F368808

General Info

Members Datasets Scaffolds Average Seq Length
259 193 518 174

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10264233|Ga0157373_102642332
Length 194
Sequence LNYLTAYLCAIVQLYKTAKNTKMPHLTIQQIDSSAILALQSISRKIFLEAFADTTSEANMKDYLDSSFSYDKLMAELEQPNSQFYFALSEGNVVGYLKLNTGDAQTEQELEEALEIERIYVLAAFHGQKVGQALLNKAFDVARALQFKTIWLGVWENNQRALRFYTKAGFEVFNSHIFRLGNDEQTDLMMKKQL

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
49 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
50 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
65 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
70 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
71 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
72 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
73 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
74 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
75 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
76 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
77 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
113 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
116 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
117 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
118 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
119 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
120 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
121 2643221731 Bacillus sp. Root147 Isolate Unclassified
122 2643221732 Bacillus sp. Root239 Isolate Unclassified
123 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
124 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
125 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
126 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
127 2738541302 Pedobacter sp. CF074 Isolate Unclassified
128 2738543017 Bacillus sp. OV186 Isolate Unclassified
129 2739367651 Pedobacter sp. OK291 Isolate Unclassified
130 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
131 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
132 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
133 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
134 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
135 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
136 2818991437 Pedobacter terrae 518 Isolate Unclassified
137 2818991441 Niallia circulans 3243 Isolate Rhizosphere
138 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
139 2842682962 Bacillus sp. R-72492 Isolate Unclassified
140 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
141 2842882022 Bacillus sp. R-71893 Isolate Unclassified
142 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
143 2849139964 Bacillus sp. R-71875 Isolate Unclassified
144 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
145 2857581216 Bacillus sp. R-71922 Isolate Unclassified
146 2857586860 Bacillus sp. R-71935 Isolate Unclassified
147 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
148 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
149 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
150 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
151 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
152 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
153 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
154 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
155 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
156 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
157 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
158 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
159 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
160 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
161 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
162 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
163 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
164 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
165 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
166 2919720352 Priestia megaterium 4340 Isolate Unclassified
167 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
168 2929004312 Priestia megaterium 1104 Isolate Unclassified
169 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
170 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
171 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
172 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
173 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
174 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
175 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
176 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
177 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
178 2965761152 Bacillus sp. COPE52 Isolate Unclassified
179 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
180 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
181 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
182 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
183 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
184 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
185 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
186 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
187 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
188 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
189 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
190 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
191 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
192 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
193 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.5
Metatranscriptomes 0.39
Isolates 30.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.42
Nodule 0.77
Rhizoplane 8.49
Rhizosphere 50.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10264233 3300013100 Bacteria 1218
2 JGI25162J39368_1000024 3300002737 Bacteria 229507
3 JGI25151J46595_10000821 3300003187 Bacteria 24743
4 JGI25151J46595_10003981 3300003187 Bacteria 7941
5 JGI25151J46595_10033047 3300003187 Bacteria 1998
6 rootH1_10050008 3300003316 Bacteria 3691
7 rootH2_10004553 3300003320 Bacteria 89512
8 rootL2_10276923 3300003322 Bacteria 2910
9 Ga0006562J51391_1043254 3300003578 Bacteria 1251
10 Ga0055532_1000030 3300003758 Bacteria 232738
11 Ga0055536_1000003 3300003781 Bacteria 447744
12 Ga0055536_1028171 3300003781 Bacteria 1536
13 Ga0055528_1045647 3300003790 Bacteria 932
14 Ga0055530_10001547 3300003791 Bacteria 16522
15 Ga0065714_10064438 3300005288 Bacteria 113441
16 Ga0065715_10504435 3300005293 Bacteria 777
17 Ga0070671_100323407 3300005355 Bacteria 1315
18 Ga0068871_100004482 3300006358 Bacteria 9721
19 Ga0079104_1000005 3300006946 Bacteria 407099
20 Ga0105251_10039663 3300009011 Bacteria 2299
21 Ga0105251_10082846 3300009011 Bacteria 1481
22 Ga0105251_10104078 3300009011 Bacteria 1297
23 Ga0105244_10024058 3300009036 Bacteria 3329
24 Ga0105244_10133295 3300009036 Bacteria 1198
25 Ga0105244_10153841 3300009036 Bacteria 1101
26 Ga0105250_10370238 3300009092 Bacteria 630
27 Ga0105240_10534908 3300009093 Bacteria 1299
28 Ga0105243_10273949 3300009148 Bacteria 1517
29 Ga0105242_10116450 3300009176 Bacteria 2286
30 Ga0105237_10555510 3300009545 Bacteria 1155
31 Ga0105246_10698822 3300011119 Bacteria 889
32 Ga0157371_10000021 3300013102 Bacteria 301017
33 Ga0157370_10001803 3300013104 Bacteria 26409
34 Ga0157370_10139935 3300013104 Bacteria 2255
35 Ga0157369_10000008 3300013105 Bacteria 309315
36 Ga0163162_10000049 3300013306 Bacteria 122455
37 Ga0163162_10057992 3300013306 Bacteria 3900
38 Ga0157372_10077512 3300013307 Bacteria 3754
39 Ga0157372_10409293 3300013307 Bacteria 1581
40 Ga0182008_10001116 3300014497 Bacteria 18469
41 Ga0157376_10107399 3300014969 Bacteria 2450
42 Ga0182006_1000267 3300015261 Bacteria 47415
43 Ga0182006_1000407 3300015261 Bacteria 34782
44 Ga0182006_1004356 3300015261 Bacteria 6998
45 Ga0182006_1140424 3300015261 Bacteria 826
46 Ga0182006_1140425 3300015261 Bacteria 826
47 Ga0182007_10000003 3300015262 Bacteria 548244
48 Ga0182007_10165847 3300015262 Bacteria 757
49 Ga0182007_10234898 3300015262 Bacteria 652
50 Ga0183373_1001 3300015682 Bacteria 1410374
51 Ga0163161_10000189 3300017792 Bacteria 56683
52 Ga0209784_100775 3300025224 Bacteria 7776
53 Ga0209784_104049 3300025224 Bacteria 1113
54 Ga0209566_107829 3300025225 Bacteria 1185
55 Ga0209147_100065 3300025229 Bacteria 232777
56 Ga0209147_101381 3300025229 Bacteria 9006
57 Ga0209673_1075356 3300025273 Bacteria 789
58 Ga0209676_1000001 3300025292 Bacteria 1852142
59 Ga0209676_1000692 3300025292 Bacteria 47476
60 Ga0209025_1000863 3300025294 Bacteria 47880
61 Ga0209025_1003931 3300025294 Bacteria 13358
62 Ga0209025_1017443 3300025294 Bacteria 4141
63 Ga0209025_1045429 3300025294 Bacteria 1821
64 Ga0209025_1072282 3300025294 Bacteria 1217
65 Ga0209025_1086675 3300025294 Bacteria 1040
66 Ga0209025_1109326 3300025294 Bacteria 853
67 Ga0209050_1000016 3300025298 Bacteria 729149
68 Ga0207426_1015198 3300025302 Bacteria 2797
69 Ga0207696_1005107 3300025711 Bacteria 5510
70 Ga0207655_1012862 3300025728 Bacteria 4848
71 Ga0207655_1021515 3300025728 Bacteria 3271
72 Ga0207655_1136768 3300025728 Bacteria 791
73 Ga0207713_1041977 3300025735 Bacteria 1903
74 Ga0207686_10062641 3300025934 Bacteria 2362
75 Ga0209281_1000216 3300027111 Bacteria 125724
76 Ga0209371_1009251 3300027312 Bacteria 3149
77 Ga0268256_1009777 3300030500 Bacteria 3149
78 Ga0265327_10000935 3300031251 Bacteria 42778
79 Ga0307405_10000042 3300031731 Bacteria 79124
80 Ga0307413_10018553 3300031824 Bacteria 3654
81 Ga0307407_10000026 3300031903 Bacteria 108029
82 Ga0307409_100014062 3300031995 Bacteria 5186
83 Ga0307416_100000053 3300032002 Bacteria 108029
84 Ga0307416_100004689 3300032002 Bacteria 8279
85 Ga0307416_100950961 3300032002 Bacteria 961
86 Ga0307414_10004897 3300032004 Bacteria 7316
87 Ga0307414_10086039 3300032004 Bacteria 2318
88 Ga0307414_10155703 3300032004 Bacteria 1808
89 Ga0307411_10000001 3300032005 Bacteria 931810
90 Ga0395900_0712079 3300037418 Bacteria 937
91 Ga0395898_0880433 3300037466 Bacteria 834
92 Ga0466967_0018808 3300045976 Bacteria 5535
93 Ga0495603_0136096 3300046455 Bacteria 1430
94 Ga0495603_0290389 3300046455 Bacteria 939
95 Ga0495638_0031756 3300046460 Bacteria 3391
96 Ga0495638_0192668 3300046460 Bacteria 1156
97 Ga0495650_0000057 3300046471 Bacteria 303569
98 Ga0495650_0043793 3300046471 Bacteria 1896
99 Ga0495584_0334749 3300046491 Bacteria 769
100 Ga0495585_0214077 3300046492 Bacteria 975
101 Ga0495583_0015879 3300046506 Bacteria 4074
102 Ga0495606_0015487 3300046507 Bacteria 5870
103 Ga0495606_0022948 3300046507 Bacteria 4533
104 Ga0495610_0005559 3300046512 Bacteria 8918
105 Ga0495633_0008111 3300046558 Bacteria 5956
106 Ga0495633_0171031 3300046558 Bacteria 1001
107 Ga0495661_0001158 3300046665 Bacteria 23006
108 Ga0495661_0048604 3300046665 Bacteria 2577
109 Ga0495661_0359928 3300046665 Bacteria 715
110 Ga0495649_0415830 3300046694 Bacteria 674
111 Ga0495589_0139305 3300046794 Bacteria 1162
112 Ga0495636_0000033 3300047318 Bacteria 57835
113 Ga0495672_0359809 3300047320 Bacteria 674
114 Ga0495683_0091556 3300047323 Bacteria 1473
115 Ga0495687_006289 3300047443 Bacteria 7320
116 Ga0495686_0000160 3300047472 Bacteria 128437
117 Ga0496100_0065063 3300048903 Bacteria 2414
118 Ga0496101_0007380 3300048904 Bacteria 7120
119 Ga0496102_0047909 3300048905 Bacteria 3886
120 Ga0496102_0680816 3300048905 Bacteria 951
121 Ga0496102_0752499 3300048905 Bacteria 897
122 Ga0496103_0031916 3300048906 Bacteria 3212
123 Ga0496104_0005828 3300048907 Bacteria 10791
124 Ga0496105_0005687 3300048908 Bacteria 9489
125 Ga0496106_0010317 3300048909 Bacteria 6905
126 Ga0496107_0004065 3300048910 Bacteria 9850
127 Ga0496108_0008711 3300048911 Bacteria 8224
128 Ga0496109_0002404 3300048912 Bacteria 15673
129 Ga0496109_0289521 3300048912 Bacteria 1544
130 Ga0496110_0012845 3300048913 Bacteria 6900
131 Ga0496110_0137854 3300048913 Bacteria 2205
132 Ga0496111_0006819 3300048914 Bacteria 7449
133 Ga0496111_0051184 3300048914 Bacteria 2981
134 Ga0496112_0330370 3300048915 Bacteria 1468
135 Ga0496112_0589264 3300048915 Bacteria 1044
136 Ga0496113_0843478 3300048916 Bacteria 726
137 Ga0496113_0900309 3300048916 Bacteria 700
138 Ga0496116_0002044 3300048919 Bacteria 21624
139 Ga0496116_0020850 3300048919 Bacteria 4964
140 Ga0496116_0089635 3300048919 Bacteria 1875
141 Ga0496116_0123138 3300048919 Bacteria 1496
142 Ga0496116_0130150 3300048919 Bacteria 1436
143 Ga0496117_0007957 3300048920 Bacteria 10183
144 Ga0496118_0076161 3300048921 Bacteria 2387
145 Ga0496118_0129819 3300048921 Bacteria 1621
146 Ga0496119_0018774 3300048922 Bacteria 5128
147 Ga0496119_0047334 3300048922 Bacteria 2676
148 Ga0496120_0000012 3300048923 Bacteria 348703
149 Ga0496120_0025253 3300048923 Bacteria 3690
150 Ga0496121_0006591 3300048924 Bacteria 14322
151 Ga0496121_0036918 3300048924 Bacteria 4347
152 Ga0496121_0116177 3300048924 Bacteria 2030
153 Ga0496121_0336089 3300048924 Bacteria 1011
154 Ga0496122_0007388 3300048925 Bacteria 12240
155 Ga0496122_0014459 3300048925 Bacteria 7628
156 Ga0496122_0098993 3300048925 Bacteria 1956
157 Ga0496123_0000237 3300048926 Bacteria 111482
158 Ga0496123_0024064 3300048926 Bacteria 4640
159 Ga0496124_0066799 3300048927 Bacteria 2994
160 Ga0496124_0254835 3300048927 Bacteria 1295
161 Ga0496124_0277795 3300048927 Bacteria 1223
162 Ga0496125_0000004 3300048928 Bacteria 843089
163 Ga0496125_0001955 3300048928 Bacteria 28119
164 Ga0496125_0049283 3300048928 Bacteria 3502
165 Ga0496125_0233536 3300048928 Bacteria 1174
166 Ga0496126_0012801 3300048929 Bacteria 8574
167 Ga0496126_0194884 3300048929 Bacteria 1714
168 Ga0496126_0414829 3300048929 Bacteria 1090
169 Ga0501034_0208200 3300049571 Bacteria 1911
170 Ga0501036_0036622 3300049572 Bacteria 4152
171 Ga0501038_0021409 3300049574 Bacteria 5804
172 Ga0501039_0049263 3300049575 Bacteria 3256
173 Ga0501043_0024043 3300049579 Bacteria 4781
174 Ga0501046_0575031 3300049580 Bacteria 801
175 Ga0501047_0142691 3300049581 Bacteria 2273
176 Ga0501072_0542478 3300049588 Bacteria 919
177 Ga0501249_001009 3300049679 Bacteria 6048
178 Ga0501249_016241 3300049679 Bacteria 1598
179 Ga0501266_000039 3300049763 Bacteria 26126
180 Ga0501044_0062464 3300049823 Bacteria 3807
181 Ga0500608_276879 3300053122 Bacteria 637
182 2586208952 2585427687 Bacteria 5544917
183 2587739092 2585428059 Bacteria 8696589
184 2595091140 2593339131 Bacteria 5116855
185 2595318112 2593339198 Bacteria 7267884
186 2644424116 2643221676 Bacteria 8119172
187 2644719158 2643221731 Bacteria 5623886
188 2644722429 2643221732 Bacteria 5756404
189 2672334145 2671180330 Bacteria 5521719
190 2722730016 2721755487 Bacteria 6357185
191 2723604039 2721755693 Bacteria 6126117
192 2730139827 2728369359 Bacteria 5621728
193 2738856280 2738541302 Bacteria 5944758
194 2739268330 2738543017 Bacteria 4271950
195 2739590482 2739367651 Bacteria 6359826
196 2740001351 2739367857 Bacteria 5433684
197 2753811541 2751185905 Bacteria 6142767
198 2757566361 2757320391 Bacteria 4746095
199 2777836141 2775507192 Bacteria 4622234
200 2816861504 2816332186 Bacteria 5331395
201 2817415949 2816332280 Bacteria 5109718
202 2819549363 2818991437 Bacteria 5805520
203 2819570820 2818991441 Bacteria 5062707
204 2819707841 2818991465 Bacteria 5388835
205 2842687263 2842682962 Bacteria 5589973
206 2842724774 2842722452 Bacteria 6263924
207 2842885065 2842882022 Bacteria 6158489
208 2842913200 2842909656 Bacteria 6185908
209 2849145486 2849139964 Bacteria 5613304
210 2857456049 2857453340 Bacteria 8090534
211 2857586130 2857581216 Bacteria 5522813
212 2857588391 2857586860 Bacteria 4354574
213 2857607015 2857604169 Bacteria 5111450
214 2857618683 2857618242 Bacteria 5635925
215 2865004710 2865002811 Bacteria 6333767
216 2881362058 2881359912 Bacteria 4935907
217 2881637410 2881636855 Bacteria 5205297
218 2881647016 2881644220 Bacteria 5302661
219 2881957351 2881955468 Bacteria 3545609
220 2885531531 2885526491 Bacteria 7164189
221 2889279977 2889276214 Bacteria 5979355
222 2897110128 2897109615 Bacteria 4009619
223 2903896301 2903895155 Bacteria 5258610
224 2904448272 2904445276 Bacteria 5310396
225 2904527502 2904524088 Bacteria 5887454
226 2904600994 2904595352 Bacteria 6124848
227 2908668919 2908665501 Bacteria 3678115
228 2919143868 2919143609 Bacteria 6219228
229 2919402980 2919399522 Bacteria 5164947
230 2919431271 2919425241 Bacteria 8055701
231 2919520625 2919517244 Bacteria 5858162
232 2919724648 2919720352 Bacteria 5986006
233 2928097302 2928093941 Bacteria 5965005
234 2929004470 2929004312 Bacteria 5678476
235 2929210407 2929206907 Bacteria 5918291
236 2929236021 2929233124 Bacteria 5948380
237 2936342199 2936340661 Bacteria 5139038
238 2946001782 2945997725 Bacteria 6404843
239 2954018605 2954016120 Bacteria 6446024
240 2956898247 2956897341 Bacteria 5447711
241 2958460737 2958458903 Bacteria 5301041
242 2960319363 2960319331 Bacteria 5502575
243 2960378099 2960375949 Bacteria 5361395
244 2965764474 2965761152 Bacteria 5806513
245 2969769119 2969765954 Bacteria 4216713
246 2977255452 2977254563 Bacteria 4828420
247 2980495255 2980492589 Bacteria 4072961
248 2996710667 2996706504 Bacteria 5757485
249 3001273363 3001272096 Bacteria 4729684
250 3006858998 3006858327 Bacteria 4317835
251 3006974034 3006973921 Bacteria 4423788
252 3006986165 3006984091 Bacteria 4207523
253 648170307 648028048 Bacteria 5394884
254 8002323331 8002317523 Bacteria 8051857
255 8022893655 8022893055 Bacteria 5300455
256 8022915923 8022914991 Bacteria 5584517
257 8022950305 8022948649 Bacteria 5366783
258 8055421657 8055419101 Bacteria 5289643
259 8055593892 8055592153 Bacteria 5961247
260 Ga0157373_10264233
261 JGI25162J39368_1000024
262 JGI25151J46595_10000821
263 JGI25151J46595_10003981
264 JGI25151J46595_10033047
265 rootH1_10050008
266 rootH2_10004553
267 rootL2_10276923
268 Ga0006562J51391_1043254
269 Ga0055532_1000030
270 Ga0055536_1000003
271 Ga0055536_1028171
272 Ga0055528_1045647
273 Ga0055530_10001547
274 Ga0065714_10064438
275 Ga0065715_10504435
276 Ga0070671_100323407
277 Ga0068871_100004482
278 Ga0079104_1000005
279 Ga0105251_10039663
280 Ga0105251_10082846
281 Ga0105251_10104078
282 Ga0105244_10024058
283 Ga0105244_10133295
284 Ga0105244_10153841
285 Ga0105250_10370238
286 Ga0105240_10534908
287 Ga0105243_10273949
288 Ga0105242_10116450
289 Ga0105237_10555510
290 Ga0105246_10698822
291 Ga0157371_10000021
292 Ga0157370_10001803
293 Ga0157370_10139935
294 Ga0157369_10000008
295 Ga0163162_10000049
296 Ga0163162_10057992
297 Ga0157372_10077512
298 Ga0157372_10409293
299 Ga0182008_10001116
300 Ga0157376_10107399
301 Ga0182006_1000267
302 Ga0182006_1000407
303 Ga0182006_1004356
304 Ga0182006_1140424
305 Ga0182006_1140425
306 Ga0182007_10000003
307 Ga0182007_10165847
308 Ga0182007_10234898
309 Ga0183373_1001
310 Ga0163161_10000189
311 Ga0209784_100775
312 Ga0209784_104049
313 Ga0209566_107829
314 Ga0209147_100065
315 Ga0209147_101381
316 Ga0209673_1075356
317 Ga0209676_1000001
318 Ga0209676_1000692
319 Ga0209025_1000863
320 Ga0209025_1003931
321 Ga0209025_1017443
322 Ga0209025_1045429
323 Ga0209025_1072282
324 Ga0209025_1086675
325 Ga0209025_1109326
326 Ga0209050_1000016
327 Ga0207426_1015198
328 Ga0207696_1005107
329 Ga0207655_1012862
330 Ga0207655_1021515
331 Ga0207655_1136768
332 Ga0207713_1041977
333 Ga0207686_10062641
334 Ga0209281_1000216
335 Ga0209371_1009251
336 Ga0268256_1009777
337 Ga0265327_10000935
338 Ga0307405_10000042
339 Ga0307413_10018553
340 Ga0307407_10000026
341 Ga0307409_100014062
342 Ga0307416_100000053
343 Ga0307416_100004689
344 Ga0307416_100950961
345 Ga0307414_10004897
346 Ga0307414_10086039
347 Ga0307414_10155703
348 Ga0307411_10000001
349 Ga0395900_0712079
350 Ga0395898_0880433
351 Ga0466967_0018808
352 Ga0495603_0136096
353 Ga0495603_0290389
354 Ga0495638_0031756
355 Ga0495638_0192668
356 Ga0495650_0000057
357 Ga0495650_0043793
358 Ga0495584_0334749
359 Ga0495585_0214077
360 Ga0495583_0015879
361 Ga0495606_0015487
362 Ga0495606_0022948
363 Ga0495610_0005559
364 Ga0495633_0008111
365 Ga0495633_0171031
366 Ga0495661_0001158
367 Ga0495661_0048604
368 Ga0495661_0359928
369 Ga0495649_0415830
370 Ga0495589_0139305
371 Ga0495636_0000033
372 Ga0495672_0359809
373 Ga0495683_0091556
374 Ga0495687_006289
375 Ga0495686_0000160
376 Ga0496100_0065063
377 Ga0496101_0007380
378 Ga0496102_0047909
379 Ga0496102_0680816
380 Ga0496102_0752499
381 Ga0496103_0031916
382 Ga0496104_0005828
383 Ga0496105_0005687
384 Ga0496106_0010317
385 Ga0496107_0004065
386 Ga0496108_0008711
387 Ga0496109_0002404
388 Ga0496109_0289521
389 Ga0496110_0012845
390 Ga0496110_0137854
391 Ga0496111_0006819
392 Ga0496111_0051184
393 Ga0496112_0330370
394 Ga0496112_0589264
395 Ga0496113_0843478
396 Ga0496113_0900309
397 Ga0496116_0002044
398 Ga0496116_0020850
399 Ga0496116_0089635
400 Ga0496116_0123138
401 Ga0496116_0130150
402 Ga0496117_0007957
403 Ga0496118_0076161
404 Ga0496118_0129819
405 Ga0496119_0018774
406 Ga0496119_0047334
407 Ga0496120_0000012
408 Ga0496120_0025253
409 Ga0496121_0006591
410 Ga0496121_0036918
411 Ga0496121_0116177
412 Ga0496121_0336089
413 Ga0496122_0007388
414 Ga0496122_0014459
415 Ga0496122_0098993
416 Ga0496123_0000237
417 Ga0496123_0024064
418 Ga0496124_0066799
419 Ga0496124_0254835
420 Ga0496124_0277795
421 Ga0496125_0000004
422 Ga0496125_0001955
423 Ga0496125_0049283
424 Ga0496125_0233536
425 Ga0496126_0012801
426 Ga0496126_0194884
427 Ga0496126_0414829
428 Ga0501034_0208200
429 Ga0501036_0036622
430 Ga0501038_0021409
431 Ga0501039_0049263
432 Ga0501043_0024043
433 Ga0501046_0575031
434 Ga0501047_0142691
435 Ga0501072_0542478
436 Ga0501249_001009
437 Ga0501249_016241
438 Ga0501266_000039
439 Ga0501044_0062464
440 Ga0500608_276879
441 2586208952
442 2587739092
443 2595091140
444 2595318112
445 2644424116
446 2644719158
447 2644722429
448 2672334145
449 2722730016
450 2723604039
451 2730139827
452 2738856280
453 2739268330
454 2739590482
455 2740001351
456 2753811541
457 2757566361
458 2777836141
459 2816861504
460 2817415949
461 2819549363
462 2819570820
463 2819707841
464 2842687263
465 2842724774
466 2842885065
467 2842913200
468 2849145486
469 2857456049
470 2857586130
471 2857588391
472 2857607015
473 2857618683
474 2865004710
475 2881362058
476 2881637410
477 2881647016
478 2881957351
479 2885531531
480 2889279977
481 2897110128
482 2903896301
483 2904448272
484 2904527502
485 2904600994
486 2908668919
487 2919143868
488 2919402980
489 2919431271
490 2919520625
491 2919724648
492 2928097302
493 2929004470
494 2929210407
495 2929236021
496 2936342199
497 2946001782
498 2954018605
499 2956898247
500 2958460737
501 2960319363
502 2960378099
503 2965764474
504 2969769119
505 2977255452
506 2980495255
507 2996710667
508 3001273363
509 3006858998
510 3006974034
511 3006986165
512 648170307
513 8002323331
514 8022893655
515 8022915923
516 8022950305
517 8055421657
518 8055593892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

51

184

0.89

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

43

170

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

80

172

0.84

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

28

190

0.82

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

25

171

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.9815 4 174
1tiq-assembly2.cif.gz_B crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9638 5 174
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9516 5 174
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9305 5 174
1tiq-assembly2.cif.gz_B crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9246 5 174
ID Description Score Start End Superfamily
1tiqB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9584 5 174 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9446 93 174 3.40.630.30
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9441 7 174 3.40.630.30
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9387 7 174 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9259 128 174 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A327R2W1-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9771 4 174 GO:0016747
AF-A0A1X7LDT9-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9763 72 174 GO:0016747
AF-A0A1Q3GM64-F1-model_v4 N-acetyltransferase domain-containing protein 0.9749 5 174 GO:0016747
AF-A0A0R1YKL6-F1-model_v4 GCN5-like N-acetyltransferase 0.97 5 174 GO:0016747
AF-A0A4Y1ZIV9-F1-model_v4 Negative regulation of sporulation, septation and degradative enzyme 0.9698 41 126 GO:0016747

Map