F368974

General Info

Members Datasets Scaffolds Average Seq Length
259 152 518 368

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_033877|Ga0400483_033877_163_1395
Length 410
Sequence MNYSGLTKTFVFGIQIVRFILAYALFAERGVMNINKPTLLLDKNRAVRNIERMAKKAKKYNVRFRPHFKTHQAAHVGVWFREFGVSAITVSSLDMAWYFAQYGWKDITVAFPVNILEIEKINALAGDIHLHLLVESPEIVQFLEKRLLPGTFANIWIKIDTGYQRTGIEWHQFERTIDLANRVTQSKNLMLQGILTHAGQTYHARSKGEVQTMYTDTVTSMNVVRGQLGAEGFANLEISVGDTPGCSIVKNLGEVNEIRPGNFVFYDVMQLAIGACKQEDIAVAVACPVVAKHEERHELVLYGGAVHLSKESIAISPAGSAETAMYGYIVGPVLKQGKGLEQQGWGQIIEHTYVSKLSQEHGIVKTDQDFFQQVHIGDVLLVLPVHSCLTANLLRKYVILDGEVIAVMKV

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
125 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
139 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
140 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
152 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.93
Rhizosphere 92.28
Stem 0
Stem Tuber 0
Unclassified 9.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_033877 3300039062 Unclassified 2238
2 Ga0065704_10075347 3300005289 Bacteria 5644
3 Ga0065712_10135191 3300005290 Bacteria 1505
4 Ga0065715_10131781 3300005293 Unclassified 2002
5 Ga0065707_10097301 3300005295 Bacteria 3186
6 Ga0070676_10136596 3300005328 Bacteria 1556
7 Ga0070683_100000081 3300005329 Bacteria 64788
8 Ga0070670_100000649 3300005331 Bacteria 26996
9 Ga0070670_100093377 3300005331 Bacteria 2588
10 Ga0070677_10016981 3300005333 Bacteria 2599
11 Ga0068869_100032607 3300005334 Bacteria 3672
12 Ga0068869_100053405 3300005334 Bacteria 2938
13 Ga0070682_100000046 3300005337 Bacteria 130568
14 Ga0068868_100000096 3300005338 Bacteria 54365
15 Ga0068868_100000125 3300005338 Bacteria 48958
16 Ga0068868_100130272 3300005338 Bacteria 2058
17 Ga0070689_100007205 3300005340 Bacteria 7753
18 Ga0070661_100158843 3300005344 Bacteria 1711
19 Ga0070692_10004412 3300005345 Bacteria 5876
20 Ga0070675_100000002 3300005354 Bacteria 435215
21 Ga0070671_100264675 3300005355 Bacteria 1461
22 Ga0070674_100067629 3300005356 Bacteria 2513
23 Ga0070673_100058408 3300005364 Bacteria 3050
24 Ga0070659_100193705 3300005366 Bacteria 1671
25 Ga0070667_100026991 3300005367 Bacteria 4776
26 Ga0070667_100246112 3300005367 Bacteria 1597
27 Ga0070703_10000698 3300005406 Bacteria 11367
28 Ga0070701_10030286 3300005438 Bacteria 2676
29 Ga0070700_100000038 3300005441 Bacteria 109438
30 Ga0070700_100003211 3300005441 Bacteria 8400
31 Ga0070678_100087286 3300005456 Bacteria 2382
32 Ga0070678_100153885 3300005456 Bacteria 1855
33 Ga0070681_10283811 3300005458 Bacteria 1566
34 Ga0070685_10022423 3300005466 Bacteria 3442
35 Ga0070706_100013800 3300005467 Bacteria 7469
36 Ga0070698_100314421 3300005471 Bacteria 1497
37 Ga0070699_100008127 3300005518 Bacteria 9111
38 Ga0070684_100000199 3300005535 Bacteria 42004
39 Ga0070684_100318914 3300005535 Bacteria 1427
40 Ga0068853_100114943 3300005539 Bacteria 2394
41 Ga0070672_100000427 3300005543 Bacteria 24573
42 Ga0070672_100097897 3300005543 Unclassified 2375
43 Ga0068855_100076169 3300005563 Bacteria 3894
44 Ga0070664_100352839 3300005564 Bacteria 1338
45 Ga0068857_100022333 3300005577 Bacteria 5566
46 Ga0068857_100325770 3300005577 Bacteria 1419
47 Ga0068854_100001019 3300005578 Bacteria 16812
48 Ga0068854_100053959 3300005578 Bacteria 2889
49 Ga0068852_100215699 3300005616 Unclassified 1823
50 Ga0068859_100054322 3300005617 Bacteria 4028
51 Ga0068859_100257529 3300005617 Unclassified 1836
52 Ga0068859_100283459 3300005617 Unclassified 1750
53 Ga0068864_100000022 3300005618 Bacteria 261941
54 Ga0068861_100135554 3300005719 Bacteria 2003
55 Ga0068870_10061811 3300005840 Unclassified 2015
56 Ga0068858_100003174 3300005842 Bacteria 16455
57 Ga0068858_100049967 3300005842 Bacteria 3872
58 Ga0068858_100409444 3300005842 Bacteria 1303
59 Ga0068860_100008692 3300005843 Bacteria 10118
60 Ga0068860_100121488 3300005843 Bacteria 2501
61 Ga0068860_100166788 3300005843 Bacteria 2126
62 Ga0070717_10000026 3300006028 Bacteria 150967
63 Ga0097621_100209090 3300006237 Bacteria 1697
64 Ga0075428_100005638 3300006844 Bacteria 13913
65 Ga0075428_100009957 3300006844 Bacteria 10562
66 Ga0075428_100037617 3300006844 Bacteria 5326
67 Ga0075430_100044663 3300006846 Bacteria 3745
68 Ga0075430_100203853 3300006846 Bacteria 1642
69 Ga0075431_100006129 3300006847 Bacteria 11932
70 Ga0075433_10016716 3300006852 Bacteria 6057
71 Ga0075434_100049132 3300006871 Unclassified 4188
72 Ga0068865_100032901 3300006881 Bacteria 3469
73 Ga0075436_100009642 3300006914 Bacteria 6608
74 Ga0097620_100054322 3300006931 Bacteria 4028
75 Ga0097620_100257524 3300006931 Unclassified 1836
76 Ga0097620_100283444 3300006931 Unclassified 1750
77 Ga0075435_100000195 3300007076 Bacteria 36669
78 Ga0075435_100145471 3300007076 Bacteria 1991
79 Ga0111539_10000023 3300009094 Bacteria 211802
80 Ga0111539_10074782 3300009094 Bacteria 3992
81 Ga0105245_10000226 3300009098 Bacteria 53639
82 Ga0105247_10057619 3300009101 Unclassified 2403
83 Ga0114129_10346656 3300009147 Bacteria 1968
84 Ga0105243_10000978 3300009148 Bacteria 26597
85 Ga0105241_10124907 3300009174 Unclassified 2077
86 Ga0105242_10014221 3300009176 Bacteria 6162
87 Ga0105242_10018845 3300009176 Bacteria 5403
88 Ga0105248_10449676 3300009177 Bacteria 1452
89 Ga0105238_10000001 3300009551 Bacteria 2036163
90 Ga0105249_10037843 3300009553 Bacteria 4378
91 Ga0105249_10130119 3300009553 Bacteria 2402
92 Ga0157369_10005044 3300013105 Bacteria 15457
93 Ga0157369_10087137 3300013105 Bacteria 3334
94 Ga0157374_10000012 3300013296 Bacteria 462353
95 Ga0157378_10000896 3300013297 Bacteria 27436
96 Ga0157378_10001104 3300013297 Bacteria 24588
97 Ga0157378_10020631 3300013297 Bacteria 5796
98 Ga0157378_10060411 3300013297 Bacteria 3383
99 Ga0163162_10308023 3300013306 Bacteria 1716
100 Ga0157372_10139330 3300013307 Unclassified 2794
101 Ga0157375_10000008 3300013308 Bacteria 373560
102 Ga0157375_10000019 3300013308 Bacteria 285083
103 Ga0157375_10001040 3300013308 Bacteria 23960
104 Ga0157375_10558899 3300013308 Bacteria 1305
105 Ga0163163_10030169 3300014325 Bacteria 5221
106 Ga0157377_10000002 3300014745 Bacteria 473827
107 Ga0157377_10000190 3300014745 Bacteria 34956
108 Ga0157379_10173631 3300014968 Bacteria 1946
109 Ga0157376_10000025 3300014969 Bacteria 214212
110 Ga0163161_10065675 3300017792 Bacteria 2648
111 Ga0213873_10000005 3300021358 Bacteria 416778
112 Ga0213876_10000010 3300021384 Bacteria 492549
113 Ga0213876_10000080 3300021384 Bacteria 109125
114 Ga0213876_10033992 3300021384 Bacteria 2688
115 Ga0207643_10040009 3300025908 Bacteria 2638
116 Ga0207707_10003990 3300025912 Bacteria 13100
117 Ga0207707_10081521 3300025912 Bacteria 2824
118 Ga0207660_10006539 3300025917 Bacteria 7560
119 Ga0207660_10118596 3300025917 Bacteria 2002
120 Ga0207649_10012040 3300025920 Bacteria 4786
121 Ga0207694_10000001 3300025924 Bacteria 4078485
122 Ga0207650_10000246 3300025925 Bacteria 59234
123 Ga0207650_10057338 3300025925 Bacteria 2897
124 Ga0207650_10141069 3300025925 Bacteria 1894
125 Ga0207659_10000005 3300025926 Bacteria 405839
126 Ga0207687_10000003 3300025927 Bacteria 875159
127 Ga0207700_10028739 3300025928 Bacteria 3915
128 Ga0207644_10035176 3300025931 Bacteria 3508
129 Ga0207690_10231738 3300025932 Bacteria 1418
130 Ga0207709_10000724 3300025935 Bacteria 26467
131 Ga0207669_10054292 3300025937 Bacteria 2419
132 Ga0207691_10001093 3300025940 Bacteria 26959
133 Ga0207711_10010303 3300025941 Bacteria 7764
134 Ga0207661_10000001 3300025944 Bacteria 937688
135 Ga0207712_10022883 3300025961 Bacteria 4120
136 Ga0207640_10000900 3300025981 Bacteria 16821
137 Ga0207658_10124073 3300025986 Bacteria 2064
138 Ga0207677_10000007 3300026023 Bacteria 274553
139 Ga0207677_10000424 3300026023 Bacteria 28470
140 Ga0207677_10121371 3300026023 Bacteria 1966
141 Ga0207703_10000081 3300026035 Bacteria 111679
142 Ga0207703_10212938 3300026035 Bacteria 1724
143 Ga0207678_10118665 3300026067 Unclassified 2257
144 Ga0207708_10000001 3300026075 Bacteria 467100
145 Ga0207708_10005525 3300026075 Bacteria 9328
146 Ga0207676_10000029 3300026095 Bacteria 232795
147 Ga0207676_10057032 3300026095 Bacteria 3074
148 Ga0207674_10037727 3300026116 Bacteria 5022
149 Ga0207674_10223109 3300026116 Bacteria 1833
150 Ga0207683_10184010 3300026121 Bacteria 1895
151 Ga0207683_10254567 3300026121 Unclassified 1602
152 Ga0207698_10088138 3300026142 Bacteria 2530
153 Ga0207428_10000003 3300027907 Bacteria 799783
154 Ga0268264_10005027 3300028381 Bacteria 11193
155 Ga0268264_10017632 3300028381 Bacteria 5846
156 Ga0268264_10213288 3300028381 Bacteria 1773
157 Ga0307511_10008760 3300030521 Bacteria 10112
158 Ga0316576_10002438 3300031727 Bacteria 10576
159 Ga0316576_10023075 3300031727 Bacteria 4331
160 Ga0316576_10132978 3300031727 Bacteria 1872
161 Ga0307405_10007503 3300031731 Bacteria 5461
162 Ga0307405_10011591 3300031731 Viruses 4631
163 Ga0307413_10016225 3300031824 Unclassified 3840
164 Ga0307413_10022641 3300031824 Viruses 3390
165 Ga0307413_10025591 3300031824 Bacteria 3237
166 Ga0307410_10007093 3300031852 Bacteria 6109
167 Ga0307410_10007581 3300031852 Bacteria 5952
168 Ga0307410_10010979 3300031852 Bacteria 5158
169 Ga0307410_10012667 3300031852 Bacteria 4886
170 Ga0307410_10015626 3300031852 Bacteria 4509
171 Ga0307406_10006051 3300031901 Bacteria 6647
172 Ga0307406_10010291 3300031901 Bacteria 5271
173 Ga0307406_10043394 3300031901 Bacteria 2812
174 Ga0307407_10002694 3300031903 Bacteria 7042
175 Ga0307407_10007338 3300031903 Unclassified 4985
176 Ga0307407_10011001 3300031903 Bacteria 4288
177 Ga0307407_10020060 3300031903 Unclassified 3416
178 Ga0307409_100013113 3300031995 Bacteria 5317
179 Ga0307409_100019678 3300031995 Unclassified 4578
180 Ga0307409_100095782 3300031995 Bacteria 2446
181 Ga0307416_100034611 3300032002 Bacteria 3846
182 Ga0307414_10006514 3300032004 Bacteria 6512
183 Ga0307411_10009711 3300032005 Bacteria 5080
184 Ga0307411_10013432 3300032005 Bacteria 4518
185 Ga0307411_10076472 3300032005 Bacteria 2289
186 Ga0307411_10129094 3300032005 Bacteria 1844
187 Ga0307415_100009859 3300032126 Bacteria 5382
188 Ga0307415_100045614 3300032126 Bacteria 2940
189 Ga0307415_100131949 3300032126 Bacteria 1893
190 Ga0373932_0000174 3300035112 Bacteria 18841
191 Ga0373943_0025218 3300035170 Bacteria 2778
192 Ga0316574_0008501 3300035398 Bacteria 5706
193 Ga0316574_0025019 3300035398 Bacteria 3580
194 Ga0316574_0158394 3300035398 Bacteria 1459
195 Ga0316584_0129293 3300036712 Bacteria 1886
196 Ga0400484_31181 3300038725 Bacteria 2155
197 Ga0400483_190087 3300039062 Bacteria 4601
198 Ga0400489_82204 3300039093 Bacteria 5443
199 Ga0436365_0240416 3300039437 Bacteria 51417
200 Ga0436365_0460549 3300039437 Bacteria 1426
201 Ga0436365_0787304 3300039437 Bacteria 1176
202 Ga0436365_0798587 3300039437 Bacteria 5491
203 Ga0436365_0920940 3300039437 Bacteria 26029
204 Ga0436365_1414701 3300039437 Bacteria 6894
205 Ga0436362_0273161 3300039453 Bacteria 561309
206 Ga0451577_0000585 3300042876 Bacteria 58478
207 Ga0451577_0000854 3300042876 Bacteria 45411
208 Ga0451577_0007394 3300042876 Bacteria 10783
209 Ga0451577_0011923 3300042876 Bacteria 8195
210 Ga0451577_0057469 3300042876 Bacteria 3468
211 Ga0451577_0170239 3300042876 Bacteria 1963
212 Ga0453683_0000241 3300044673 Bacteria 72899
213 Ga0453683_0000482 3300044673 Bacteria 45741
214 Ga0453683_0007451 3300044673 Bacteria 7422
215 Ga0453683_0017171 3300044673 Bacteria 4663
216 Ga0453683_0037029 3300044673 Bacteria 3069
217 Ga0453683_0116313 3300044673 Bacteria 1682
218 Ga0453684_0001022 3300044712 Bacteria 89958
219 Ga0453684_0001284 3300044712 Bacteria 74993
220 Ga0453684_0001358 3300044712 Bacteria 71434
221 Ga0453684_0001730 3300044712 Bacteria 58478
222 Ga0453684_0003229 3300044712 Bacteria 37305
223 Ga0453684_0005462 3300044712 Bacteria 25166
224 Ga0453684_0007417 3300044712 Bacteria 20179
225 Ga0453684_0007452 3300044712 Bacteria 20097
226 Ga0453684_0011563 3300044712 Bacteria 14757
227 Ga0453684_0091781 3300044712 Bacteria 3747
228 Ga0453684_0112711 3300044712 Bacteria 3301
229 Ga0453684_0355406 3300044712 Bacteria 1651
230 Ga0453684_0538426 3300044712 Unclassified 1288
231 Ga0451576_0000599 3300045051 Bacteria 76070
232 Ga0451576_0000860 3300045051 Bacteria 58751
233 Ga0451576_0001055 3300045051 Bacteria 50745
234 Ga0451576_0007257 3300045051 Bacteria 13325
235 Ga0451576_0017553 3300045051 Bacteria 7864
236 Ga0451576_0094929 3300045051 Bacteria 3102
237 Ga0451576_0122197 3300045051 Unclassified 2711
238 Ga0496100_0013065 3300048903 Bacteria 4779
239 Ga0496106_0046527 3300048909 Bacteria 3262
240 Ga0496109_0118729 3300048912 Bacteria 2462
241 Ga0496110_0310009 3300048913 Bacteria 1438
242 Ga0496114_0060246 3300048917 Bacteria 3172
243 Ga0501073_0004314 3300049589 Bacteria 10672
244 Ga0501209_028410 3300049656 Unclassified 1398
245 Ga0501249_003469 3300049679 Viruses 3166
246 Ga0501257_025086 3300049686 Unclassified 1417
247 Ga0501080_0182038 3300049742 Bacteria 1933
248 Ga0501268_000621 3300049765 Bacteria 3978
249 nmdc:mga05p37_320339_c1 3300050507 Bacteria 1835
250 nmdc:mga0qj67_25066_c1 3300050509 Bacteria 4604
251 nmdc:mga06r32_5838_c1 3300050510 Bacteria 11079
252 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
253 nmdc:mga0n895_37397_c1 3300050512 Unclassified 4695
254 nmdc:mga0rr50_12257_c1 3300050513 Bacteria 5530
255 nmdc:mga0rr50_417_c1 3300050513 Bacteria 22990
256 nmdc:mga08x19_1047_c2 3300050514 Bacteria 6531
257 Ga0495601_0025506 3300053077 Bacteria 3646
258 2839992537 2839989709 Bacteria 3773432
259 2881716992 2881714928 Bacteria 2469486
260 Ga0400483_033877
261 Ga0065704_10075347
262 Ga0065712_10135191
263 Ga0065715_10131781
264 Ga0065707_10097301
265 Ga0070676_10136596
266 Ga0070683_100000081
267 Ga0070670_100000649
268 Ga0070670_100093377
269 Ga0070677_10016981
270 Ga0068869_100032607
271 Ga0068869_100053405
272 Ga0070682_100000046
273 Ga0068868_100000096
274 Ga0068868_100000125
275 Ga0068868_100130272
276 Ga0070689_100007205
277 Ga0070661_100158843
278 Ga0070692_10004412
279 Ga0070675_100000002
280 Ga0070671_100264675
281 Ga0070674_100067629
282 Ga0070673_100058408
283 Ga0070659_100193705
284 Ga0070667_100026991
285 Ga0070667_100246112
286 Ga0070703_10000698
287 Ga0070701_10030286
288 Ga0070700_100000038
289 Ga0070700_100003211
290 Ga0070678_100087286
291 Ga0070678_100153885
292 Ga0070681_10283811
293 Ga0070685_10022423
294 Ga0070706_100013800
295 Ga0070698_100314421
296 Ga0070699_100008127
297 Ga0070684_100000199
298 Ga0070684_100318914
299 Ga0068853_100114943
300 Ga0070672_100000427
301 Ga0070672_100097897
302 Ga0068855_100076169
303 Ga0070664_100352839
304 Ga0068857_100022333
305 Ga0068857_100325770
306 Ga0068854_100001019
307 Ga0068854_100053959
308 Ga0068852_100215699
309 Ga0068859_100054322
310 Ga0068859_100257529
311 Ga0068859_100283459
312 Ga0068864_100000022
313 Ga0068861_100135554
314 Ga0068870_10061811
315 Ga0068858_100003174
316 Ga0068858_100049967
317 Ga0068858_100409444
318 Ga0068860_100008692
319 Ga0068860_100121488
320 Ga0068860_100166788
321 Ga0070717_10000026
322 Ga0097621_100209090
323 Ga0075428_100005638
324 Ga0075428_100009957
325 Ga0075428_100037617
326 Ga0075430_100044663
327 Ga0075430_100203853
328 Ga0075431_100006129
329 Ga0075433_10016716
330 Ga0075434_100049132
331 Ga0068865_100032901
332 Ga0075436_100009642
333 Ga0097620_100054322
334 Ga0097620_100257524
335 Ga0097620_100283444
336 Ga0075435_100000195
337 Ga0075435_100145471
338 Ga0111539_10000023
339 Ga0111539_10074782
340 Ga0105245_10000226
341 Ga0105247_10057619
342 Ga0114129_10346656
343 Ga0105243_10000978
344 Ga0105241_10124907
345 Ga0105242_10014221
346 Ga0105242_10018845
347 Ga0105248_10449676
348 Ga0105238_10000001
349 Ga0105249_10037843
350 Ga0105249_10130119
351 Ga0157369_10005044
352 Ga0157369_10087137
353 Ga0157374_10000012
354 Ga0157378_10000896
355 Ga0157378_10001104
356 Ga0157378_10020631
357 Ga0157378_10060411
358 Ga0163162_10308023
359 Ga0157372_10139330
360 Ga0157375_10000008
361 Ga0157375_10000019
362 Ga0157375_10001040
363 Ga0157375_10558899
364 Ga0163163_10030169
365 Ga0157377_10000002
366 Ga0157377_10000190
367 Ga0157379_10173631
368 Ga0157376_10000025
369 Ga0163161_10065675
370 Ga0213873_10000005
371 Ga0213876_10000010
372 Ga0213876_10000080
373 Ga0213876_10033992
374 Ga0207643_10040009
375 Ga0207707_10003990
376 Ga0207707_10081521
377 Ga0207660_10006539
378 Ga0207660_10118596
379 Ga0207649_10012040
380 Ga0207694_10000001
381 Ga0207650_10000246
382 Ga0207650_10057338
383 Ga0207650_10141069
384 Ga0207659_10000005
385 Ga0207687_10000003
386 Ga0207700_10028739
387 Ga0207644_10035176
388 Ga0207690_10231738
389 Ga0207709_10000724
390 Ga0207669_10054292
391 Ga0207691_10001093
392 Ga0207711_10010303
393 Ga0207661_10000001
394 Ga0207712_10022883
395 Ga0207640_10000900
396 Ga0207658_10124073
397 Ga0207677_10000007
398 Ga0207677_10000424
399 Ga0207677_10121371
400 Ga0207703_10000081
401 Ga0207703_10212938
402 Ga0207678_10118665
403 Ga0207708_10000001
404 Ga0207708_10005525
405 Ga0207676_10000029
406 Ga0207676_10057032
407 Ga0207674_10037727
408 Ga0207674_10223109
409 Ga0207683_10184010
410 Ga0207683_10254567
411 Ga0207698_10088138
412 Ga0207428_10000003
413 Ga0268264_10005027
414 Ga0268264_10017632
415 Ga0268264_10213288
416 Ga0307511_10008760
417 Ga0316576_10002438
418 Ga0316576_10023075
419 Ga0316576_10132978
420 Ga0307405_10007503
421 Ga0307405_10011591
422 Ga0307413_10016225
423 Ga0307413_10022641
424 Ga0307413_10025591
425 Ga0307410_10007093
426 Ga0307410_10007581
427 Ga0307410_10010979
428 Ga0307410_10012667
429 Ga0307410_10015626
430 Ga0307406_10006051
431 Ga0307406_10010291
432 Ga0307406_10043394
433 Ga0307407_10002694
434 Ga0307407_10007338
435 Ga0307407_10011001
436 Ga0307407_10020060
437 Ga0307409_100013113
438 Ga0307409_100019678
439 Ga0307409_100095782
440 Ga0307416_100034611
441 Ga0307414_10006514
442 Ga0307411_10009711
443 Ga0307411_10013432
444 Ga0307411_10076472
445 Ga0307411_10129094
446 Ga0307415_100009859
447 Ga0307415_100045614
448 Ga0307415_100131949
449 Ga0373932_0000174
450 Ga0373943_0025218
451 Ga0316574_0008501
452 Ga0316574_0025019
453 Ga0316574_0158394
454 Ga0316584_0129293
455 Ga0400484_31181
456 Ga0400483_190087
457 Ga0400489_82204
458 Ga0436365_0240416
459 Ga0436365_0460549
460 Ga0436365_0787304
461 Ga0436365_0798587
462 Ga0436365_0920940
463 Ga0436365_1414701
464 Ga0436362_0273161
465 Ga0451577_0000585
466 Ga0451577_0000854
467 Ga0451577_0007394
468 Ga0451577_0011923
469 Ga0451577_0057469
470 Ga0451577_0170239
471 Ga0453683_0000241
472 Ga0453683_0000482
473 Ga0453683_0007451
474 Ga0453683_0017171
475 Ga0453683_0037029
476 Ga0453683_0116313
477 Ga0453684_0001022
478 Ga0453684_0001284
479 Ga0453684_0001358
480 Ga0453684_0001730
481 Ga0453684_0003229
482 Ga0453684_0005462
483 Ga0453684_0007417
484 Ga0453684_0007452
485 Ga0453684_0011563
486 Ga0453684_0091781
487 Ga0453684_0112711
488 Ga0453684_0355406
489 Ga0453684_0538426
490 Ga0451576_0000599
491 Ga0451576_0000860
492 Ga0451576_0001055
493 Ga0451576_0007257
494 Ga0451576_0017553
495 Ga0451576_0094929
496 Ga0451576_0122197
497 Ga0496100_0013065
498 Ga0496106_0046527
499 Ga0496109_0118729
500 Ga0496110_0310009
501 Ga0496114_0060246
502 Ga0501073_0004314
503 Ga0501209_028410
504 Ga0501249_003469
505 Ga0501257_025086
506 Ga0501080_0182038
507 Ga0501268_000621
508 nmdc:mga05p37_320339_c1
509 nmdc:mga0qj67_25066_c1
510 nmdc:mga06r32_5838_c1
511 nmdc:mga08y16_4_c1
512 nmdc:mga0n895_37397_c1
513 nmdc:mga0rr50_12257_c1
514 nmdc:mga0rr50_417_c1
515 nmdc:mga08x19_1047_c2
516 Ga0495601_0025506
517 2839992537
518 2881716992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14031

D-ser_dehydrat

Putative serine dehydratase domain

282

400

0.92

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

41

268

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wqf-assembly1.cif.gz_A d-threo-3-hydroxyaspartate dehydratase from delftia sp. ht23 in the metal-free form 0.9533 5 358
4pb3-assembly1.cif.gz_B d-threo-3-hydroxyaspartate dehydratase h351a mutant 0.9531 5 358
3llx-assembly1.cif.gz_A-2 crystal structure of an ala racemase-like protein (il1761) from idiomarina loihiensis at 1.50 a resolution 0.9516 2 357
3wqg-assembly1.cif.gz_A d-threo-3-hydroxyaspartate dehydratase c353a mutant in the metal-free form 0.9505 5 358
3wqf-assembly1.cif.gz_A d-threo-3-hydroxyaspartate dehydratase from delftia sp. ht23 in the metal-free form 0.9403 5 358
ID Description Score Start End Superfamily
3wqcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9561 16 236 3.20.20.10
3llxA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9494 16 236 3.20.20.10
3wqcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9437 16 236 3.20.20.10
af_Q54XE5_21_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9424 17 238 3.20.20.10
3llxA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9368 16 236 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A7W1W3Q9-F1-model_v4 Alanine racemase 0.9877 6 358 GO:0008721
GO:0036088
AF-A0A7W1LV49-F1-model_v4 Alanine racemase 0.9832 2 230 GO:0008721
GO:0036088
AF-A0A7V4SNH4-F1-model_v4 DSD1 family PLP-dependent enzyme 0.9759 6 358 GO:0008721
GO:0036088
AF-A0A7W1W3Q9-F1-model_v4 Alanine racemase 0.9713 6 358 GO:0008721
GO:0036088
AF-A0A6J4YT07-F1-model_v4 Low-specificity D-threonine aldolase 0.9699 1 358 GO:0008721
GO:0036088

Map