3300031711 Ga0265314_10008285 Ga0265314_100082855 359
107 3300037466 Ga0395898_0027365 Ga0395898_0027365_2975_4090 359
108 3300037471 Ga0395905_0033714 Ga0395905_0033714_1585_2664 359
109 3300037853 Ga0436364_1005383 Ga0436364_1005383_1482_2561 359
110 3300039437 Ga0436365_0962981 Ga0436365_0962981_1043_2122 359
111 3300042016 Ga0439463_001270 Ga0439463_001270_4509_5594 359
112 3300046513 Ga0495616_0089099 Ga0495616_0089099_200_1282 359
113 3300046665 Ga0495661_0100831 Ga0495661_0100831_99_1181 359
114 3300048924 Ga0496121_0000616 Ga0496121_0000616_50234_51313 359
115 3300048924 Ga0496121_0211532 Ga0496121_0211532_110_1189 359
116 3300048929 Ga0496126_0234832 Ga0496126_0234832_245_1324 359
117 3300053102 Ga0500554_010878 Ga0500554_010878_94_1173 359
118 3300053119 Ga0500595_002327 Ga0500595_002327_8062_9141 359
119 3300053162 Ga0500638_019715 Ga0500638_019715_574_1653 359
120 3300053178 Ga0500637_0001603 Ga0500637_0001603_7946_9025 359
121 3300053733 Ga0500552_000109 Ga0500552_000109_270_1349 359
122 3300003215 JGI25153J46596_10000549 JGI25153J46596_1000054912 360
123 3300005331 Ga0070670_100257475 Ga0070670_1002574751 360
124 3300005334 Ga0068869_100022285 Ga0068869_1000222851 360
125 3300005334 Ga0068869_100056145 Ga0068869_1000561452 360
126 3300005334 Ga0068869_100169554 Ga0068869_1001695542 360
127 3300005335 Ga0070666_10137113 Ga0070666_101371132 360
128 3300005340 Ga0070689_100054568 Ga0070689_1000545683 360
129 3300005356 Ga0070674_100302896 Ga0070674_1003028961 360
130 3300005455 Ga0070663_100087529 Ga0070663_1000875291 360
131 3300005456 Ga0070678_100036617 Ga0070678_1000366173 360
132 3300005548 Ga0070665_100062371 Ga0070665_1000623713 360
133 3300005548 Ga0070665_100313979 Ga0070665_1003139791 360
134 3300005563 Ga0068855_100019654 Ga0068855_1000196542 360
135 3300005578 Ga0068854_100033465 Ga0068854_1000334654 360
136 3300005614 Ga0068856_100024184 Ga0068856_1000241842 360
137 3300005614 Ga0068856_100050757 Ga0068856_1000507574 360
138 3300005616 Ga0068852_100265869 Ga0068852_1002658692 360
139 3300005617 Ga0068859_100059219 Ga0068859_1000592192 360
140 3300005618 Ga0068864_100016299 Ga0068864_1000162992 360
141 3300005719 Ga0068861_100101262 Ga0068861_1001012622 360
142 3300005719 Ga0068861_100404983 Ga0068861_1004049831 360
143 3300005841 Ga0068863_100108539 Ga0068863_1001085392 360
144 3300005842 Ga0068858_100018333 Ga0068858_1000183336 360
145 3300005843 Ga0068860_100241415 Ga0068860_1002414152 360
146 3300005937 Ga0081455_10069950 Ga0081455_100699503 360
147 3300005983 Ga0081540_1001309 Ga0081540_10013097 360
148 3300005983 Ga0081540_1011824 Ga0081540_10118246 360
149 3300006038 Ga0075365_10031906 Ga0075365_100319062 360
150 3300006042 Ga0075368_10008163 Ga0075368_100081633 360
151 3300006048 Ga0075363_100000880 Ga0075363_1000008804 360
152 3300006048 Ga0075363_100033735 Ga0075363_1000337352 360
153 3300006051 Ga0075364_10009208 Ga0075364_100092084 360
154 3300006178 Ga0075367_10015848 Ga0075367_100158484 360
155 3300006178 Ga0075367_10020665 Ga0075367_100206651 360
156 3300006186 Ga0075369_10078319 Ga0075369_100783192 360
157 3300006353 Ga0075370_10031920 Ga0075370_100319202 360
158 3300006353 Ga0075370_10110918 Ga0075370_101109182 360
159 3300006353 Ga0075370_10122992 Ga0075370_101229921 360
160 3300006852 Ga0075433_10328472 Ga0075433_103284721 360
161 3300006871 Ga0075434_100079758 Ga0075434_1000797583 360
162 3300006931 Ga0097620_100059220 Ga0097620_1000592202 360
163 3300007076 Ga0075435_100022886 Ga0075435_1000228862 360
164 3300009093 Ga0105240_10109552 Ga0105240_101095522 360
165 3300009098 Ga0105245_10051742 Ga0105245_100517423 360
166 3300009101 Ga0105247_10201753 Ga0105247_102017531 360
167 3300009174 Ga0105241_10010905 Ga0105241_100109053 360
168 3300009174 Ga0105241_10028160 Ga0105241_100281604 360
169 3300009177 Ga0105248_10053320 Ga0105248_100533205 360
170 3300009177 Ga0105248_10072957 Ga0105248_100729574 360
171 3300009545 Ga0105237_10045179 Ga0105237_100451792 360
172 3300009545 Ga0105237_10065589 Ga0105237_100655892 360
173 3300009551 Ga0105238_10087204 Ga0105238_100872041 360
174 3300010375 Ga0105239_10023031 Ga0105239_100230313 360
175 3300010375 Ga0105239_10087454 Ga0105239_100874542 360
176 3300010375 Ga0105239_10510037 Ga0105239_105100372 360
177 3300014968 Ga0157379_10112641 Ga0157379_101126411 360
178 3300025901 Ga0207688_10012904 Ga0207688_100129043 360
179 3300025903 Ga0207680_10094884 Ga0207680_100948842 360
180 3300025904 Ga0207647_10007950 Ga0207647_100079502 360
181 3300025904 Ga0207647_10040059 Ga0207647_100400592 360
182 3300025907 Ga0207645_10149084 Ga0207645_101490841 360
183 3300025908 Ga0207643_10041215 Ga0207643_100412152 360
184 3300025908 Ga0207643_10081680 Ga0207643_100816802 360
185 3300025911 Ga0207654_10011101 Ga0207654_100111011 360
186 3300025913 Ga0207695_10017177 Ga0207695_100171773 360
187 3300025914 Ga0207671_10002302 Ga0207671_100023027 360
188 3300025914 Ga0207671_10093760 Ga0207671_100937601 360
189 3300025920 Ga0207649_10157811 Ga0207649_101578111 360
190 3300025924 Ga0207694_10004185 Ga0207694_100041857 360
191 3300025927 Ga0207687_10141132 Ga0207687_101411322 360
192 3300025940 Ga0207691_10119678 Ga0207691_101196782 360
193 3300025941 Ga0207711_10221546 Ga0207711_102215462 360
194 3300025942 Ga0207689_10079187 Ga0207689_100791872 360
195 3300025949 Ga0207667_10016189 Ga0207667_100161898 360
196 3300025972 Ga0207668_10050098 Ga0207668_100500982 360
197 3300025972 Ga0207668_10099734 Ga0207668_100997342 360
198 3300025981 Ga0207640_10273666 Ga0207640_102736661 360
199 3300026035 Ga0207703_10029106 Ga0207703_100291064 360
200 3300026041 Ga0207639_10037132 Ga0207639_100371322 360
201 3300026067 Ga0207678_10118823 Ga0207678_101188232 360
202 3300026078 Ga0207702_10067760 Ga0207702_100677602 360
203 3300026118 Ga0207675_100050867 Ga0207675_1000508672 360
204 3300026118 Ga0207675_100064738 Ga0207675_1000647383 360
205 3300026118 Ga0207675_100338403 Ga0207675_1003384032 360
206 3300026118 Ga0207675_100441910 Ga0207675_1004419101 360
207 3300026121 Ga0207683_10103145 Ga0207683_101031452 360
208 3300026142 Ga0207698_10228210 Ga0207698_102282102 360
209 3300028379 Ga0268266_10004455 Ga0268266_100044559 360
210 3300028379 Ga0268266_10006881 Ga0268266_100068817 360
211 3300028379 Ga0268266_10011633 Ga0268266_100116332 360
212 3300028379 Ga0268266_10253482 Ga0268266_102534822 360
213 3300028380 Ga0268265_10086486 Ga0268265_100864862 360
214 3300028381 Ga0268264_10229040 Ga0268264_102290402 360
215 3300028786 Ga0307517_10000369 Ga0307517_1000036968 360
216 3300028786 Ga0307517_10163380 Ga0307517_101633802 360
217 3300028794 Ga0307515_10023324 Ga0307515_100233249 360
218 3300031548 Ga0307408_100276472 Ga0307408_1002764722 360
219 3300031616 Ga0307508_10028978 Ga0307508_100289782 360
220 3300031911 Ga0307412_10201150 Ga0307412_102011501 360
221 3300031995 Ga0307409_100116193 Ga0307409_1001161932 360
222 3300032002 Ga0307416_100301562 Ga0307416_1003015621 360
223 3300033180 Ga0307510_10006740 Ga0307510_1000674013 360
224 3300033180 Ga0307510_10212885 Ga0307510_102128852 360
225 3300039447 Ga0436361_0507638 Ga0436361_0507638_1031_2116 360
226 3300041443 Ga0451789_1234897 Ga0451789_1234897_76_1158 360
227 3300045836 Ga0466958_0002400 Ga0466958_0002400_3695_4792 360
228 3300046455 Ga0495603_0142249 Ga0495603_0142249_279_1364 360
229 3300046459 Ga0495629_0122793 Ga0495629_0122793_663_1748 360
230 3300046460 Ga0495638_0099062 Ga0495638_0099062_245_1327 360
231 3300046475 Ga0495639_0032155 Ga0495639_0032155_1141_2223 360
232 3300046501 Ga0495607_0119492 Ga0495607_0119492_187_1269 360
233 3300046519 Ga0495632_0077131 Ga0495632_0077131_226_1311 360
234 3300046523 Ga0495644_0042001 Ga0495644_0042001_369_1451 360
235 3300046660 Ga0495625_0179850 Ga0495625_0179850_263_1348 360
236 3300046663 Ga0495635_0138354 Ga0495635_0138354_49_1134 360
237 3300046674 Ga0495588_0009550 Ga0495588_0009550_3347_4429 360
238 3300046684 Ga0495669_0060812 Ga0495669_0060812_317_1402 360
239 3300047323 Ga0495683_0111300 Ga0495683_0111300_117_1199 360
240 3300047472 Ga0495686_0031719 Ga0495686_0031719_1761_2843 360
241 3300048909 Ga0496106_0055551 Ga0496106_0055551_130_1212 360
242 3300048912 Ga0496109_0125588 Ga0496109_0125588_879_1964 360
243 3300048924 Ga0496121_0074918 Ga0496121_0074918_1093_2175 360
244 3300048924 Ga0496121_0079103 Ga0496121_0079103_694_1776 360
245 3300048927 Ga0496124_0025173 Ga0496124_0025173_2605_3687 360
246 3300048928 Ga0496125_0084824 Ga0496125_0084824_47_1129 360
247 3300048929 Ga0496126_0004475 Ga0496126_0004475_7433_8548 360
248 3300048929 Ga0496126_0104782 Ga0496126_0104782_884_1966 360
249 3300048929 Ga0496126_0205621 Ga0496126_0205621_67_1149 360
250 3300050490 nmdc:mga03n38_2163_c1 nmdc:mga03n38_2163_c1_2691_3773 360
251 3300050491 nmdc:mga00v17_63066_c1 nmdc:mga00v17_63066_c1_1133_2215 360
252 3300050494 nmdc:mga06z11_9282_c1 nmdc:mga06z11_9282_c1_2909_3991 360
253 3300050510 nmdc:mga06r32_440962_c1 nmdc:mga06r32_440962_c1_185_1267 360
254 3300053119 Ga0500595_017961 Ga0500595_017961_229_1311 360
255 3300053133 Ga0500655_019392 Ga0500655_019392_130_1215 360
256 3300053148 Ga0500590_110836 Ga0500590_110836_168_1250 360
257 3300053156 Ga0500622_0045681 Ga0500622_0045681_104_1189 360
258 3300053158 Ga0500627_0081571 Ga0500627_0081571_84_1169 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

178

314

0.83

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

20

136

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pl6-assembly1.cif.gz_A human sdh/nadh/inhibitor complex 0.8403 2 359
1rjw-assembly1.cif.gz_C crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r 0.8375 1 358
1e3j-assembly1.cif.gz_A ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly 0.8355 2 359
2d8a-assembly1.cif.gz_A crystal structure of ph0655 from pyrococcus horikoshii ot3 0.8305 1 357
4ilk-assembly1.cif.gz_B crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.8302 1 357
ID Description Score Start End Superfamily
af_B0BNC9_25_138_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9149 2 141 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8896 2 145 3.90.180.10
af_O97479_158_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8799 160 301 3.40.50.720
3m6iB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8733 156 303 3.40.50.720
af_Q21703_166_295_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8695 166 303 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q3LLL8-F1-model_v4 Alcohol dehydrogenase 0.9669 1 328 GO:0016491
AF-A0A1Q3LLL8-F1-model_v4 Alcohol dehydrogenase 0.964 1 328 GO:0016491
AF-A0A499V367-F1-model_v4 Alcohol dehydrogenase 0.9584 1 358 GO:0016491
AF-A0A499V367-F1-model_v4 Alcohol dehydrogenase 0.9532 1 358 GO:0016491
AF-A0A846GEE9-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9511 1 358 GO:0016491
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.84 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map