F369255

General Info

Members Datasets Scaffolds Average Seq Length
260 155 259 423

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10169883|rootH1_101698833
Length 458
Sequence VKSLLLLQQTGYLPNSVSQFYNSYIKINKLIVIKNFIPELQQRGLLQDIIPGTEEQLAKEMTAGYVGFDPTADSLHIGSMLPIILLMHMQRAGHKPYALIGGATGMIGDPTGKSAERNLLDSETLERNIAGIRKQLEHFLDFNASSPNKAELVNNYDWLKDYTFLDFIRDIGKHITVNYMLSKDSVQKRLEYGLSFTEFTYQLIQGYDFYYLHSHHNIKLQFGGGDQWGNIVTGTELIRRKGGTDAFAFTCPLLKKADGGKFGKTESGNIWLDRNKTSPYKFYQYWLNVTDEDAGNLIRIFTFLPLEEIDALSKDHEADPGRRLLQKKLAEEITIMVHSKEDLEFARQASNILFGKDTTTALSGLNEQELLEVMEGVPQVNFSRKALKEGVDFVQFLADTAIFPSKGEARKMLQSGGVSINKIKASGADVRLNEEHLLNEKYTLIQKGKRDYYLVIFE

Samples

Sample ID Description Type Environment
1 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
2 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
137 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
138 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
139 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
140 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
141 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
142 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
145 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
146 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
151 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
152 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0
Rhizoplane 1.15
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10006190 3300002459 Bacteria 2438
2 rootH2_10012470 3300003320 Bacteria 21001
3 rootL2_10071784 3300003322 Unclassified 3699
4 rootH1_10030177 3300003323 Bacteria 17204
5 rootH1_10133571 3300003323 Bacteria 4406
6 rootH1_10169883 3300003316 Bacteria 1638
7 rootH1_10169883 3300003323 Bacteria 11505
8 Ga0055531_10002847 3300003794 Bacteria 11310
9 Ga0070658_10000420 3300005327 Bacteria 36817
10 Ga0070683_100014608 3300005329 Bacteria 6876
11 Ga0070670_100020611 3300005331 Bacteria 5671
12 Ga0070670_100046128 3300005331 Bacteria 3747
13 Ga0070670_100059001 3300005331 Bacteria 3294
14 Ga0068869_100003566 3300005334 Bacteria 9547
15 Ga0070666_10000029 3300005335 Bacteria 141568
16 Ga0070682_100000101 3300005337 Bacteria 76535
17 Ga0068868_100000893 3300005338 Bacteria 20285
18 Ga0070660_100001327 3300005339 Bacteria 16821
19 Ga0070668_100000022 3300005347 Bacteria 96336
20 Ga0070669_100019244 3300005353 Bacteria 4876
21 Ga0070669_100073207 3300005353 Bacteria 2538
22 Ga0070674_100013732 3300005356 Bacteria 5013
23 Ga0070673_100000090 3300005364 Bacteria 39776
24 Ga0070688_100103733 3300005365 Bacteria 1879
25 Ga0070667_100001287 3300005367 Bacteria 22667
26 Ga0070713_100057551 3300005436 Bacteria 3238
27 Ga0070662_100007524 3300005457 Bacteria 7064
28 Ga0068867_100002488 3300005459 Bacteria 12960
29 Ga0068867_100056803 3300005459 Bacteria 2897
30 Ga0070679_100002459 3300005530 Bacteria 16772
31 Ga0070684_100004189 3300005535 Bacteria 10925
32 Ga0068853_100011415 3300005539 Bacteria 7217
33 Ga0070672_100000149 3300005543 Bacteria 38128
34 Ga0070686_100044782 3300005544 Bacteria 2784
35 Ga0070665_100001508 3300005548 Bacteria 27075
36 Ga0068855_100001939 3300005563 Bacteria 25691
37 Ga0068855_100031928 3300005563 Bacteria 6286
38 Ga0068855_100038497 3300005563 Bacteria 5682
39 Ga0070664_100156117 3300005564 Bacteria 2016
40 Ga0068856_100007746 3300005614 Bacteria 10491
41 Ga0068852_100017015 3300005616 Bacteria 5693
42 Ga0068852_100023793 3300005616 Bacteria 4938
43 Ga0068859_100000035 3300005617 Bacteria 169846
44 Ga0068859_100005872 3300005617 Bacteria 12460
45 Ga0068859_100019080 3300005617 Bacteria 6886
46 Ga0068864_100000404 3300005618 Bacteria 37446
47 Ga0068864_100003043 3300005618 Bacteria 13845
48 Ga0068864_100013085 3300005618 Bacteria 6873
49 Ga0068861_100007044 3300005719 Bacteria 7687
50 Ga0068851_10001594 3300005834 Bacteria 9956
51 Ga0068851_10027673 3300005834 Bacteria 2795
52 Ga0068851_10042258 3300005834 Bacteria 2294
53 Ga0068863_100000216 3300005841 Bacteria 61837
54 Ga0068863_100004976 3300005841 Bacteria 13098
55 Ga0068863_100132264 3300005841 Bacteria 2382
56 Ga0068858_100001050 3300005842 Bacteria 28529
57 Ga0068858_100002128 3300005842 Bacteria 20066
58 Ga0068860_100005982 3300005843 Bacteria 12246
59 Ga0075366_10054302 3300006195 Bacteria 2379
60 Ga0097621_100000622 3300006237 Bacteria 25041
61 Ga0097621_100009119 3300006237 Bacteria 7190
62 Ga0097621_100185605 3300006237 Bacteria 1799
63 Ga0068871_100000381 3300006358 Bacteria 31089
64 Ga0068871_100059929 3300006358 Bacteria 3103
65 Ga0068871_100113985 3300006358 Bacteria 2277
66 Ga0068865_100002023 3300006881 Bacteria 11967
67 Ga0097620_100000035 3300006931 Bacteria 169846
68 Ga0097620_100005872 3300006931 Bacteria 12460
69 Ga0097620_100019082 3300006931 Bacteria 6886
70 Ga0105240_10002479 3300009093 Bacteria 29666
71 Ga0105240_10028350 3300009093 Bacteria 7316
72 Ga0105240_10131306 3300009093 Bacteria 3004
73 Ga0111539_10047195 3300009094 Bacteria 5149
74 Ga0105247_10002595 3300009101 Bacteria 12225
75 Ga0105247_10007389 3300009101 Bacteria 6745
76 Ga0105241_10002106 3300009174 Bacteria 15030
77 Ga0105242_10073467 3300009176 Bacteria 2843
78 Ga0105242_10114464 3300009176 Bacteria 2305
79 Ga0105237_10000982 3300009545 Bacteria 38268
80 Ga0105237_10001411 3300009545 Bacteria 31753
81 Ga0105237_10092466 3300009545 Bacteria 3014
82 Ga0105238_10019266 3300009551 Bacteria 6951
83 Ga0105249_10001211 3300009553 Bacteria 22772
84 Ga0105249_10001250 3300009553 Bacteria 22317
85 Ga0105249_10006996 3300009553 Bacteria 9844
86 Ga0105249_10078193 3300009553 Bacteria 3069
87 Ga0105239_10001651 3300010375 Bacteria 29415
88 Ga0105239_10001753 3300010375 Bacteria 28602
89 Ga0105239_10024235 3300010375 Bacteria 6683
90 Ga0105239_10070527 3300010375 Bacteria 3839
91 Ga0105239_10071327 3300010375 Bacteria 3817
92 Ga0105246_10025624 3300011119 Bacteria 3845
93 Ga0105246_10034165 3300011119 Bacteria 3385
94 Ga0157370_10012018 3300013104 Bacteria 9019
95 Ga0157369_10101207 3300013105 Bacteria 3071
96 Ga0157374_10000001 3300013296 Bacteria 1077351
97 Ga0157374_10001426 3300013296 Bacteria 20204
98 Ga0157374_10176374 3300013296 Bacteria 2086
99 Ga0163162_10000573 3300013306 Bacteria 34029
100 Ga0163162_10000750 3300013306 Bacteria 30227
101 Ga0163162_10014307 3300013306 Bacteria 7752
102 Ga0163162_10016023 3300013306 Bacteria 7326
103 Ga0157372_10339951 3300013307 Unclassified 1748
104 Ga0157375_10002045 3300013308 Bacteria 17406
105 Ga0157375_10036795 3300013308 Bacteria 4686
106 Ga0157375_10037085 3300013308 Bacteria 4668
107 Ga0163163_10003562 3300014325 Bacteria 13222
108 Ga0163163_10255989 3300014325 Bacteria 1801
109 Ga0157380_10000746 3300014326 Bacteria 20287
110 Ga0157380_10094408 3300014326 Bacteria 2476
111 Ga0157379_10000068 3300014968 Bacteria 65388
112 Ga0157379_10123241 3300014968 Bacteria 2332
113 Ga0157376_10000719 3300014969 Bacteria 21414
114 Ga0157376_10000743 3300014969 Bacteria 21197
115 Ga0157376_10004097 3300014969 Bacteria 10092
116 Ga0157376_10118242 3300014969 Bacteria 2345
117 Ga0163161_10016255 3300017792 Bacteria 5193
118 Ga0213876_10020330 3300021384 Bacteria 3508
119 Ga0209257_1000006 3300025304 Bacteria 1570111
120 Ga0207710_10002918 3300025900 Bacteria 7769
121 Ga0207710_10100834 3300025900 Bacteria 1361
122 Ga0207680_10000049 3300025903 Bacteria 57625
123 Ga0207680_10003039 3300025903 Bacteria 7871
124 Ga0207645_10004561 3300025907 Bacteria 10226
125 Ga0207705_10015209 3300025909 Bacteria 5528
126 Ga0207705_10035554 3300025909 Bacteria 3564
127 Ga0207654_10002542 3300025911 Bacteria 9256
128 Ga0207707_10059551 3300025912 Bacteria 3323
129 Ga0207695_10000232 3300025913 Bacteria 147559
130 Ga0207695_10002023 3300025913 Bacteria 31171
131 Ga0207671_10002888 3300025914 Bacteria 17789
132 Ga0207671_10004179 3300025914 Bacteria 13946
133 Ga0207671_10012802 3300025914 Bacteria 6723
134 Ga0207660_10050228 3300025917 Bacteria 2960
135 Ga0207657_10007596 3300025919 Bacteria 11102
136 Ga0207652_10172264 3300025921 Bacteria 1942
137 Ga0207681_10020575 3300025923 Bacteria 4184
138 Ga0207650_10017509 3300025925 Bacteria 5019
139 Ga0207650_10032727 3300025925 Bacteria 3762
140 Ga0207700_10044061 3300025928 Bacteria 3282
141 Ga0207706_10025520 3300025933 Bacteria 5295
142 Ga0207686_10027589 3300025934 Bacteria 3327
143 Ga0207704_10085332 3300025938 Bacteria 2055
144 Ga0207691_10000113 3300025940 Bacteria 72765
145 Ga0207691_10108488 3300025940 Bacteria 2470
146 Ga0207691_10116885 3300025940 Bacteria 2367
147 Ga0207689_10001700 3300025942 Bacteria 20878
148 Ga0207667_10000111 3300025949 Bacteria 131758
149 Ga0207667_10012129 3300025949 Bacteria 9953
150 Ga0207667_10100220 3300025949 Bacteria 2988
151 Ga0207651_10000313 3300025960 Bacteria 20839
152 Ga0207712_10003924 3300025961 Bacteria 9396
153 Ga0207712_10003997 3300025961 Bacteria 9306
154 Ga0207712_10010349 3300025961 Bacteria 5920
155 Ga0207668_10005826 3300025972 Bacteria 7258
156 Ga0207668_10006568 3300025972 Bacteria 6875
157 Ga0207658_10001468 3300025986 Bacteria 18385
158 Ga0207658_10019093 3300025986 Bacteria 4741
159 Ga0207677_10001174 3300026023 Bacteria 14239
160 Ga0207703_10000316 3300026035 Bacteria 52401
161 Ga0207703_10003752 3300026035 Bacteria 12645
162 Ga0207639_10042374 3300026041 Bacteria 3411
163 Ga0207639_10044412 3300026041 Bacteria 3342
164 Ga0207702_10020767 3300026078 Bacteria 5431
165 Ga0207641_10000043 3300026088 Bacteria 186340
166 Ga0207641_10019872 3300026088 Bacteria 5511
167 Ga0207641_10032132 3300026088 Bacteria 4358
168 Ga0207648_10002914 3300026089 Bacteria 18110
169 Ga0207648_10061853 3300026089 Bacteria 3264
170 Ga0207676_10001587 3300026095 Bacteria 16726
171 Ga0207676_10004515 3300026095 Bacteria 9844
172 Ga0207676_10005296 3300026095 Bacteria 9136
173 Ga0207676_10029438 3300026095 Bacteria 4112
174 Ga0207674_10037559 3300026116 Bacteria 5036
175 Ga0207674_10132579 3300026116 Bacteria 2454
176 Ga0207675_100007098 3300026118 Bacteria 10587
177 Ga0207675_100084024 3300026118 Bacteria 2987
178 Ga0207698_10012573 3300026142 Bacteria 5545
179 Ga0207698_10114568 3300026142 Bacteria 2268
180 Ga0209974_10016032 3300027876 Bacteria 2488
181 Ga0268266_10006375 3300028379 Bacteria 10805
182 Ga0268264_10007707 3300028381 Bacteria 8968
183 Ga0265327_10000410 3300031251 Bacteria 78900
184 Ga0265327_10009985 3300031251 Bacteria 6755
185 Ga0265327_10035408 3300031251 Bacteria 2760
186 Ga0265316_10027168 3300031344 Bacteria 4745
187 Ga0307509_10096931 3300031507 Bacteria 2999
188 Ga0307408_100002585 3300031548 Bacteria 12621
189 Ga0265342_10098688 3300031712 Bacteria 1667
190 Ga0316576_10012872 3300031727 Bacteria 5537
191 Ga0316578_10006168 3300031728 Bacteria 5890
192 Ga0307516_10022409 3300031730 Bacteria 6487
193 Ga0307412_10013729 3300031911 Bacteria 4759
194 Ga0307510_10000119 3300033180 Bacteria 62835
195 Ga0373927_0062810 3300035695 Bacteria 2402
196 Ga0316584_0001857 3300036712 Bacteria 13088
197 Ga0316584_0013514 3300036712 Bacteria 5782
198 Ga0395901_0000341 3300038443 Bacteria 56827
199 Ga0400483_009503 3300039062 Bacteria 57988
200 Ga0436365_1040940 3300039437 Bacteria 11578
201 Ga0451795_0257601 3300041456 Bacteria 1296
202 Ga0451795_0726116 3300041456 Bacteria 1101
203 Ga0451577_0000542 3300042876 Bacteria 62075
204 Ga0451577_0003644 3300042876 Bacteria 16925
205 Ga0451577_0010050 3300042876 Bacteria 9067
206 Ga0451577_0011854 3300042876 Bacteria 8222
207 Ga0451577_0050216 3300042876 Bacteria 3724
208 Ga0451577_0156261 3300042876 Bacteria 2053
209 Ga0453683_0000039 3300044673 Bacteria 228860
210 Ga0453683_0029407 3300044673 Bacteria 3474
211 Ga0453683_0049836 3300044673 Bacteria 2624
212 Ga0453683_0050164 3300044673 Bacteria 2615
213 Ga0453683_0052188 3300044673 Bacteria 2560
214 Ga0453683_0130680 3300044673 Bacteria 1582
215 Ga0466965_0053764 3300044683 Bacteria 2002
216 Ga0453684_0000225 3300044712 Bacteria 245902
217 Ga0453684_0000525 3300044712 Bacteria 146588
218 Ga0453684_0002816 3300044712 Bacteria 41080
219 Ga0453684_0032722 3300044712 Bacteria 7266
220 Ga0453684_0047083 3300044712 Bacteria 5724
221 Ga0453684_0108208 3300044712 Bacteria 3384
222 Ga0453684_0326231 3300044712 Bacteria 1737
223 Ga0453684_0585046 3300044712 Bacteria 1225
224 Ga0466959_0008643 3300045049 Bacteria 7207
225 Ga0451576_0024735 3300045051 Bacteria 6481
226 Ga0451576_0028637 3300045051 Bacteria 5964
227 Ga0451576_0037143 3300045051 Bacteria 5160
228 Ga0451576_0044703 3300045051 Bacteria 4667
229 Ga0451576_0096773 3300045051 Bacteria 3070
230 Ga0451576_0133079 3300045051 Bacteria 2592
231 Ga0451576_0248928 3300045051 Bacteria 1857
232 Ga0495638_0088557 3300046460 Bacteria 1869
233 Ga0495606_0021150 3300046507 Bacteria 4770
234 Ga0495622_0022006 3300046557 Bacteria 2970
235 Ga0495668_0001323 3300046616 Bacteria 24366
236 Ga0495670_0058102 3300046691 Bacteria 1942
237 Ga0495686_0000004 3300047472 Bacteria 869019
238 Ga0495686_0001501 3300047472 Bacteria 25233
239 Ga0496114_0002303 3300048917 Bacteria 14544
240 Ga0501202_000050 3300049652 Bacteria 12265
241 Ga0501217_000079 3300049661 Bacteria 11818
242 Ga0501223_000157 3300049663 Bacteria 17995
243 Ga0501235_000643 3300049669 Bacteria 7040
244 Ga0501243_001255 3300049675 Bacteria 3623
245 Ga0501259_000566 3300049688 Bacteria 5904
246 Ga0501221_000123 3300049704 Bacteria 9752
247 Ga0501225_0000570 3300049705 Bacteria 11554
248 Ga0501234_001234 3300049707 Bacteria 4017
249 Ga0501245_000180 3300049708 Bacteria 7000
250 Ga0501241_000312 3300049758 Bacteria 10631
251 Ga0501044_0257250 3300049823 Bacteria 1685
252 Ga0501212_002358 3300049851 Bacteria 2268
253 nmdc:mga0k408_3179_c1 3300050493 Bacteria 8705
254 Ga0500578_0000529 3300053086 Bacteria 46403
255 Ga0500642_0054203 3300053130 Bacteria 1780
256 Ga0500655_006973 3300053133 Bacteria 2031
257 Ga0500616_0003105 3300053153 Bacteria 13014
258 Ga0500611_000069 3300053727 Bacteria 41999
259 Ga0466962_0031497 3300061719 Bacteria 2539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041456 Ga0451795_0726116 Ga0451795_0726116_19_1056 340
2 3300061719 Ga0466962_0031497 Ga0466962_0031497_1414_2526 370
3 3300049823 Ga0501044_0257250 Ga0501044_0257250_537_1661 372
4 3300041456 Ga0451795_0257601 Ga0451795_0257601_49_1191 375
5 3300044712 Ga0453684_0585046 Ga0453684_0585046_55_1197 375
6 3300044673 Ga0453683_0050164 Ga0453683_0050164_1434_2588 379
7 3300045051 Ga0451576_0248928 Ga0451576_0248928_656_1810 379
8 3300046460 Ga0495638_0088557 Ga0495638_0088557_601_1845 395
9 3300003323 rootH1_10030177 rootH1_100301777 396
10 3300053133 Ga0500655_006973 Ga0500655_006973_11_1207 398
11 3300031344 Ga0265316_10027168 Ga0265316_100271682 405
12 3300053727 Ga0500611_000069 Ga0500611_000069_23650_24927 406
13 3300014326 Ga0157380_10094408 Ga0157380_100944082 409
14 3300025914 Ga0207671_10012802 Ga0207671_100128021 409
15 3300036712 Ga0316584_0001857 Ga0316584_0001857_5659_6906 410
16 3300005544 Ga0070686_100044782 Ga0070686_1000447822 412
17 3300031727 Ga0316576_10012872 Ga0316576_100128724 412
18 3300005327 Ga0070658_10000420 Ga0070658_1000042022 413
19 3300005338 Ga0068868_100000893 Ga0068868_1000008932 413
20 3300005364 Ga0070673_100000090 Ga0070673_10000009021 413
21 3300005457 Ga0070662_100007524 Ga0070662_1000075244 413
22 3300005459 Ga0068867_100002488 Ga0068867_10000248810 413
23 3300005543 Ga0070672_100000149 Ga0070672_10000014917 413
24 3300005548 Ga0070665_100001508 Ga0070665_1000015087 413
25 3300005563 Ga0068855_100038497 Ga0068855_1000384972 413
26 3300005618 Ga0068864_100000404 Ga0068864_10000040422 413
27 3300005719 Ga0068861_100007044 Ga0068861_1000070445 413
28 3300006358 Ga0068871_100000381 Ga0068871_10000038112 413
29 3300017792 Ga0163161_10016255 Ga0163161_100162553 413
30 3300025909 Ga0207705_10015209 Ga0207705_100152094 413
31 3300025933 Ga0207706_10025520 Ga0207706_100255204 413
32 3300025934 Ga0207686_10027589 Ga0207686_100275893 413
33 3300025949 Ga0207667_10100220 Ga0207667_101002203 413
34 3300025960 Ga0207651_10000313 Ga0207651_100003133 413
35 3300025961 Ga0207712_10010349 Ga0207712_100103492 413
36 3300025972 Ga0207668_10005826 Ga0207668_100058264 413
37 3300026023 Ga0207677_10001174 Ga0207677_1000117414 413
38 3300026035 Ga0207703_10000316 Ga0207703_1000031615 413
39 3300026089 Ga0207648_10002914 Ga0207648_1000291412 413
40 3300026095 Ga0207676_10001587 Ga0207676_1000158713 413
41 3300026142 Ga0207698_10114568 Ga0207698_101145682 413
42 3300005331 Ga0070670_100059001 Ga0070670_1000590013 414
43 3300005841 Ga0068863_100132264 Ga0068863_1001322642 414
44 3300014968 Ga0157379_10123241 Ga0157379_101232411 414
45 3300025914 Ga0207671_10002888 Ga0207671_100028883 414
46 3300026041 Ga0207639_10042374 Ga0207639_100423743 414
47 3300049652 Ga0501202_000050 Ga0501202_000050_7898_9145 415
48 3300003320 rootH2_10012470 rootH2_100124706 419
49 3300009093 Ga0105240_10002479 Ga0105240_1000247922 419
50 3300009545 Ga0105237_10092466 Ga0105237_100924662 419
51 3300025913 Ga0207695_10002023 Ga0207695_100020237 419
52 3300013296 Ga0157374_10000001 Ga0157374_10000001548 420
53 3300014969 Ga0157376_10000719 Ga0157376_100007193 420
54 iso_pu_bacteria 2881955468 2881955593 420
55 iso_pu_bacteria 2890804823 2890806312 420
56 3300005614 Ga0068856_100007746 Ga0068856_1000077465 421
57 3300026078 Ga0207702_10020767 Ga0207702_100207673 421
58 3300031251 Ga0265327_10009985 Ga0265327_100099855 421
59 3300003794 Ga0055531_10002847 Ga0055531_100028476 422
60 3300025304 Ga0209257_1000006 Ga0209257_100000611 422
61 3300049758 Ga0501241_000312 Ga0501241_000312_9285_10568 422
62 3300005329 Ga0070683_100014608 Ga0070683_1000146087 423
63 3300005535 Ga0070684_100004189 Ga0070684_1000041893 423
64 3300005539 Ga0068853_100011415 Ga0068853_1000114153 423
65 3300005563 Ga0068855_100001939 Ga0068855_1000019397 423
66 3300009093 Ga0105240_10028350 Ga0105240_100283501 423
67 3300009551 Ga0105238_10019266 Ga0105238_100192663 423
68 3300010375 Ga0105239_10001651 Ga0105239_1000165117 423
69 3300010375 Ga0105239_10070527 Ga0105239_100705272 423
70 3300013105 Ga0157369_10101207 Ga0157369_101012072 423
71 3300025913 Ga0207695_10000232 Ga0207695_100002328 423
72 3300025949 Ga0207667_10000111 Ga0207667_100001119 423
73 3300027876 Ga0209974_10016032 Ga0209974_100160322 423
74 3300044683 Ga0466965_0053764 Ga0466965_0053764_97_1368 423
75 3300046616 Ga0495668_0001323 Ga0495668_0001323_11528_12811 423
76 3300053130 Ga0500642_0054203 Ga0500642_0054203_474_1757 423
77 3300053153 Ga0500616_0003105 Ga0500616_0003105_2547_3830 423
78 3300005339 Ga0070660_100001327 Ga0070660_10000132712 424
79 3300005347 Ga0070668_100000022 Ga0070668_10000002239 424
80 3300005353 Ga0070669_100019244 Ga0070669_1000192443 424
81 3300005367 Ga0070667_100001287 Ga0070667_1000012876 424
82 3300005530 Ga0070679_100002459 Ga0070679_1000024597 424
83 3300005564 Ga0070664_100156117 Ga0070664_1001561172 424
84 3300005616 Ga0068852_100023793 Ga0068852_1000237931 424
85 3300005617 Ga0068859_100019080 Ga0068859_1000190802 424
86 3300005834 Ga0068851_10001594 Ga0068851_100015942 424
87 3300005841 Ga0068863_100000216 Ga0068863_10000021639 424
88 3300005842 Ga0068858_100001050 Ga0068858_10000105020 424
89 3300006237 Ga0097621_100000622 Ga0097621_1000006224 424
90 3300006881 Ga0068865_100002023 Ga0068865_1000020237 424
91 3300006931 Ga0097620_100019082 Ga0097620_1000190822 424
92 3300009101 Ga0105247_10002595 Ga0105247_100025954 424
93 3300009553 Ga0105249_10001211 Ga0105249_1000121111 424
94 3300010375 Ga0105239_10024235 Ga0105239_100242353 424
95 3300013104 Ga0157370_10012018 Ga0157370_100120185 424
96 3300013307 Ga0157372_10339951 Ga0157372_103399511 424
97 3300025900 Ga0207710_10002918 Ga0207710_100029184 424
98 3300025903 Ga0207680_10003039 Ga0207680_100030397 424
99 3300025907 Ga0207645_10004561 Ga0207645_100045613 424
100 3300025909 Ga0207705_10035554 Ga0207705_100355542 424
101 3300025912 Ga0207707_10059551 Ga0207707_100595513 424
102 3300025917 Ga0207660_10050228 Ga0207660_100502283 424
103 3300025919 Ga0207657_10007596 Ga0207657_100075963 424
104 3300025921 Ga0207652_10172264 Ga0207652_101722641 424
105 3300025923 Ga0207681_10020575 Ga0207681_100205753 424
106 3300025938 Ga0207704_10085332 Ga0207704_100853322 424
107 3300025940 Ga0207691_10000113 Ga0207691_1000011344 424
108 3300025961 Ga0207712_10003924 Ga0207712_100039243 424
109 3300025986 Ga0207658_10001468 Ga0207658_100014688 424
110 3300026088 Ga0207641_10019872 Ga0207641_100198722 424
111 3300026095 Ga0207676_10005296 Ga0207676_100052964 424
112 3300026118 Ga0207675_100007098 Ga0207675_1000070984 424
113 3300026118 Ga0207675_100084024 Ga0207675_1000840243 424
114 3300026142 Ga0207698_10012573 Ga0207698_100125733 424
115 3300028379 Ga0268266_10006375 Ga0268266_100063754 424
116 3300036712 Ga0316584_0013514 Ga0316584_0013514_2574_3869 424
117 3300046691 Ga0495670_0058102 Ga0495670_0058102_59_1333 424
118 3300047472 Ga0495686_0001501 Ga0495686_0001501_21318_22604 424
119 3300003323 rootH1_10133571 rootH1_101335716 425
120 3300005331 Ga0070670_100020611 Ga0070670_1000206114 425
121 3300005334 Ga0068869_100003566 Ga0068869_1000035662 425
122 3300005335 Ga0070666_10000029 Ga0070666_1000002952 425
123 3300005337 Ga0070682_100000101 Ga0070682_10000010158 425
124 3300005353 Ga0070669_100073207 Ga0070669_1000732072 425
125 3300005356 Ga0070674_100013732 Ga0070674_1000137323 425
126 3300005365 Ga0070688_100103733 Ga0070688_1001037332 425
127 3300005459 Ga0068867_100056803 Ga0068867_1000568034 425
128 3300005563 Ga0068855_100031928 Ga0068855_1000319283 425
129 3300005616 Ga0068852_100017015 Ga0068852_1000170152 425
130 3300005617 Ga0068859_100000035 Ga0068859_100000035106 425
131 3300005617 Ga0068859_100005872 Ga0068859_1000058726 425
132 3300005618 Ga0068864_100003043 Ga0068864_1000030434 425
133 3300005618 Ga0068864_100013085 Ga0068864_1000130854 425
134 3300005834 Ga0068851_10027673 Ga0068851_100276732 425
135 3300005834 Ga0068851_10042258 Ga0068851_100422582 425
136 3300005841 Ga0068863_100004976 Ga0068863_1000049762 425
137 3300005842 Ga0068858_100002128 Ga0068858_1000021283 425
138 3300005843 Ga0068860_100005982 Ga0068860_1000059822 425
139 3300006195 Ga0075366_10054302 Ga0075366_100543022 425
140 3300006237 Ga0097621_100009119 Ga0097621_1000091192 425
141 3300006237 Ga0097621_100185605 Ga0097621_1001856051 425
142 3300006358 Ga0068871_100059929 Ga0068871_1000599292 425
143 3300006358 Ga0068871_100113985 Ga0068871_1001139851 425
144 3300006931 Ga0097620_100000035 Ga0097620_100000035106 425
145 3300006931 Ga0097620_100005872 Ga0097620_1000058726 425
146 3300009094 Ga0111539_10047195 Ga0111539_100471953 425
147 3300009101 Ga0105247_10007389 Ga0105247_100073893 425
148 3300009174 Ga0105241_10002106 Ga0105241_100021062 425
149 3300009176 Ga0105242_10114464 Ga0105242_101144641 425
150 3300009545 Ga0105237_10000982 Ga0105237_1000098221 425
151 3300009545 Ga0105237_10001411 Ga0105237_1000141114 425
152 3300009553 Ga0105249_10001250 Ga0105249_1000125012 425
153 3300010375 Ga0105239_10001753 Ga0105239_100017538 425
154 3300010375 Ga0105239_10071327 Ga0105239_100713272 425
155 3300011119 Ga0105246_10034165 Ga0105246_100341651 425
156 3300013296 Ga0157374_10176374 Ga0157374_101763742 425
157 3300013306 Ga0163162_10000573 Ga0163162_1000057317 425
158 3300013306 Ga0163162_10014307 Ga0163162_100143073 425
159 3300013306 Ga0163162_10016023 Ga0163162_100160235 425
160 3300013308 Ga0157375_10036795 Ga0157375_100367953 425
161 3300013308 Ga0157375_10037085 Ga0157375_100370853 425
162 3300014325 Ga0163163_10255989 Ga0163163_102559891 425
163 3300014326 Ga0157380_10000746 Ga0157380_100007462 425
164 3300014969 Ga0157376_10004097 Ga0157376_100040973 425
165 3300014969 Ga0157376_10118242 Ga0157376_101182422 425
166 3300021384 Ga0213876_10020330 Ga0213876_100203303 425
167 3300025900 Ga0207710_10100834 Ga0207710_101008341 425
168 3300025903 Ga0207680_10000049 Ga0207680_1000004938 425
169 3300025911 Ga0207654_10002542 Ga0207654_100025423 425
170 3300025914 Ga0207671_10004179 Ga0207671_100041794 425
171 3300025925 Ga0207650_10017509 Ga0207650_100175093 425
172 3300025940 Ga0207691_10108488 Ga0207691_101084881 425
173 3300025940 Ga0207691_10116885 Ga0207691_101168852 425
174 3300025942 Ga0207689_10001700 Ga0207689_100017007 425
175 3300025949 Ga0207667_10012129 Ga0207667_100121292 425
176 3300025961 Ga0207712_10003997 Ga0207712_100039973 425
177 3300025972 Ga0207668_10006568 Ga0207668_100065683 425
178 3300025986 Ga0207658_10019093 Ga0207658_100190932 425
179 3300026035 Ga0207703_10003752 Ga0207703_100037522 425
180 3300026041 Ga0207639_10044412 Ga0207639_100444124 425
181 3300026088 Ga0207641_10000043 Ga0207641_1000004385 425
182 3300026088 Ga0207641_10032132 Ga0207641_100321324 425
183 3300026089 Ga0207648_10061853 Ga0207648_100618532 425
184 3300026095 Ga0207676_10004515 Ga0207676_100045154 425
185 3300026095 Ga0207676_10029438 Ga0207676_100294382 425
186 3300026116 Ga0207674_10037559 Ga0207674_100375593 425
187 3300028381 Ga0268264_10007707 Ga0268264_100077076 425
188 3300031251 Ga0265327_10000410 Ga0265327_1000041022 425
189 3300031251 Ga0265327_10035408 Ga0265327_100354083 425
190 3300031507 Ga0307509_10096931 Ga0307509_100969312 425
191 3300031548 Ga0307408_100002585 Ga0307408_1000025853 425
192 3300031712 Ga0265342_10098688 Ga0265342_100986881 425
193 3300031728 Ga0316578_10006168 Ga0316578_100061683 425
194 3300031730 Ga0307516_10022409 Ga0307516_100224093 425
195 3300031911 Ga0307412_10013729 Ga0307412_100137292 425
196 3300033180 Ga0307510_10000119 Ga0307510_1000011925 425
197 3300035695 Ga0373927_0062810 Ga0373927_0062810_457_1734 425
198 3300039062 Ga0400483_009503 Ga0400483_009503_22690_23982 425
199 3300039437 Ga0436365_1040940 Ga0436365_1040940_1579_2862 425
200 3300042876 Ga0451577_0000542 Ga0451577_0000542_30125_31417 425
201 3300042876 Ga0451577_0003644 Ga0451577_0003644_6821_8113 425
202 3300042876 Ga0451577_0010050 Ga0451577_0010050_2607_3899 425
203 3300042876 Ga0451577_0011854 Ga0451577_0011854_1057_2349 425
204 3300042876 Ga0451577_0156261 Ga0451577_0156261_738_2030 425
205 3300044673 Ga0453683_0000039 Ga0453683_0000039_3043_4335 425
206 3300044673 Ga0453683_0029407 Ga0453683_0029407_520_1812 425
207 3300044673 Ga0453683_0049836 Ga0453683_0049836_1301_2593 425
208 3300044673 Ga0453683_0052188 Ga0453683_0052188_26_1321 425
209 3300044673 Ga0453683_0130680 Ga0453683_0130680_142_1434 425
210 3300044712 Ga0453684_0000225 Ga0453684_0000225_124053_125345 425
211 3300044712 Ga0453684_0000525 Ga0453684_0000525_12683_13975 425
212 3300044712 Ga0453684_0002816 Ga0453684_0002816_37662_38954 425
213 3300044712 Ga0453684_0032722 Ga0453684_0032722_1009_2301 425
214 3300044712 Ga0453684_0047083 Ga0453684_0047083_871_2163 425
215 3300044712 Ga0453684_0108208 Ga0453684_0108208_1104_2396 425
216 3300044712 Ga0453684_0326231 Ga0453684_0326231_360_1655 425
217 3300045051 Ga0451576_0024735 Ga0451576_0024735_2171_3463 425
218 3300045051 Ga0451576_0028637 Ga0451576_0028637_2109_3401 425
219 3300045051 Ga0451576_0037143 Ga0451576_0037143_632_1924 425
220 3300045051 Ga0451576_0044703 Ga0451576_0044703_2882_4174 425
221 3300045051 Ga0451576_0096773 Ga0451576_0096773_1070_2362 425
222 3300045051 Ga0451576_0133079 Ga0451576_0133079_827_2119 425
223 3300046507 Ga0495606_0021150 Ga0495606_0021150_3256_4533 425
224 3300046557 Ga0495622_0022006 Ga0495622_0022006_1134_2411 425
225 3300047472 Ga0495686_0000004 Ga0495686_0000004_62813_64090 425
226 3300049661 Ga0501217_000079 Ga0501217_000079_7406_8683 425
227 3300049663 Ga0501223_000157 Ga0501223_000157_4979_6256 425
228 3300049669 Ga0501235_000643 Ga0501235_000643_2476_3753 425
229 3300049675 Ga0501243_001255 Ga0501243_001255_808_2085 425
230 3300049688 Ga0501259_000566 Ga0501259_000566_3837_5114 425
231 3300049704 Ga0501221_000123 Ga0501221_000123_679_1956 425
232 3300049705 Ga0501225_0000570 Ga0501225_0000570_1244_2521 425
233 3300049707 Ga0501234_001234 Ga0501234_001234_161_1438 425
234 3300049708 Ga0501245_000180 Ga0501245_000180_2505_3782 425
235 3300049851 Ga0501212_002358 Ga0501212_002358_390_1667 425
236 3300050493 nmdc:mga0k408_3179_c1 nmdc:mga0k408_3179_c1_399_1676 425
237 3300053086 Ga0500578_0000529 Ga0500578_0000529_14488_15765 425
238 3300009093 Ga0105240_10131306 Ga0105240_101313063 428
239 3300009176 Ga0105242_10073467 Ga0105242_100734672 428
240 3300009553 Ga0105249_10078193 Ga0105249_100781932 428
241 3300011119 Ga0105246_10025624 Ga0105246_100256243 428
242 3300013296 Ga0157374_10001426 Ga0157374_1000142622 428
243 3300013306 Ga0163162_10000750 Ga0163162_100007507 428
244 3300013308 Ga0157375_10002045 Ga0157375_100020458 428
245 3300014325 Ga0163163_10003562 Ga0163163_100035623 428
246 3300014968 Ga0157379_10000068 Ga0157379_1000006833 428
247 3300014969 Ga0157376_10000743 Ga0157376_100007434 428
248 3300003322 rootL2_10071784 rootL2_100717843 431
249 3300038443 Ga0395901_0000341 Ga0395901_0000341_43376_44686 431
250 3300042876 Ga0451577_0050216 Ga0451577_0050216_1746_3074 432
251 3300045049 Ga0466959_0008643 Ga0466959_0008643_1506_2804 432
252 3300005436 Ga0070713_100057551 Ga0070713_1000575512 438
253 3300025928 Ga0207700_10044061 Ga0207700_100440612 438
254 3300048917 Ga0496114_0002303 Ga0496114_0002303_4437_5846 448
255 3300003323 rootH1_10169883 rootH1_101698833 449
256 3300002459 JGI24751J29686_10006190 JGI24751J29686_100061902 457
257 3300005331 Ga0070670_100046128 Ga0070670_1000461282 457
258 3300009553 Ga0105249_10006996 Ga0105249_100069963 457
259 3300025925 Ga0207650_10032727 Ga0207650_100327273 457
260 3300026116 Ga0207674_10132579 Ga0207674_101325791 457

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

57

355

0.98

PF22421

SYY_C-terminal

Tyrosine--tRNA ligase SYY-like C-terminal domain

369

455

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9428 391 430
6n0w-assembly1.cif.gz_A crystal structure of a tyrosine--trna ligase from elizabethkingia anophelis 0.9193 35 384
1tya-assembly1.cif.gz_E-2 structural analysis of a series of mutants of tyrosyl-trna synthetase: enhancement of catalysis by hydrophobic interactions 0.9156 33 349
2ts1-assembly1.cif.gz_A structure of tyrosyl-t/rna synthetase refined at 2.3 angstroms resolution. interaction of the enzyme with the tyrosyl adenylate intermediate 0.9151 33 349
4ts1-assembly1.cif.gz_A crystal structure of a deletion mutant of a tyrosyl-t/rna synthetase complexed with tyrosine 0.915 33 348
ID Description Score Start End Superfamily
2pidA02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.981 272 352 1.10.240.10
3zxiB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9795 272 349 1.10.240.10
2pidB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9745 272 352 1.10.240.10
4ts1B02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9686 255 343 1.10.240.10
2janD02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9619 255 351 1.10.240.10
ID Description Score Start End GO Terms
AF-A0A3C0IVH8-F1-model_v4 Tyrosine--tRNA ligase 0.9927 391 457 GO:0003723
GO:0004831
GO:0005829
GO:0043039
AF-A0A269XEI3-F1-model_v4 Tyrosine--tRNA ligase 0.9798 255 347 GO:0004831
GO:0005524
GO:0005829
GO:0006418
AF-A0A1V5NCW1-F1-model_v4 Tyrosine--tRNA ligase 1 (EC 6.1.1.1) 0.9726 379 457 GO:0003723
GO:0004831
AF-A0A5D0IME9-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9702 213 333 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A358DH60-F1-model_v4 Tyrosine--tRNA ligase 0.9694 378 457 GO:0003723
GO:0016874

Feature Viewer

pLDDT pTM Quality
85.71 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map