F369147

General Info

Members Datasets Scaffolds Average Seq Length
259 157 518 139

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_25184_c1|nmdc:mga0yw44_25184_c1_2876_3295
Length 126
Sequence VEGSDCLFCGIVAGEVPAQIVDSDEHTVAFMDINPATRGHALVVPRTHAADLFARRLARRLRTALKPDGFNVLNSCGAAAWQTVFHFHLHVVPRYEDDPLELPWTPSEGDADDIAAVADRIRGVGE

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.34
Nodule 0
Rhizoplane 11.58
Rhizosphere 80.69
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_25184_c1 3300050492 Bacteria 3379
2 Ga0070683_100038407 3300005329 Bacteria 4389
3 Ga0070690_100240775 3300005330 Bacteria 1276
4 Ga0070682_100093309 3300005337 Bacteria 1973
5 Ga0070682_100236682 3300005337 Bacteria 1309
6 Ga0068868_100025767 3300005338 Bacteria 4476
7 Ga0068868_100151767 3300005338 Bacteria 1908
8 Ga0070660_100001576 3300005339 Bacteria 15678
9 Ga0070689_100273206 3300005340 Bacteria 1400
10 Ga0070692_10011563 3300005345 Bacteria 4055
11 Ga0070692_10743660 3300005345 Bacteria 664
12 Ga0070675_100110947 3300005354 Bacteria 2320
13 Ga0070675_100405554 3300005354 Bacteria 1217
14 Ga0070674_101633560 3300005356 Bacteria 582
15 Ga0070659_100003244 3300005366 Bacteria 11575
16 Ga0070659_101002186 3300005366 Bacteria 733
17 Ga0070667_100216363 3300005367 Bacteria 1704
18 Ga0070662_100043823 3300005457 Bacteria 3203
19 Ga0068867_101633890 3300005459 Bacteria 603
20 Ga0068853_100005538 3300005539 Bacteria 9905
21 Ga0070686_100017850 3300005544 Bacteria 4153
22 Ga0070686_100022894 3300005544 Bacteria 3727
23 Ga0070695_100697984 3300005545 Bacteria 805
24 Ga0070696_100127182 3300005546 Bacteria 1850
25 Ga0070693_100010104 3300005547 Bacteria 4713
26 Ga0070704_100363800 3300005549 Bacteria 1224
27 Ga0070664_100008941 3300005564 Bacteria 8121
28 Ga0068857_100302464 3300005577 Bacteria 1475
29 Ga0070702_100026057 3300005615 Bacteria 3138
30 Ga0068859_100238102 3300005617 Bacteria 1909
31 Ga0068861_101696117 3300005719 Bacteria 625
32 Ga0068870_10046313 3300005840 Bacteria 2280
33 Ga0068860_100670925 3300005843 Bacteria 1045
34 Ga0081455_10140283 3300005937 Bacteria 1878
35 Ga0081455_10370393 3300005937 Bacteria 1004
36 Ga0081455_10606115 3300005937 Bacteria 713
37 Ga0081538_10000514 3300005981 Bacteria 43252
38 Ga0081538_10077189 3300005981 Bacteria 1795
39 Ga0070717_10262732 3300006028 Bacteria 1527
40 Ga0075365_10001124 3300006038 Bacteria 11686
41 Ga0075365_10006524 3300006038 Bacteria 6427
42 Ga0075365_10009261 3300006038 Bacteria 5649
43 Ga0075365_10180243 3300006038 Bacteria 1477
44 Ga0075365_10260973 3300006038 Bacteria 1218
45 Ga0075363_100008821 3300006048 Bacteria 4715
46 Ga0075363_100310363 3300006048 Bacteria 916
47 Ga0075364_10357178 3300006051 Bacteria 996
48 Ga0070716_100195470 3300006173 Bacteria 1340
49 Ga0070712_100158379 3300006175 Bacteria 1746
50 Ga0075367_10114918 3300006178 Bacteria 1655
51 Ga0075428_100043184 3300006844 Bacteria 4957
52 Ga0075431_100000075 3300006847 Bacteria 57994
53 Ga0075431_100228367 3300006847 Bacteria 1897
54 Ga0075434_100013845 3300006871 Bacteria 7693
55 Ga0075434_100351207 3300006871 Bacteria 1496
56 Ga0068865_100026040 3300006881 Bacteria 3853
57 Ga0097620_100238108 3300006931 Bacteria 1909
58 Ga0075435_100203729 3300007076 Bacteria 1677
59 Ga0111539_10010995 3300009094 Bacteria 11393
60 Ga0111539_10042135 3300009094 Bacteria 5486
61 Ga0105245_10002623 3300009098 Bacteria 16194
62 Ga0105245_11393068 3300009098 Bacteria 751
63 Ga0105247_10075650 3300009101 Bacteria 2113
64 Ga0114129_10029321 3300009147 Bacteria 7795
65 Ga0114129_10209321 3300009147 Bacteria 2637
66 Ga0114129_10936830 3300009147 Unclassified 1095
67 Ga0114129_11021470 3300009147 Bacteria 1040
68 Ga0114129_12421302 3300009147 Bacteria 628
69 Ga0105243_11128486 3300009148 Bacteria 794
70 Ga0105242_10113012 3300009176 Bacteria 2319
71 Ga0105248_10226973 3300009177 Bacteria 2102
72 Ga0105239_10427643 3300010375 Bacteria 1501
73 Ga0105246_10157781 3300011119 Bacteria 1725
74 Ga0105246_11049855 3300011119 Bacteria 741
75 Ga0157375_10080738 3300013308 Bacteria 3291
76 Ga0163163_10116408 3300014325 Bacteria 2704
77 Ga0157377_10125824 3300014745 Bacteria 1559
78 Ga0157379_10195434 3300014968 Bacteria 1828
79 Ga0207688_10011311 3300025901 Bacteria 4858
80 Ga0207688_10104032 3300025901 Bacteria 1642
81 Ga0207685_10215903 3300025905 Bacteria 909
82 Ga0207705_10337828 3300025909 Bacteria 1159
83 Ga0207684_10206745 3300025910 Bacteria 1694
84 Ga0207693_10017208 3300025915 Bacteria 5765
85 Ga0207657_10001445 3300025919 Bacteria 25426
86 Ga0207649_10026746 3300025920 Bacteria 3378
87 Ga0207650_10256779 3300025925 Bacteria 1416
88 Ga0207659_10044561 3300025926 Bacteria 3122
89 Ga0207687_10203875 3300025927 Bacteria 1548
90 Ga0207687_10781459 3300025927 Bacteria 814
91 Ga0207690_10241241 3300025932 Bacteria 1392
92 Ga0207690_11384388 3300025932 Bacteria 588
93 Ga0207706_10002862 3300025933 Bacteria 16746
94 Ga0207686_10488162 3300025934 Bacteria 954
95 Ga0207709_10086030 3300025935 Bacteria 2040
96 Ga0207709_10124705 3300025935 Bacteria 1745
97 Ga0207709_11348165 3300025935 Bacteria 590
98 Ga0207670_10207122 3300025936 Bacteria 1493
99 Ga0207669_10192713 3300025937 Bacteria 1472
100 Ga0207704_10176457 3300025938 Bacteria 1539
101 Ga0207704_10271392 3300025938 Bacteria 1284
102 Ga0207665_11196614 3300025939 Bacteria 606
103 Ga0207661_10068482 3300025944 Bacteria 2890
104 Ga0207712_10810772 3300025961 Bacteria 823
105 Ga0207640_10330246 3300025981 Bacteria 1218
106 Ga0207677_10263842 3300026023 Bacteria 1405
107 Ga0207678_10030478 3300026067 Bacteria 4708
108 Ga0207683_10029603 3300026121 Bacteria 4741
109 Ga0207683_10118778 3300026121 Bacteria 2372
110 Ga0207698_10108034 3300026142 Bacteria 2324
111 Ga0207428_10113271 3300027907 Bacteria 2085
112 Ga0307410_10056106 3300031852 Bacteria 2677
113 Ga0307407_10074286 3300031903 Bacteria 2034
114 Ga0307409_100030603 3300031995 Bacteria 3870
115 Ga0307409_100697514 3300031995 Bacteria 1014
116 Ga0307409_101539436 3300031995 Bacteria 693
117 Ga0307416_100023745 3300032002 Bacteria 4458
118 Ga0307414_11652970 3300032004 Bacteria 597
119 Ga0316574_0123434 3300035398 Bacteria 1664
120 Ga0316574_0833406 3300035398 Bacteria 560
121 Ga0373931_1087080 3300035691 Bacteria 544
122 Ga0373947_0225651 3300035725 Bacteria 1233
123 Ga0316584_0047110 3300036712 Bacteria 3220
124 Ga0316584_0162280 3300036712 Bacteria 1660
125 Ga0395900_0025504 3300037418 Bacteria 6052
126 Ga0395900_0459707 3300037418 Bacteria 1228
127 Ga0395898_0028632 3300037466 Bacteria 5582
128 Ga0395898_0048424 3300037466 Bacteria 4168
129 Ga0395898_1112185 3300037466 Bacteria 723
130 Ga0395905_0020030 3300037471 Bacteria 6338
131 Ga0395905_0267872 3300037471 Bacteria 1594
132 Ga0395905_1409088 3300037471 Bacteria 601
133 Ga0395901_0014051 3300038443 Bacteria 8150
134 Ga0395901_0089195 3300038443 Bacteria 3226
135 Ga0395901_1547318 3300038443 Bacteria 618
136 Ga0451807_1276215 3300041486 Unclassified 558
137 Ga0451853_2929270 3300041512 Bacteria 836
138 Ga0466960_0191891 3300044901 Bacteria 1112
139 Ga0466967_0516061 3300045976 Bacteria 1174
140 Ga0466967_2121856 3300045976 Bacteria 558
141 Ga0495603_0226627 3300046455 Bacteria 1078
142 Ga0495641_0021079 3300046461 Bacteria 3287
143 Ga0495582_0079948 3300046473 Bacteria 1815
144 Ga0495663_0322208 3300046525 Bacteria 559
145 Ga0495668_0440122 3300046616 Bacteria 717
146 Ga0495588_0044125 3300046674 Bacteria 2283
147 Ga0495581_0487055 3300047315 Bacteria 717
148 Ga0495676_0033275 3300047321 Bacteria 4344
149 Ga0496100_0067181 3300048903 Bacteria 2380
150 Ga0496101_0428466 3300048904 Bacteria 1043
151 Ga0496101_1196861 3300048904 Bacteria 595
152 Ga0496102_0323584 3300048905 Bacteria 1452
153 Ga0496103_0921123 3300048906 Bacteria 547
154 Ga0496105_0386845 3300048908 Bacteria 1112
155 Ga0496105_0709156 3300048908 Bacteria 772
156 Ga0496107_0776508 3300048910 Bacteria 702
157 Ga0496108_0068666 3300048911 Bacteria 2990
158 Ga0496109_0021291 3300048912 Bacteria 5732
159 Ga0496109_0059933 3300048912 Bacteria 3477
160 Ga0496110_0016016 3300048913 Bacteria 6253
161 Ga0496110_0048031 3300048913 Bacteria 3740
162 Ga0496110_0221201 3300048913 Bacteria 1722
163 Ga0496110_0302707 3300048913 Bacteria 1456
164 Ga0496110_0501060 3300048913 Bacteria 1105
165 Ga0496110_1061701 3300048913 Bacteria 718
166 Ga0496111_0046106 3300048914 Bacteria 3138
167 Ga0496111_0218665 3300048914 Bacteria 1415
168 Ga0496111_0544599 3300048914 Bacteria 852
169 Ga0496112_0083879 3300048915 Bacteria 3152
170 Ga0496112_0495487 3300048915 Bacteria 1157
171 Ga0496113_0023844 3300048916 Bacteria 4343
172 Ga0496113_0063347 3300048916 Bacteria 2794
173 Ga0496113_0337718 3300048916 Bacteria 1208
174 Ga0496113_0740500 3300048916 Bacteria 783
175 Ga0496114_0142029 3300048917 Bacteria 2079
176 Ga0496114_0348247 3300048917 Bacteria 1310
177 Ga0496115_0115807 3300048918 Bacteria 2204
178 Ga0501032_0968122 3300049569 Bacteria 535
179 Ga0501034_0236547 3300049571 Bacteria 1774
180 Ga0501036_1470017 3300049572 Bacteria 552
181 Ga0501038_0673174 3300049574 Bacteria 777
182 Ga0501039_0586472 3300049575 Bacteria 874
183 Ga0501040_0293895 3300049576 Bacteria 1161
184 Ga0501040_0496188 3300049576 Bacteria 880
185 Ga0501040_0613592 3300049576 Bacteria 786
186 Ga0501041_0045630 3300049577 Bacteria 2665
187 Ga0501041_0210312 3300049577 Bacteria 1220
188 Ga0501041_0382220 3300049577 Bacteria 891
189 Ga0501041_0549456 3300049577 Bacteria 736
190 Ga0501042_0034268 3300049578 Bacteria 3601
191 Ga0501042_0950946 3300049578 Bacteria 626
192 Ga0501067_0486186 3300049583 Bacteria 690
193 Ga0501068_0034696 3300049584 Bacteria 3010
194 Ga0501068_0401182 3300049584 Bacteria 884
195 Ga0501069_0367972 3300049585 Bacteria 848
196 Ga0501070_0060363 3300049586 Bacteria 3143
197 Ga0501070_0152052 3300049586 Bacteria 1909
198 Ga0501070_1350582 3300049586 Bacteria 543
199 Ga0501071_0091101 3300049587 Bacteria 2240
200 Ga0501071_0228690 3300049587 Bacteria 1401
201 Ga0501071_0426700 3300049587 Bacteria 1013
202 Ga0501072_0025253 3300049588 Bacteria 4628
203 Ga0501072_0070634 3300049588 Bacteria 2758
204 Ga0501072_0374875 3300049588 Bacteria 1129
205 Ga0501072_0517661 3300049588 Bacteria 943
206 Ga0501072_0523231 3300049588 Bacteria 938
207 Ga0501073_0049690 3300049589 Bacteria 2940
208 Ga0501074_0120408 3300049590 Bacteria 1877
209 Ga0501074_0182832 3300049590 Bacteria 1495
210 Ga0501074_0439625 3300049590 Bacteria 925
211 Ga0501074_0978302 3300049590 Bacteria 595
212 Ga0501076_0043108 3300049592 Bacteria 3554
213 Ga0501076_0225881 3300049592 Bacteria 1530
214 Ga0501076_0741830 3300049592 Bacteria 810
215 Ga0501077_0454002 3300049593 Bacteria 821
216 Ga0501079_0025894 3300049741 Bacteria 4499
217 Ga0501079_0150802 3300049741 Bacteria 1812
218 Ga0501079_0196360 3300049741 Bacteria 1575
219 Ga0501079_0264973 3300049741 Bacteria 1343
220 Ga0501080_0346167 3300049742 Bacteria 1343
221 Ga0501080_1483044 3300049742 Bacteria 577
222 Ga0501081_0093746 3300049743 Bacteria 2114
223 Ga0501081_0376092 3300049743 Bacteria 1049
224 Ga0501083_0175417 3300049744 Bacteria 1401
225 Ga0501045_0149778 3300049824 Bacteria 1736
226 Ga0501045_0261345 3300049824 Bacteria 1288
227 Ga0501045_0334450 3300049824 Bacteria 1127
228 nmdc:mga03n38_108074_c1 3300050490 Bacteria 1351
229 nmdc:mga00v17_1026267_c1 3300050491 Bacteria 518
230 nmdc:mga0yw44_150527_c1 3300050492 Bacteria 1517
231 nmdc:mga0yw44_25079_c1 3300050492 Bacteria 3384
232 nmdc:mga0yw44_4920_c1 3300050492 Bacteria 6221
233 nmdc:mga06z11_256169_c1 3300050494 Bacteria 1031
234 nmdc:mga06z11_464045_c1 3300050494 Bacteria 766
235 nmdc:mga06z11_748634_c1 3300050494 Bacteria 595
236 nmdc:mga05p37_1608126_c1 3300050507 Bacteria 640
237 nmdc:mga05p37_28563_c1 3300050507 Bacteria 6802
238 nmdc:mga05p37_650175_c1 3300050507 Bacteria 1181
239 nmdc:mga0qj67_1252545_c1 3300050509 Bacteria 576
240 nmdc:mga06r32_244_c1 3300050510 Bacteria 44802
241 nmdc:mga06r32_442404_c1 3300050510 Bacteria 1280
242 nmdc:mga08y16_487444_c1 3300050511 Bacteria 1254
243 nmdc:mga08y16_50983_c1 3300050511 Bacteria 4330
244 nmdc:mga0n895_1557160_c1 3300050512 Bacteria 626
245 nmdc:mga0n895_451519_c1 3300050512 Bacteria 1298
246 nmdc:mga0n895_49947_c1 3300050512 Bacteria 4100
247 nmdc:mga0rr50_721062_c1 3300050513 Bacteria 851
248 nmdc:mga0a205_28868_c1 3300050515 Bacteria 2360
249 Ga0500644_0053511 3300053088 Bacteria 1394
250 Ga0501084_0197049 3300054114 Bacteria 1699
251 Ga0501084_0390311 3300054114 Bacteria 1176
252 Ga0501084_0662727 3300054114 Bacteria 881
253 Ga0501084_0668455 3300054114 Bacteria 876
254 Ga0501082_0823510 3300060353 Bacteria 812
255 Ga0501082_1234714 3300060353 Bacteria 653
256 Ga0530510_0035145 3300061734 Bacteria 3611
257 Ga0530510_0193118 3300061734 Bacteria 1511
258 Ga0530510_0315199 3300061734 Bacteria 1172
259 Ga0530510_0877379 3300061734 Bacteria 685
260 nmdc:mga0yw44_25184_c1
261 Ga0070683_100038407
262 Ga0070690_100240775
263 Ga0070682_100093309
264 Ga0070682_100236682
265 Ga0068868_100025767
266 Ga0068868_100151767
267 Ga0070660_100001576
268 Ga0070689_100273206
269 Ga0070692_10011563
270 Ga0070692_10743660
271 Ga0070675_100110947
272 Ga0070675_100405554
273 Ga0070674_101633560
274 Ga0070659_100003244
275 Ga0070659_101002186
276 Ga0070667_100216363
277 Ga0070662_100043823
278 Ga0068867_101633890
279 Ga0068853_100005538
280 Ga0070686_100017850
281 Ga0070686_100022894
282 Ga0070695_100697984
283 Ga0070696_100127182
284 Ga0070693_100010104
285 Ga0070704_100363800
286 Ga0070664_100008941
287 Ga0068857_100302464
288 Ga0070702_100026057
289 Ga0068859_100238102
290 Ga0068861_101696117
291 Ga0068870_10046313
292 Ga0068860_100670925
293 Ga0081455_10140283
294 Ga0081455_10370393
295 Ga0081455_10606115
296 Ga0081538_10000514
297 Ga0081538_10077189
298 Ga0070717_10262732
299 Ga0075365_10001124
300 Ga0075365_10006524
301 Ga0075365_10009261
302 Ga0075365_10180243
303 Ga0075365_10260973
304 Ga0075363_100008821
305 Ga0075363_100310363
306 Ga0075364_10357178
307 Ga0070716_100195470
308 Ga0070712_100158379
309 Ga0075367_10114918
310 Ga0075428_100043184
311 Ga0075431_100000075
312 Ga0075431_100228367
313 Ga0075434_100013845
314 Ga0075434_100351207
315 Ga0068865_100026040
316 Ga0097620_100238108
317 Ga0075435_100203729
318 Ga0111539_10010995
319 Ga0111539_10042135
320 Ga0105245_10002623
321 Ga0105245_11393068
322 Ga0105247_10075650
323 Ga0114129_10029321
324 Ga0114129_10209321
325 Ga0114129_10936830
326 Ga0114129_11021470
327 Ga0114129_12421302
328 Ga0105243_11128486
329 Ga0105242_10113012
330 Ga0105248_10226973
331 Ga0105239_10427643
332 Ga0105246_10157781
333 Ga0105246_11049855
334 Ga0157375_10080738
335 Ga0163163_10116408
336 Ga0157377_10125824
337 Ga0157379_10195434
338 Ga0207688_10011311
339 Ga0207688_10104032
340 Ga0207685_10215903
341 Ga0207705_10337828
342 Ga0207684_10206745
343 Ga0207693_10017208
344 Ga0207657_10001445
345 Ga0207649_10026746
346 Ga0207650_10256779
347 Ga0207659_10044561
348 Ga0207687_10203875
349 Ga0207687_10781459
350 Ga0207690_10241241
351 Ga0207690_11384388
352 Ga0207706_10002862
353 Ga0207686_10488162
354 Ga0207709_10086030
355 Ga0207709_10124705
356 Ga0207709_11348165
357 Ga0207670_10207122
358 Ga0207669_10192713
359 Ga0207704_10176457
360 Ga0207704_10271392
361 Ga0207665_11196614
362 Ga0207661_10068482
363 Ga0207712_10810772
364 Ga0207640_10330246
365 Ga0207677_10263842
366 Ga0207678_10030478
367 Ga0207683_10029603
368 Ga0207683_10118778
369 Ga0207698_10108034
370 Ga0207428_10113271
371 Ga0307410_10056106
372 Ga0307407_10074286
373 Ga0307409_100030603
374 Ga0307409_100697514
375 Ga0307409_101539436
376 Ga0307416_100023745
377 Ga0307414_11652970
378 Ga0316574_0123434
379 Ga0316574_0833406
380 Ga0373931_1087080
381 Ga0373947_0225651
382 Ga0316584_0047110
383 Ga0316584_0162280
384 Ga0395900_0025504
385 Ga0395900_0459707
386 Ga0395898_0028632
387 Ga0395898_0048424
388 Ga0395898_1112185
389 Ga0395905_0020030
390 Ga0395905_0267872
391 Ga0395905_1409088
392 Ga0395901_0014051
393 Ga0395901_0089195
394 Ga0395901_1547318
395 Ga0451807_1276215
396 Ga0451853_2929270
397 Ga0466960_0191891
398 Ga0466967_0516061
399 Ga0466967_2121856
400 Ga0495603_0226627
401 Ga0495641_0021079
402 Ga0495582_0079948
403 Ga0495663_0322208
404 Ga0495668_0440122
405 Ga0495588_0044125
406 Ga0495581_0487055
407 Ga0495676_0033275
408 Ga0496100_0067181
409 Ga0496101_0428466
410 Ga0496101_1196861
411 Ga0496102_0323584
412 Ga0496103_0921123
413 Ga0496105_0386845
414 Ga0496105_0709156
415 Ga0496107_0776508
416 Ga0496108_0068666
417 Ga0496109_0021291
418 Ga0496109_0059933
419 Ga0496110_0016016
420 Ga0496110_0048031
421 Ga0496110_0221201
422 Ga0496110_0302707
423 Ga0496110_0501060
424 Ga0496110_1061701
425 Ga0496111_0046106
426 Ga0496111_0218665
427 Ga0496111_0544599
428 Ga0496112_0083879
429 Ga0496112_0495487
430 Ga0496113_0023844
431 Ga0496113_0063347
432 Ga0496113_0337718
433 Ga0496113_0740500
434 Ga0496114_0142029
435 Ga0496114_0348247
436 Ga0496115_0115807
437 Ga0501032_0968122
438 Ga0501034_0236547
439 Ga0501036_1470017
440 Ga0501038_0673174
441 Ga0501039_0586472
442 Ga0501040_0293895
443 Ga0501040_0496188
444 Ga0501040_0613592
445 Ga0501041_0045630
446 Ga0501041_0210312
447 Ga0501041_0382220
448 Ga0501041_0549456
449 Ga0501042_0034268
450 Ga0501042_0950946
451 Ga0501067_0486186
452 Ga0501068_0034696
453 Ga0501068_0401182
454 Ga0501069_0367972
455 Ga0501070_0060363
456 Ga0501070_0152052
457 Ga0501070_1350582
458 Ga0501071_0091101
459 Ga0501071_0228690
460 Ga0501071_0426700
461 Ga0501072_0025253
462 Ga0501072_0070634
463 Ga0501072_0374875
464 Ga0501072_0517661
465 Ga0501072_0523231
466 Ga0501073_0049690
467 Ga0501074_0120408
468 Ga0501074_0182832
469 Ga0501074_0439625
470 Ga0501074_0978302
471 Ga0501076_0043108
472 Ga0501076_0225881
473 Ga0501076_0741830
474 Ga0501077_0454002
475 Ga0501079_0025894
476 Ga0501079_0150802
477 Ga0501079_0196360
478 Ga0501079_0264973
479 Ga0501080_0346167
480 Ga0501080_1483044
481 Ga0501081_0093746
482 Ga0501081_0376092
483 Ga0501083_0175417
484 Ga0501045_0149778
485 Ga0501045_0261345
486 Ga0501045_0334450
487 nmdc:mga03n38_108074_c1
488 nmdc:mga00v17_1026267_c1
489 nmdc:mga0yw44_150527_c1
490 nmdc:mga0yw44_25079_c1
491 nmdc:mga0yw44_4920_c1
492 nmdc:mga06z11_256169_c1
493 nmdc:mga06z11_464045_c1
494 nmdc:mga06z11_748634_c1
495 nmdc:mga05p37_1608126_c1
496 nmdc:mga05p37_28563_c1
497 nmdc:mga05p37_650175_c1
498 nmdc:mga0qj67_1252545_c1
499 nmdc:mga06r32_244_c1
500 nmdc:mga06r32_442404_c1
501 nmdc:mga08y16_487444_c1
502 nmdc:mga08y16_50983_c1
503 nmdc:mga0n895_1557160_c1
504 nmdc:mga0n895_451519_c1
505 nmdc:mga0n895_49947_c1
506 nmdc:mga0rr50_721062_c1
507 nmdc:mga0a205_28868_c1
508 Ga0500644_0053511
509 Ga0501084_0197049
510 Ga0501084_0390311
511 Ga0501084_0662727
512 Ga0501084_0668455
513 Ga0501082_0823510
514 Ga0501082_1234714
515 Ga0530510_0035145
516 Ga0530510_0193118
517 Ga0530510_0315199
518 Ga0530510_0877379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

13

97

0.94

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

5

100

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bkb-assembly1.cif.gz_A initiation factor 5a from archebacterium pyrobaculum aerophilum 0.7914 20 48
6id1-assembly1.cif.gz_U cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution 0.7812 22 78
6k9z-assembly1.cif.gz_B structure of uridylyltransferase mutant 0.7786 8 77
6k5z-assembly1.cif.gz_B structure of uridylyltransferase 0.7704 8 77
7kb6-assembly1.cif.gz_A co-crystal structure of alpha glucosidase with compound 7 0.7644 18 47
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.78 22 105 3.30.428.10
af_A4I4B7_77_254_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7747 20 88 3.30.428.10
af_Q558W0_227_389_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7733 22 88 3.30.428.10
af_A1Z8J0_315_438_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7648 22 78 3.30.428.10
af_Q8I5K9_256_433_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7451 22 78 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A101F1V2-F1-model_v4 Histidine triad (HIT) protein 0.8973 22 87 GO:0003824
AF-A0A3N9PTR7-F1-model_v4 deleted 0.8928 7 87
AF-A0A3N5K8J2-F1-model_v4 HIT domain-containing protein 0.8898 8 93 GO:0003824
GO:0009117
AF-A0A496AYM7-F1-model_v4 HIT domain-containing protein 0.8856 22 95 GO:0003824
AF-B7FGW6-F1-model_v4 HIT domain-containing protein 0.8837 7 85 GO:0047627

Map