F368947

General Info

Members Datasets Scaffolds Average Seq Length
259 161 259 1061

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0000101|Ga0373943_0000101_20033_23386
Length 1117
Sequence MTFTSRDAFPACGGVGDERRFEPGPPARTTPVRTPAPYVELHSHSAYSFLDGASLPEELAARAAELGYDALALTDHDGVYGSLEFAHAAKHLGVRPITGAEVTLGGVGLTEPRSSRGAGFAGAEAENTGAHVTLLCETQQGYTNLCRILTDAHARTRLQGRERELLPPETSVEVVSEHAEGLVALSGCARHGLGVVDPNAAARLARAFPGAFYVELQRPYERGDARRNALLTDLAETLRVPTVATGDVHAHNARRAKLQDALVAIKQRTSLDGCEHERRGNHESILLAPAELLERLPREAAEQTREVADRCRFDLTQELGYRYPDFSDGVDPADVQLREICDRAFVERYAKANGHKRQARERLDDELKLIARLGLAGFFLLHWEVLELARECALEVRGPGSPRHALPPGRGRGSSVGSIVCYLTGLSHVDPVEAGLSLGRFINDEMVAVPDIDLDFPRDIREKLIIRVTERYGRQHAALVASFSTYRSRGAIRDIGKAVGLPFAELERLARVTDGWDATRIADEVDGVPGTHSGPRWDAFRELTHEIAGLPRHISQHPGGMVISTRPLIDLVPVQPAAMTGRQICQWDKDSCGDAGFLKIDLLGLGMLSAVEDAIDRIARLHGTTIDLSRVPLDDAAVYAEIQQADTVGVFQIESRAQMQSLLQTQPENLDDLTVQVALVRPGPIQGKAVHPYIEHRRRRRIDPTFEPPVEHESLREPLRDTLGVVVFQDQVLDVSMAAAGFSIGEAEGLRRAMSRKRSEEAIEAWRPRFVAGALAQGMSEETAHLIYDKLVGFAGFGFPKSHAAAFALLAYQSAWLRRYYPGEFLCALLNAQPMGFYPPSSLVRDAQRRGVEVRSPHVNRSRAECTIEDGAVRVGIGYVQSVGEADAKAVEAGQPYADLGDLARRTSVHADSLEALVAAGTCDEWGPRRELLWRLGVTSRGETVTGGNRQLALPLEPTAEIPELPGQTDWEQMLADYKHTSMSVGVHPLQLLRPHLPAGVATSAELPETPHGTTIQVAGMAIARQRXXTANGVVFMLLEDEHGQSNLIVPPRVYEQYRAVVRGEPLILARGKLERHGRNINLLVAELASLGPLARKAASEAEVTAALPRAHHFGHR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
68 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.13
Rhizosphere 86.49
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10007457 3300005327 Bacteria 8829
2 Ga0070658_10013477 3300005327 Bacteria 6561
3 Ga0070683_100003577 3300005329 Bacteria 12648
4 Ga0070680_100004960 3300005336 Bacteria 10024
5 Ga0070682_100003079 3300005337 Bacteria 9233
6 Ga0068868_100011866 3300005338 Bacteria 6354
7 Ga0070660_100001517 3300005339 Bacteria 15917
8 Ga0070660_100001690 3300005339 Bacteria 15140
9 Ga0070660_100006571 3300005339 Bacteria 8065
10 Ga0070660_100006644 3300005339 Bacteria 8022
11 Ga0070661_100018546 3300005344 Bacteria 4948
12 Ga0070703_10001072 3300005406 Bacteria 8529
13 Ga0070713_100009683 3300005436 Bacteria 6918
14 Ga0070711_100008245 3300005439 Bacteria 6374
15 Ga0070705_100002476 3300005440 Bacteria 9279
16 Ga0070694_100016971 3300005444 Bacteria 4593
17 Ga0070708_100018996 3300005445 Bacteria 5764
18 Ga0070678_100008675 3300005456 Bacteria 6100
19 Ga0070662_100004082 3300005457 Bacteria 9172
20 Ga0070662_100008123 3300005457 Bacteria 6836
21 Ga0070681_10001213 3300005458 Bacteria 22417
22 Ga0070681_10002017 3300005458 Bacteria 18379
23 Ga0070681_10050602 3300005458 Bacteria 4145
24 Ga0070679_100062071 3300005530 Bacteria 3725
25 Ga0070684_100001782 3300005535 Bacteria 15731
26 Ga0070684_100010222 3300005535 Bacteria 7427
27 Ga0070684_100013717 3300005535 Bacteria 6540
28 Ga0070696_100003439 3300005546 Bacteria 10545
29 Ga0068855_100016384 3300005563 Bacteria 8910
30 Ga0068855_100061277 3300005563 Bacteria 4396
31 Ga0068857_100011566 3300005577 Bacteria 7676
32 Ga0068861_100031952 3300005719 Bacteria 3872
33 Ga0068858_100035617 3300005842 Bacteria 4616
34 Ga0081455_10002421 3300005937 Bacteria 22252
35 Ga0081455_10017969 3300005937 Bacteria 6755
36 Ga0081455_10048306 3300005937 Bacteria 3678
37 Ga0081538_10000136 3300005981 Bacteria 76141
38 Ga0081538_10000303 3300005981 Bacteria 56689
39 Ga0081538_10010518 3300005981 Bacteria 7586
40 Ga0081540_1014279 3300005983 Bacteria 5099
41 Ga0081539_10000041 3300005985 Bacteria 292660
42 Ga0081539_10001999 3300005985 Bacteria 30965
43 Ga0081539_10007768 3300005985 Bacteria 9606
44 Ga0070717_10039591 3300006028 Bacteria 3836
45 Ga0070715_10007344 3300006163 Bacteria 3791
46 Ga0075428_100016394 3300006844 Bacteria 8188
47 Ga0075431_100016760 3300006847 Bacteria 7441
48 Ga0075433_10005704 3300006852 Bacteria 9790
49 Ga0075434_100009252 3300006871 Bacteria 9180
50 Ga0075434_100010410 3300006871 Bacteria 8717
51 Ga0075429_100022732 3300006880 Bacteria 5436
52 Ga0075436_100015281 3300006914 Bacteria 5257
53 Ga0105240_10087055 3300009093 Bacteria 3826
54 Ga0114129_10005545 3300009147 Bacteria 17850
55 Ga0114129_10010084 3300009147 Bacteria 13469
56 Ga0114129_10011714 3300009147 Bacteria 12480
57 Ga0105241_10010596 3300009174 Bacteria 6762
58 Ga0105242_10021052 3300009176 Bacteria 5116
59 Ga0105237_10019405 3300009545 Bacteria 7021
60 Ga0105238_10019876 3300009551 Bacteria 6836
61 Ga0157370_10008703 3300013104 Bacteria 10922
62 Ga0157370_10008884 3300013104 Bacteria 10799
63 Ga0157369_10002394 3300013105 Bacteria 22528
64 Ga0157369_10003170 3300013105 Bacteria 19626
65 Ga0157369_10006425 3300013105 Bacteria 13626
66 Ga0157372_10126534 3300013307 Bacteria 2938
67 Ga0157375_10012577 3300013308 Bacteria 7510
68 Ga0157375_10046248 3300013308 Bacteria 4241
69 Ga0207707_10008180 3300025912 Bacteria 9075
70 Ga0207707_10015589 3300025912 Bacteria 6620
71 Ga0207707_10019358 3300025912 Bacteria 5942
72 Ga0207695_10028339 3300025913 Bacteria 6215
73 Ga0207693_10000495 3300025915 Bacteria 35594
74 Ga0207693_10001862 3300025915 Bacteria 18464
75 Ga0207693_10007873 3300025915 Bacteria 8752
76 Ga0207693_10031074 3300025915 Bacteria 4219
77 Ga0207663_10011227 3300025916 Bacteria 4803
78 Ga0207657_10000054 3300025919 Bacteria 106767
79 Ga0207657_10000651 3300025919 Bacteria 36939
80 Ga0207657_10000941 3300025919 Bacteria 30830
81 Ga0207657_10001857 3300025919 Bacteria 22817
82 Ga0207652_10017716 3300025921 Bacteria 5834
83 Ga0207700_10000006 3300025928 Bacteria 348187
84 Ga0207664_10005439 3300025929 Bacteria 8706
85 Ga0207709_10013070 3300025935 Bacteria 4576
86 Ga0207665_10000344 3300025939 Bacteria 32292
87 Ga0207708_10003668 3300026075 Bacteria 11337
88 Ga0207702_10015688 3300026078 Bacteria 6272
89 Ga0207648_10007291 3300026089 Bacteria 10900
90 Ga0207674_10003286 3300026116 Bacteria 19888
91 Ga0207674_10010978 3300026116 Bacteria 10193
92 Ga0207675_100000541 3300026118 Bacteria 36871
93 Ga0207683_10001247 3300026121 Bacteria 23079
94 Ga0207428_10009055 3300027907 Bacteria 8956
95 Ga0265338_10009155 3300028800 Bacteria 11881
96 Ga0265325_10011734 3300031241 Bacteria 5026
97 Ga0265314_10003849 3300031711 Bacteria 14308
98 Ga0307415_100000048 3300032126 Bacteria 51694
99 Ga0373938_0000556 3300034957 Bacteria 6024
100 Ga0373932_0002600 3300035112 Bacteria 4503
101 Ga0373936_0003231 3300035113 Bacteria 6115
102 Ga0373939_0000856 3300035114 Bacteria 7531
103 Ga0373945_0002165 3300035116 Bacteria 6128
104 Ga0373945_0003605 3300035116 Bacteria 4879
105 Ga0373956_0007986 3300035119 Bacteria 4278
106 Ga0373943_0000101 3300035170 Bacteria 31609
107 Ga0373961_0001787 3300035241 Bacteria 5926
108 Ga0373931_0000639 3300035691 Bacteria 14537
109 Ga0373947_0002740 3300035725 Bacteria 10558
110 Ga0373925_0001828 3300037068 Bacteria 17755
111 Ga0395899_0002274 3300037312 Bacteria 15695
112 Ga0395899_0004686 3300037312 Bacteria 10675
113 Ga0395899_0005493 3300037312 Bacteria 9825
114 Ga0395900_0007347 3300037418 Bacteria 11391
115 Ga0395900_0015578 3300037418 Bacteria 7750
116 Ga0395900_0073303 3300037418 Bacteria 3520
117 Ga0395898_0007850 3300037466 Bacteria 11324
118 Ga0395898_0012083 3300037466 Bacteria 8940
119 Ga0395898_0021158 3300037466 Bacteria 6598
120 Ga0395898_0024194 3300037466 Bacteria 6127
121 Ga0395905_0003114 3300037471 Bacteria 17897
122 Ga0395905_0007761 3300037471 Bacteria 10643
123 Ga0395905_0030415 3300037471 Bacteria 5088
124 Ga0395901_0001414 3300038443 Bacteria 25054
125 Ga0395901_0012827 3300038443 Bacteria 8501
126 Ga0395901_0045076 3300038443 Bacteria 4575
127 Ga0395901_0048894 3300038443 Bacteria 4392
128 Ga0436360_0268799 3300039438 Bacteria 3833
129 Ga0451839_0533068 3300041496 Bacteria 8559
130 Ga0466969_0001441 3300044656 Bacteria 12788
131 Ga0466966_0002588 3300044684 Bacteria 11853
132 Ga0466966_0026762 3300044684 Bacteria 3764
133 Ga0466961_0009429 3300044693 Bacteria 6213
134 Ga0466961_0014344 3300044693 Bacteria 5085
135 Ga0466963_0000451 3300044694 Bacteria 19022
136 Ga0466963_0001690 3300044694 Bacteria 12019
137 Ga0466963_0002216 3300044694 Bacteria 10754
138 Ga0466963_0003477 3300044694 Bacteria 9033
139 Ga0466963_0004553 3300044694 Bacteria 8071
140 Ga0466963_0007356 3300044694 Bacteria 6558
141 Ga0466964_0000730 3300044706 Bacteria 10677
142 Ga0466971_0000282 3300044719 Bacteria 19481
143 Ga0466957_0021423 3300044842 Bacteria 3808
144 Ga0466959_0012579 3300045049 Bacteria 6120
145 Ga0466959_0021308 3300045049 Bacteria 4779
146 Ga0466958_0002307 3300045836 Bacteria 9518
147 Ga0466967_0000650 3300045976 Bacteria 17434
148 Ga0466967_0003105 3300045976 Bacteria 10682
149 Ga0466967_0003423 3300045976 Bacteria 10349
150 Ga0466967_0003600 3300045976 Bacteria 10171
151 Ga0466967_0007258 3300045976 Bacteria 7971
152 Ga0466967_0044852 3300045976 Bacteria 3838
153 Ga0466967_0052968 3300045976 Bacteria 3565
154 Ga0495592_0006313 3300046454 Bacteria 8823
155 Ga0495592_0032649 3300046454 Bacteria 3926
156 Ga0495629_0000670 3300046459 Bacteria 27725
157 Ga0495641_0000374 3300046461 Bacteria 37120
158 Ga0495641_0019253 3300046461 Bacteria 3498
159 Ga0495651_0004871 3300046462 Bacteria 10268
160 Ga0495582_0000124 3300046473 Bacteria 41197
161 Ga0495639_0000658 3300046475 Bacteria 15965
162 Ga0495608_0005935 3300046511 Bacteria 8686
163 Ga0495608_0012879 3300046511 Bacteria 5803
164 Ga0495628_0008852 3300046516 Bacteria 8615
165 Ga0495665_0000249 3300046531 Bacteria 27073
166 Ga0495640_0002423 3300046533 Bacteria 14977
167 Ga0495586_0011287 3300046535 Bacteria 4750
168 Ga0495667_0002537 3300046559 Bacteria 12191
169 Ga0495667_0020930 3300046559 Bacteria 4413
170 Ga0495667_0021038 3300046559 Bacteria 4400
171 Ga0495634_0014159 3300046642 Bacteria 5756
172 Ga0495647_0000689 3300046681 Bacteria 10082
173 Ga0495658_0000247 3300046683 Bacteria 30977
174 Ga0495613_0001393 3300046689 Bacteria 18401
175 Ga0495624_0016257 3300046690 Bacteria 5010
176 Ga0495581_0004417 3300047315 Bacteria 8130
177 Ga0495674_0044455 3300047319 Bacteria 3949
178 Ga0495676_0001077 3300047321 Bacteria 23118
179 Ga0495680_0000743 3300047322 Bacteria 36546
180 Ga0495680_0003365 3300047322 Bacteria 15791
181 Ga0495680_0013880 3300047322 Bacteria 7008
182 Ga0495675_0000878 3300047444 Bacteria 18381
183 Ga0495684_0001855 3300047471 Bacteria 16919
184 Ga0495684_0034247 3300047471 Bacteria 3897
185 Ga0495593_0004760 3300047673 Bacteria 8065
186 Ga0496102_0008396 3300048905 Bacteria 8847
187 Ga0496102_0054807 3300048905 Bacteria 3636
188 Ga0496103_0002427 3300048906 Bacteria 11726
189 Ga0496104_0000606 3300048907 Bacteria 30748
190 Ga0496104_0040551 3300048907 Bacteria 4364
191 Ga0496104_0047373 3300048907 Bacteria 4051
192 Ga0496105_0000182 3300048908 Bacteria 41923
193 Ga0496105_0008541 3300048908 Bacteria 7957
194 Ga0496105_0028828 3300048908 Bacteria 4541
195 Ga0496106_0006529 3300048909 Bacteria 8634
196 Ga0496107_0006368 3300048910 Bacteria 8115
197 Ga0496108_0002961 3300048911 Bacteria 13659
198 Ga0496108_0051817 3300048911 Bacteria 3438
199 Ga0496109_0000403 3300048912 Bacteria 39012
200 Ga0496109_0000626 3300048912 Bacteria 29449
201 Ga0496109_0002273 3300048912 Bacteria 15968
202 Ga0496109_0043868 3300048912 Bacteria 4054
203 Ga0496110_0000261 3300048913 Bacteria 34222
204 Ga0496110_0000581 3300048913 Bacteria 25064
205 Ga0496110_0022132 3300048913 Bacteria 5393
206 Ga0496110_0031649 3300048913 Bacteria 4565
207 Ga0496111_0000076 3300048914 Bacteria 40931
208 Ga0496111_0000086 3300048914 Bacteria 39141
209 Ga0496111_0005084 3300048914 Bacteria 8368
210 Ga0496112_0006274 3300048915 Bacteria 10426
211 Ga0496112_0010827 3300048915 Bacteria 8297
212 Ga0496114_0000690 3300048917 Bacteria 25130
213 Ga0496114_0004673 3300048917 Bacteria 10646
214 Ga0496114_0005312 3300048917 Bacteria 10066
215 Ga0496114_0005352 3300048917 Bacteria 10033
216 Ga0496114_0026913 3300048917 Bacteria 4711
217 Ga0496114_0032571 3300048917 Bacteria 4291
218 Ga0496115_0006197 3300048918 Bacteria 8747
219 Ga0496115_0013124 3300048918 Bacteria 6257
220 Ga0501032_0002549 3300049569 Bacteria 14258
221 Ga0501034_0005171 3300049571 Bacteria 14311
222 Ga0501038_0000324 3300049574 Bacteria 41091
223 Ga0501041_0000022 3300049577 Bacteria 52719
224 Ga0501043_0001346 3300049579 Bacteria 21514
225 Ga0501043_0006798 3300049579 Bacteria 9130
226 Ga0501046_0003365 3300049580 Bacteria 14690
227 Ga0501047_0000555 3300049581 Bacteria 40171
228 Ga0501067_0002100 3300049583 Bacteria 10972
229 Ga0501067_0005473 3300049583 Bacteria 7044
230 Ga0501068_0000275 3300049584 Bacteria 25451
231 Ga0501068_0017555 3300049584 Bacteria 4139
232 Ga0501069_0008355 3300049585 Bacteria 5437
233 Ga0501070_0000187 3300049586 Bacteria 58257
234 Ga0501071_0000004 3300049587 Bacteria 79181
235 Ga0501072_0001036 3300049588 Bacteria 20575
236 Ga0501073_0001183 3300049589 Bacteria 19046
237 Ga0501074_0004073 3300049590 Bacteria 10427
238 Ga0501076_0000224 3300049592 Bacteria 34195
239 Ga0501080_0000858 3300049742 Bacteria 24882
240 Ga0501081_0000284 3300049743 Bacteria 26831
241 Ga0501081_0026867 3300049743 Bacteria 3884
242 Ga0501045_0000014 3300049824 Bacteria 73464
243 Ga0501045_0000729 3300049824 Bacteria 20961
244 nmdc:mga05p37_13459_c1 3300050507 Bacteria 9803
245 nmdc:mga05p37_38036_c1 3300050507 Bacteria 5902
246 nmdc:mga05p37_9218_c1 3300050507 Bacteria 11663
247 nmdc:mga09592_1338_c1 3300050508 Bacteria 19735
248 nmdc:mga0qj67_23916_c1 3300050509 Bacteria 4705
249 nmdc:mga06r32_17415_c1 3300050510 Bacteria 6557
250 nmdc:mga08y16_30466_c2 3300050511 Bacteria 4647
251 nmdc:mga08y16_62831_c1 3300050511 Bacteria 3878
252 nmdc:mga08y16_8024_c1 3300050511 Bacteria 11044
253 nmdc:mga0n895_25434_c1 3300050512 Bacteria 5593
254 nmdc:mga0n895_67132_c1 3300050512 Bacteria 3552
255 nmdc:mga0a205_59360_c1 3300050515 Bacteria 3695
256 Ga0495619_0008857 3300053085 Bacteria 6362
257 Ga0501084_0000228 3300054114 Bacteria 42475
258 Ga0466962_0001189 3300061719 Bacteria 11991
259 Ga0530510_0024040 3300061734 Bacteria 4346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10126534 Ga0157372_101265341 843
2 3300048912 Ga0496109_0043868 Ga0496109_0043868_20_2620 854
3 3300048907 Ga0496104_0040551 Ga0496104_0040551_1735_4347 858
4 3300049743 Ga0501081_0026867 Ga0501081_0026867_39_2978 899
5 3300046461 Ga0495641_0019253 Ga0495641_0019253_692_3421 909
6 3300005329 Ga0070683_100003577 Ga0070683_1000035777 949
7 3300005336 Ga0070680_100004960 Ga0070680_1000049603 949
8 3300005338 Ga0068868_100011866 Ga0068868_1000118663 949
9 3300005535 Ga0070684_100010222 Ga0070684_1000102226 949
10 3300048905 Ga0496102_0008396 Ga0496102_0008396_2848_5706 949
11 3300048917 Ga0496114_0005312 Ga0496114_0005312_2048_4906 949
12 3300048918 Ga0496115_0013124 Ga0496115_0013124_341_3199 949
13 3300048915 Ga0496112_0006274 Ga0496112_0006274_543_3584 951
14 3300005456 Ga0070678_100008675 Ga0070678_1000086755 978
15 3300048917 Ga0496114_0000690 Ga0496114_0000690_2040_4985 978
16 3300006914 Ga0075436_100015281 Ga0075436_1000152813 985
17 3300005457 Ga0070662_100004082 Ga0070662_1000040825 986
18 3300005983 Ga0081540_1014279 Ga0081540_10142792 986
19 3300009176 Ga0105242_10021052 Ga0105242_100210524 986
20 3300013308 Ga0157375_10012577 Ga0157375_100125773 986
21 3300025915 Ga0207693_10031074 Ga0207693_100310743 986
22 3300025929 Ga0207664_10005439 Ga0207664_100054397 986
23 3300026075 Ga0207708_10003668 Ga0207708_100036684 986
24 3300026078 Ga0207702_10015688 Ga0207702_100156882 986
25 3300026089 Ga0207648_10007291 Ga0207648_100072914 986
26 3300027907 Ga0207428_10009055 Ga0207428_100090552 986
27 3300037418 Ga0395900_0007347 Ga0395900_0007347_384_3422 986
28 3300047315 Ga0495581_0004417 Ga0495581_0004417_5152_8112 986
29 3300047321 Ga0495676_0001077 Ga0495676_0001077_20017_22977 986
30 3300048905 Ga0496102_0054807 Ga0496102_0054807_513_3551 986
31 3300005546 Ga0070696_100003439 Ga0070696_1000034397 992
32 3300025935 Ga0207709_10013070 Ga0207709_100130702 992
33 3300006847 Ga0075431_100016760 Ga0075431_1000167602 1015
34 3300006852 Ga0075433_10005704 Ga0075433_1000570411 1015
35 3300009174 Ga0105241_10010596 Ga0105241_100105966 1023
36 3300025915 Ga0207693_10001862 Ga0207693_1000186221 1023
37 3300025939 Ga0207665_10000344 Ga0207665_100003445 1023
38 3300048906 Ga0496103_0002427 Ga0496103_0002427_7320_10529 1023
39 3300037466 Ga0395898_0007850 Ga0395898_0007850_3466_6651 1026
40 3300038443 Ga0395901_0001414 Ga0395901_0001414_18015_21200 1026
41 3300006844 Ga0075428_100016394 Ga0075428_1000163946 1028
42 3300009147 Ga0114129_10011714 Ga0114129_100117147 1028
43 3300050507 nmdc:mga05p37_9218_c1 nmdc:mga05p37_9218_c1_3179_6379 1028
44 3300050509 nmdc:mga0qj67_23916_c1 nmdc:mga0qj67_23916_c1_230_3430 1028
45 3300006163 Ga0070715_10007344 Ga0070715_100073442 1029
46 3300026121 Ga0207683_10001247 Ga0207683_1000124713 1029
47 3300044694 Ga0466963_0001690 Ga0466963_0001690_8660_11953 1029
48 3300050510 nmdc:mga06r32_17415_c1 nmdc:mga06r32_17415_c1_964_4254 1031
49 3300009147 Ga0114129_10010084 Ga0114129_100100848 1033
50 3300050507 nmdc:mga05p37_38036_c1 nmdc:mga05p37_38036_c1_2479_5769 1033
51 3300050511 nmdc:mga08y16_62831_c1 nmdc:mga08y16_62831_c1_337_3627 1033
52 3300005337 Ga0070682_100003079 Ga0070682_1000030795 1036
53 3300005339 Ga0070660_100006571 Ga0070660_1000065717 1036
54 3300048907 Ga0496104_0047373 Ga0496104_0047373_391_3684 1036
55 3300048910 Ga0496107_0006368 Ga0496107_0006368_3103_6396 1036
56 3300048911 Ga0496108_0002961 Ga0496108_0002961_404_3697 1036
57 3300048912 Ga0496109_0002273 Ga0496109_0002273_678_3971 1036
58 3300005458 Ga0070681_10050602 Ga0070681_100506023 1038
59 3300025921 Ga0207652_10017716 Ga0207652_100177161 1038
60 3300037466 Ga0395898_0024194 Ga0395898_0024194_2807_5977 1038
61 3300037418 Ga0395900_0073303 Ga0395900_0073303_335_3487 1039
62 3300045976 Ga0466967_0003423 Ga0466967_0003423_1270_4479 1039
63 3300048907 Ga0496104_0000606 Ga0496104_0000606_2397_5606 1040
64 3300048908 Ga0496105_0000182 Ga0496105_0000182_25171_28380 1040
65 3300048912 Ga0496109_0000403 Ga0496109_0000403_10004_13213 1040
66 3300048913 Ga0496110_0000581 Ga0496110_0000581_2412_5621 1040
67 3300048914 Ga0496111_0000076 Ga0496111_0000076_24130_27339 1040
68 3300048917 Ga0496114_0004673 Ga0496114_0004673_2152_5361 1040
69 3300048917 Ga0496114_0032571 Ga0496114_0032571_390_3587 1040
70 3300025912 Ga0207707_10015589 Ga0207707_100155893 1041
71 3300005457 Ga0070662_100008123 Ga0070662_1000081235 1042
72 3300005719 Ga0068861_100031952 Ga0068861_1000319522 1042
73 3300026118 Ga0207675_100000541 Ga0207675_10000054140 1042
74 3300028800 Ga0265338_10009155 Ga0265338_100091556 1042
75 3300046559 Ga0495667_0020930 Ga0495667_0020930_126_3479 1042
76 3300047471 Ga0495684_0001855 Ga0495684_0001855_12683_16036 1042
77 3300013105 Ga0157369_10006425 Ga0157369_100064254 1043
78 3300044694 Ga0466963_0002216 Ga0466963_0002216_5106_8330 1043
79 3300044694 Ga0466963_0007356 Ga0466963_0007356_2285_5497 1043
80 3300045836 Ga0466958_0002307 Ga0466958_0002307_3303_6527 1043
81 3300045976 Ga0466967_0044852 Ga0466967_0044852_307_3519 1043
82 3300049583 Ga0501067_0002100 Ga0501067_0002100_5296_8475 1043
83 3300049585 Ga0501069_0008355 Ga0501069_0008355_2142_5321 1043
84 3300050512 nmdc:mga0n895_67132_c1 nmdc:mga0n895_67132_c1_23_3244 1043
85 3300061734 Ga0530510_0024040 Ga0530510_0024040_204_3383 1043
86 3300035113 Ga0373936_0003231 Ga0373936_0003231_403_3585 1045
87 3300035116 Ga0373945_0003605 Ga0373945_0003605_422_3604 1045
88 3300048917 Ga0496114_0026913 Ga0496114_0026913_805_4158 1046
89 3300006871 Ga0075434_100010410 Ga0075434_1000104103 1047
90 3300031241 Ga0265325_10011734 Ga0265325_100117342 1047
91 3300031711 Ga0265314_10003849 Ga0265314_100038492 1047
92 3300050512 nmdc:mga0n895_25434_c1 nmdc:mga0n895_25434_c1_1162_4479 1047
93 3300050515 nmdc:mga0a205_59360_c1 nmdc:mga0a205_59360_c1_313_3630 1047
94 3300005577 Ga0068857_100011566 Ga0068857_1000115663 1049
95 3300005842 Ga0068858_100035617 Ga0068858_1000356173 1049
96 3300005937 Ga0081455_10002421 Ga0081455_100024219 1049
97 3300005985 Ga0081539_10001999 Ga0081539_1000199920 1049
98 3300026116 Ga0207674_10003286 Ga0207674_100032863 1049
99 3300032126 Ga0307415_100000048 Ga0307415_10000004836 1049
100 3300037312 Ga0395899_0002274 Ga0395899_0002274_10225_13422 1049
101 3300037312 Ga0395899_0005493 Ga0395899_0005493_2496_5693 1049
102 3300037418 Ga0395900_0015578 Ga0395900_0015578_156_3353 1049
103 3300037471 Ga0395905_0003114 Ga0395905_0003114_5214_8411 1049
104 3300038443 Ga0395901_0012827 Ga0395901_0012827_2996_6193 1049
105 3300048914 Ga0496111_0005084 Ga0496111_0005084_4188_7385 1049
106 3300049583 Ga0501067_0005473 Ga0501067_0005473_78_3284 1049
107 3300049584 Ga0501068_0017555 Ga0501068_0017555_748_3954 1049
108 3300050511 nmdc:mga08y16_30466_c2 nmdc:mga08y16_30466_c2_342_3557 1049
109 3300050511 nmdc:mga08y16_8024_c1 nmdc:mga08y16_8024_c1_4483_7698 1049
110 3300005981 Ga0081538_10000136 Ga0081538_1000013641 1050
111 3300005981 Ga0081538_10000303 Ga0081538_1000030352 1050
112 3300005981 Ga0081538_10010518 Ga0081538_100105184 1050
113 3300005985 Ga0081539_10000041 Ga0081539_10000041129 1050
114 3300006880 Ga0075429_100022732 Ga0075429_1000227322 1050
115 3300046642 Ga0495634_0014159 Ga0495634_0014159_377_3547 1050
116 3300048912 Ga0496109_0000626 Ga0496109_0000626_14755_17925 1050
117 3300048913 Ga0496110_0000261 Ga0496110_0000261_2788_5958 1050
118 3300048914 Ga0496111_0000086 Ga0496111_0000086_2083_5253 1050
119 3300048917 Ga0496114_0005352 Ga0496114_0005352_4628_7864 1050
120 3300049569 Ga0501032_0002549 Ga0501032_0002549_7189_10389 1050
121 3300049571 Ga0501034_0005171 Ga0501034_0005171_11018_14218 1050
122 3300049574 Ga0501038_0000324 Ga0501038_0000324_30329_33529 1050
123 3300049577 Ga0501041_0000022 Ga0501041_0000022_23264_26467 1050
124 3300049579 Ga0501043_0001346 Ga0501043_0001346_11619_14942 1050
125 3300049579 Ga0501043_0006798 Ga0501043_0006798_3907_7107 1050
126 3300049580 Ga0501046_0003365 Ga0501046_0003365_7521_10721 1050
127 3300049581 Ga0501047_0000555 Ga0501047_0000555_21717_25040 1050
128 3300049584 Ga0501068_0000275 Ga0501068_0000275_15194_18394 1050
129 3300049587 Ga0501071_0000004 Ga0501071_0000004_54935_58255 1050
130 3300049588 Ga0501072_0001036 Ga0501072_0001036_16268_19468 1050
131 3300049589 Ga0501073_0001183 Ga0501073_0001183_15103_18426 1050
132 3300049590 Ga0501074_0004073 Ga0501074_0004073_3548_6748 1050
133 3300049592 Ga0501076_0000224 Ga0501076_0000224_1172_4492 1050
134 3300049742 Ga0501080_0000858 Ga0501080_0000858_20941_24264 1050
135 3300049743 Ga0501081_0000284 Ga0501081_0000284_16379_19579 1050
136 3300049824 Ga0501045_0000014 Ga0501045_0000014_15238_18438 1050
137 3300049824 Ga0501045_0000729 Ga0501045_0000729_2893_6093 1050
138 3300050508 nmdc:mga09592_1338_c1 nmdc:mga09592_1338_c1_5303_8512 1050
139 3300054114 Ga0501084_0000228 Ga0501084_0000228_34627_37830 1050
140 3300005339 Ga0070660_100006644 Ga0070660_1000066444 1052
141 3300005530 Ga0070679_100062071 Ga0070679_1000620712 1052
142 3300005563 Ga0068855_100061277 Ga0068855_1000612773 1052
143 3300025913 Ga0207695_10028339 Ga0207695_100283394 1052
144 3300037466 Ga0395898_0012083 Ga0395898_0012083_1220_4426 1052
145 3300045976 Ga0466967_0052968 Ga0466967_0052968_83_3292 1052
146 3300046535 Ga0495586_0011287 Ga0495586_0011287_356_3643 1052
147 3300013308 Ga0157375_10046248 Ga0157375_100462482 1053
148 3300005327 Ga0070658_10013477 Ga0070658_100134774 1054
149 3300035119 Ga0373956_0007986 Ga0373956_0007986_837_4043 1054
150 3300046511 Ga0495608_0012879 Ga0495608_0012879_769_3975 1054
151 3300005937 Ga0081455_10048306 Ga0081455_100483062 1055
152 3300006871 Ga0075434_100009252 Ga0075434_1000092524 1055
153 3300044656 Ga0466969_0001441 Ga0466969_0001441_3209_6520 1055
154 3300045976 Ga0466967_0003105 Ga0466967_0003105_6921_10094 1055
155 3300005436 Ga0070713_100009683 Ga0070713_1000096833 1056
156 3300005937 Ga0081455_10017969 Ga0081455_100179691 1056
157 3300025928 Ga0207700_10000006 Ga0207700_10000006193 1056
158 3300035725 Ga0373947_0002740 Ga0373947_0002740_4777_8040 1056
159 3300039438 Ga0436360_0268799 Ga0436360_0268799_517_3795 1056
160 3300044684 Ga0466966_0026762 Ga0466966_0026762_18_3254 1056
161 3300044694 Ga0466963_0004553 Ga0466963_0004553_2059_5340 1056
162 3300045049 Ga0466959_0021308 Ga0466959_0021308_63_3299 1056
163 3300045976 Ga0466967_0000650 Ga0466967_0000650_5360_8611 1056
164 3300046454 Ga0495592_0006313 Ga0495592_0006313_4006_7287 1056
165 3300048913 Ga0496110_0031649 Ga0496110_0031649_596_3811 1056
166 3300041496 Ga0451839_0533068 Ga0451839_0533068_1905_5123 1057
167 3300044706 Ga0466964_0000730 Ga0466964_0000730_3890_7105 1057
168 3300045976 Ga0466967_0003600 Ga0466967_0003600_5762_8977 1057
169 3300005406 Ga0070703_10001072 Ga0070703_100010726 1058
170 3300005439 Ga0070711_100008245 Ga0070711_1000082455 1058
171 3300005440 Ga0070705_100002476 Ga0070705_1000024765 1058
172 3300005444 Ga0070694_100016971 Ga0070694_1000169713 1058
173 3300005985 Ga0081539_10007768 Ga0081539_100077682 1058
174 3300009147 Ga0114129_10005545 Ga0114129_100055453 1058
175 3300025915 Ga0207693_10000495 Ga0207693_1000049511 1058
176 3300025915 Ga0207693_10007873 Ga0207693_100078736 1058
177 3300025916 Ga0207663_10011227 Ga0207663_100112272 1058
178 3300025919 Ga0207657_10001857 Ga0207657_1000185716 1058
179 3300034957 Ga0373938_0000556 Ga0373938_0000556_177_3431 1058
180 3300035112 Ga0373932_0002600 Ga0373932_0002600_1129_4383 1058
181 3300035114 Ga0373939_0000856 Ga0373939_0000856_2901_6155 1058
182 3300035241 Ga0373961_0001787 Ga0373961_0001787_2195_5449 1058
183 3300035691 Ga0373931_0000639 Ga0373931_0000639_7010_10264 1058
184 3300037312 Ga0395899_0004686 Ga0395899_0004686_3252_6482 1058
185 3300037466 Ga0395898_0021158 Ga0395898_0021158_555_3785 1058
186 3300037471 Ga0395905_0007761 Ga0395905_0007761_3434_6664 1058
187 3300037471 Ga0395905_0030415 Ga0395905_0030415_806_4027 1058
188 3300038443 Ga0395901_0045076 Ga0395901_0045076_815_4045 1058
189 3300038443 Ga0395901_0048894 Ga0395901_0048894_931_4215 1058
190 3300048908 Ga0496105_0008541 Ga0496105_0008541_2600_5854 1058
191 3300048909 Ga0496106_0006529 Ga0496106_0006529_1399_4653 1058
192 3300048913 Ga0496110_0022132 Ga0496110_0022132_1845_5099 1058
193 3300048918 Ga0496115_0006197 Ga0496115_0006197_3649_6903 1058
194 3300050507 nmdc:mga05p37_13459_c1 nmdc:mga05p37_13459_c1_2555_5776 1058
195 3300005339 Ga0070660_100001690 Ga0070660_10000169012 1059
196 3300005344 Ga0070661_100018546 Ga0070661_1000185462 1059
197 3300005458 Ga0070681_10001213 Ga0070681_1000121323 1059
198 3300009545 Ga0105237_10019405 Ga0105237_100194055 1059
199 3300009551 Ga0105238_10019876 Ga0105238_100198763 1059
200 3300025912 Ga0207707_10008180 Ga0207707_100081804 1059
201 3300025919 Ga0207657_10000651 Ga0207657_100006518 1059
202 3300025919 Ga0207657_10000941 Ga0207657_1000094121 1059
203 3300026116 Ga0207674_10010978 Ga0207674_100109787 1059
204 3300044693 Ga0466961_0014344 Ga0466961_0014344_322_3504 1059
205 3300044694 Ga0466963_0000451 Ga0466963_0000451_11478_14672 1059
206 3300044694 Ga0466963_0003477 Ga0466963_0003477_3726_6908 1059
207 3300044719 Ga0466971_0000282 Ga0466971_0000282_13407_16589 1059
208 3300045049 Ga0466959_0012579 Ga0466959_0012579_2767_5949 1059
209 3300045976 Ga0466967_0007258 Ga0466967_0007258_2468_5647 1059
210 3300048908 Ga0496105_0028828 Ga0496105_0028828_607_3906 1059
211 3300048911 Ga0496108_0051817 Ga0496108_0051817_44_3343 1059
212 3300049586 Ga0501070_0000187 Ga0501070_0000187_30599_33922 1059
213 3300061719 Ga0466962_0001189 Ga0466962_0001189_3664_6846 1059
214 3300005445 Ga0070708_100018996 Ga0070708_1000189964 1060
215 3300005535 Ga0070684_100013717 Ga0070684_1000137173 1060
216 3300006028 Ga0070717_10039591 Ga0070717_100395912 1060
217 3300013104 Ga0157370_10008884 Ga0157370_100088848 1060
218 3300013105 Ga0157369_10002394 Ga0157369_1000239422 1060
219 3300013105 Ga0157369_10003170 Ga0157369_100031703 1060
220 3300035116 Ga0373945_0002165 Ga0373945_0002165_2531_5878 1060
221 3300035170 Ga0373943_0000101 Ga0373943_0000101_20033_23386 1060
222 3300037068 Ga0373925_0001828 Ga0373925_0001828_10414_13761 1060
223 3300044684 Ga0466966_0002588 Ga0466966_0002588_2049_5438 1060
224 3300044693 Ga0466961_0009429 Ga0466961_0009429_2819_6142 1060
225 3300044842 Ga0466957_0021423 Ga0466957_0021423_48_3371 1060
226 3300046454 Ga0495592_0032649 Ga0495592_0032649_590_3880 1060
227 3300046459 Ga0495629_0000670 Ga0495629_0000670_6885_10232 1060
228 3300046461 Ga0495641_0000374 Ga0495641_0000374_17363_20710 1060
229 3300046462 Ga0495651_0004871 Ga0495651_0004871_1705_4995 1060
230 3300046473 Ga0495582_0000124 Ga0495582_0000124_17283_20630 1060
231 3300046475 Ga0495639_0000658 Ga0495639_0000658_10068_13415 1060
232 3300046511 Ga0495608_0005935 Ga0495608_0005935_1705_4995 1060
233 3300046516 Ga0495628_0008852 Ga0495628_0008852_5300_8587 1060
234 3300046531 Ga0495665_0000249 Ga0495665_0000249_9892_13245 1060
235 3300046533 Ga0495640_0002423 Ga0495640_0002423_11535_14822 1060
236 3300046559 Ga0495667_0002537 Ga0495667_0002537_4961_8248 1060
237 3300046559 Ga0495667_0021038 Ga0495667_0021038_501_3848 1060
238 3300046681 Ga0495647_0000689 Ga0495647_0000689_4066_7413 1060
239 3300046683 Ga0495658_0000247 Ga0495658_0000247_20285_23632 1060
240 3300046689 Ga0495613_0001393 Ga0495613_0001393_3833_7180 1060
241 3300046690 Ga0495624_0016257 Ga0495624_0016257_1077_4424 1060
242 3300047319 Ga0495674_0044455 Ga0495674_0044455_308_3661 1060
243 3300047322 Ga0495680_0000743 Ga0495680_0000743_5062_8349 1060
244 3300047322 Ga0495680_0003365 Ga0495680_0003365_532_3822 1060
245 3300047322 Ga0495680_0013880 Ga0495680_0013880_334_3681 1060
246 3300047444 Ga0495675_0000878 Ga0495675_0000878_14540_17830 1060
247 3300047471 Ga0495684_0034247 Ga0495684_0034247_272_3619 1060
248 3300047673 Ga0495593_0004760 Ga0495593_0004760_521_3868 1060
249 3300048915 Ga0496112_0010827 Ga0496112_0010827_4993_8238 1060
250 3300053085 Ga0495619_0008857 Ga0495619_0008857_2558_5848 1060
251 3300005327 Ga0070658_10007457 Ga0070658_100074574 1061
252 3300005339 Ga0070660_100001517 Ga0070660_1000015177 1061
253 3300005458 Ga0070681_10002017 Ga0070681_100020173 1061
254 3300005535 Ga0070684_100001782 Ga0070684_1000017823 1061
255 3300005563 Ga0068855_100016384 Ga0068855_1000163845 1061
256 3300009093 Ga0105240_10087055 Ga0105240_100870552 1061
257 3300013104 Ga0157370_10008703 Ga0157370_100087035 1061
258 3300025912 Ga0207707_10019358 Ga0207707_100193586 1061
259 3300025919 Ga0207657_10000054 Ga0207657_1000005487 1061

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14579

HHH_6

Helix-hairpin-helix motif

851

933

0.97

PF07733

DNA_pol3_alpha

Bacterial DNA polymerase III alpha NTPase domain

335

604

0.93

PF17657

DNA_pol3_finger

Bacterial DNA polymerase III alpha subunit finger domain

607

778

0.92

PF02811

PHP

PHP domain

40

219

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gx9-assembly4.cif.gz_D crystal structure of a dna polymerase iii alpha-epsilon chimera 0.8855 3 254
4gx8-assembly1.cif.gz_A crystal structure of a dna polymerase iii alpha-epsilon chimera 0.8498 3 254
1n9w-assembly1.cif.gz_A crystal structure of the non-discriminating and archaeal-type aspartyl-trna synthetase from thermus thermophilus 0.8337 945 1035
1wyd-assembly1.cif.gz_A crystal structure of aspartyl-trna synthetase from sulfolobus tokodaii 0.814 946 1035
4gx9-assembly2.cif.gz_B crystal structure of a dna polymerase iii alpha-epsilon chimera 0.8131 3 254
ID Description Score Start End Superfamily
af_P9WNT7_7_294_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8955 2 255 3.20.20.140
af_Q9F1K0_916_986_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8881 978 1035 2.40.50.140
4gx9D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8855 3 254 3.20.20.140
af_P9WNT5_44_334_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.87 2 256 3.20.20.140
2hqaA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8659 1 255 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A3D2UGM7-F1-model_v4 OB domain-containing protein 0.9683 931 1035 GO:0003676
GO:0006260
GO:0008408
AF-A0A838PLA9-F1-model_v4 OB domain-containing protein 0.9496 960 1035 GO:0003676
AF-A0A6B2DA61-F1-model_v4 OB domain-containing protein 0.9467 946 1034 GO:0003676
AF-A0A538HP71-F1-model_v4 PHP domain-containing protein 0.9457 1 172 GO:0006260
GO:0008408
AF-A0A7R6YUP2-F1-model_v4 deleted 0.9435 953 1033

Feature Viewer

pLDDT pTM Quality
75.52 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map