F369488

General Info

Members Datasets Scaffolds Average Seq Length
260 160 520 77

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10013417|Ga0105251_100134173
Length 85
Sequence MAMSQPYSRFLHPFEVARHPSLEPEVKRAILASWASDRSAVRDQPALRKPPGAKRAVPIDDVLAAMRTLDEGRDAGSSINERSRL

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
88 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
89 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
90 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
149 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
154 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
155 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
156 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
157 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
158 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
159 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
160 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.08
Nodule 0.38
Rhizoplane 3.46
Rhizosphere 58.85
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10013417 3300009011 Bacteria 4585
2 JGI24752J21851_1001080 3300001976 Bacteria 3722
3 JGI24739J22299_10000723 3300001989 Bacteria 11963
4 JGI24034J26672_10043112 3300002239 Bacteria 761
5 JGI25162J39368_1009714 3300002737 Bacteria 1265
6 JGI25165J46597_1032705 3300003214 Bacteria 670
7 JGI25165J46597_1032760 3300003214 Bacteria 670
8 Ga0055536_1000915 3300003781 Bacteria 19073
9 Ga0055536_1072739 3300003781 Bacteria 673
10 Ga0055530_10000070 3300003791 Bacteria 88001
11 Ga0055530_10005349 3300003791 Bacteria 6139
12 Ga0055531_10000119 3300003794 Bacteria 88001
13 Ga0065704_10311482 3300005289 Bacteria 865
14 Ga0070670_100000317 3300005331 Bacteria 41460
15 Ga0070670_100422241 3300005331 Bacteria 1179
16 Ga0070666_10031538 3300005335 Bacteria 3498
17 Ga0070666_10473972 3300005335 Bacteria 906
18 Ga0070668_100015084 3300005347 Bacteria 5773
19 Ga0070668_100029033 3300005347 Bacteria 4199
20 Ga0070669_100010041 3300005353 Bacteria 6729
21 Ga0070659_100171154 3300005366 Bacteria 1779
22 Ga0070667_100003913 3300005367 Bacteria 12646
23 Ga0070667_100009143 3300005367 Bacteria 8201
24 Ga0070667_100604646 3300005367 Bacteria 1010
25 Ga0070685_10807723 3300005466 Bacteria 692
26 Ga0070665_100181452 3300005548 Bacteria 2106
27 Ga0068854_100029310 3300005578 Bacteria 3810
28 Ga0068854_100029743 3300005578 Bacteria 3784
29 Ga0068854_100215287 3300005578 Bacteria 1517
30 Ga0068852_102196656 3300005616 Bacteria 573
31 Ga0068859_100218461 3300005617 Bacteria 1993
32 Ga0068859_101309212 3300005617 Bacteria 798
33 Ga0068859_101857589 3300005617 Bacteria 665
34 Ga0068864_100000062 3300005618 Bacteria 121206
35 Ga0068851_10001107 3300005834 Bacteria 11674
36 Ga0068863_100000055 3300005841 Bacteria 124300
37 Ga0068863_100000064 3300005841 Bacteria 118153
38 Ga0068863_100853667 3300005841 Bacteria 909
39 Ga0068858_100394102 3300005842 Bacteria 1330
40 Ga0068860_100000288 3300005843 Bacteria 71737
41 Ga0068860_100013301 3300005843 Bacteria 8069
42 Ga0068862_100028257 3300005844 Bacteria 4722
43 Ga0068862_100470169 3300005844 Bacteria 1188
44 Ga0081455_10318054 3300005937 Bacteria 1110
45 Ga0075368_10004005 3300006042 Bacteria 4962
46 Ga0075368_10016622 3300006042 Bacteria 2744
47 Ga0075363_100002384 3300006048 Bacteria 7659
48 Ga0075363_100175273 3300006048 Bacteria 1219
49 Ga0075364_10000105 3300006051 Bacteria 34139
50 Ga0075364_10479386 3300006051 Bacteria 850
51 Ga0075362_10014661 3300006177 Bacteria 3169
52 Ga0075367_10034224 3300006178 Bacteria 2933
53 Ga0075367_10035818 3300006178 Bacteria 2875
54 Ga0075369_10000046 3300006186 Bacteria 31338
55 Ga0075369_10002404 3300006186 Bacteria 6673
56 Ga0075366_10001719 3300006195 Bacteria 11005
57 Ga0075366_10882828 3300006195 Bacteria 557
58 Ga0075370_10002775 3300006353 Bacteria 8203
59 Ga0075370_10080422 3300006353 Bacteria 1872
60 Ga0075370_10084520 3300006353 Bacteria 1826
61 Ga0075370_10135122 3300006353 Bacteria 1440
62 Ga0075370_10155309 3300006353 Bacteria 1342
63 Ga0075370_10349282 3300006353 Bacteria 883
64 Ga0097620_100218466 3300006931 Bacteria 1993
65 Ga0097620_101309214 3300006931 Bacteria 798
66 Ga0097620_101856739 3300006931 Bacteria 665
67 Ga0079104_1008301 3300006946 Bacteria 3652
68 Ga0105240_10201461 3300009093 Bacteria 2332
69 Ga0105240_10282383 3300009093 Bacteria 1907
70 Ga0105240_10678431 3300009093 Bacteria 1127
71 Ga0105240_11167884 3300009093 Bacteria 816
72 Ga0105247_10005438 3300009101 Bacteria 8023
73 Ga0105243_12258380 3300009148 Bacteria 581
74 Ga0105241_10310309 3300009174 Bacteria 1357
75 Ga0105248_10000014 3300009177 Bacteria 324729
76 Ga0105237_10025772 3300009545 Bacteria 6013
77 Ga0105237_11106237 3300009545 Bacteria 799
78 Ga0105238_10376431 3300009551 Bacteria 1411
79 Ga0105249_10000253 3300009553 Bacteria 58707
80 Ga0105239_10001791 3300010375 Bacteria 28227
81 Ga0105239_10040213 3300010375 Bacteria 5123
82 Ga0157373_10038827 3300013100 Bacteria 3411
83 Ga0157370_10531159 3300013104 Bacteria 1079
84 Ga0157369_12139061 3300013105 Bacteria 567
85 Ga0163162_10344770 3300013306 Bacteria 1622
86 Ga0163162_10506379 3300013306 Bacteria 1338
87 Ga0157379_10109996 3300014968 Bacteria 2475
88 Ga0207427_113162 3300025231 Bacteria 816
89 Ga0209233_1016337 3300025261 Bacteria 2046
90 Ga0209455_1015468 3300025272 Bacteria 1675
91 Ga0209676_1000060 3300025292 Bacteria 338238
92 Ga0209676_1004948 3300025292 Bacteria 7159
93 Ga0209676_1010352 3300025292 Bacteria 3900
94 Ga0209050_1000355 3300025298 Bacteria 88238
95 Ga0209050_1000688 3300025298 Bacteria 50791
96 Ga0209257_1000384 3300025304 Bacteria 88238
97 Ga0209257_1012709 3300025304 Bacteria 3850
98 Ga0207656_10001271 3300025321 Bacteria 8308
99 Ga0207713_1011687 3300025735 Bacteria 4750
100 Ga0207680_10346559 3300025903 Bacteria 1043
101 Ga0207680_10362148 3300025903 Bacteria 1020
102 Ga0207695_10002128 3300025913 Bacteria 29997
103 Ga0207695_10065247 3300025913 Bacteria 3743
104 Ga0207695_10181661 3300025913 Bacteria 2024
105 Ga0207695_10187724 3300025913 Bacteria 1985
106 Ga0207671_10004867 3300025914 Bacteria 12637
107 Ga0207681_10007391 3300025923 Bacteria 6729
108 Ga0207694_10058745 3300025924 Bacteria 2991
109 Ga0207650_10000383 3300025925 Bacteria 41472
110 Ga0207650_10284594 3300025925 Bacteria 1347
111 Ga0207659_11168135 3300025926 Bacteria 662
112 Ga0207690_10169587 3300025932 Bacteria 1634
113 Ga0207709_10915733 3300025935 Bacteria 713
114 Ga0207711_10000021 3300025941 Bacteria 355952
115 Ga0207712_10000199 3300025961 Bacteria 60814
116 Ga0207668_10000373 3300025972 Bacteria 28446
117 Ga0207668_10027524 3300025972 Bacteria 3703
118 Ga0207640_10034929 3300025981 Bacteria 3142
119 Ga0207640_10264177 3300025981 Bacteria 1343
120 Ga0207640_10542427 3300025981 Bacteria 976
121 Ga0207658_10000137 3300025986 Bacteria 77129
122 Ga0207658_10000184 3300025986 Bacteria 67062
123 Ga0207658_10000332 3300025986 Bacteria 47441
124 Ga0207703_10191860 3300026035 Bacteria 1810
125 Ga0207703_12258414 3300026035 Bacteria 520
126 Ga0207641_10000107 3300026088 Bacteria 121220
127 Ga0207641_10000110 3300026088 Bacteria 120617
128 Ga0207676_10000057 3300026095 Bacteria 121220
129 Ga0209813_10000351 3300027866 Bacteria 11803
130 Ga0209974_10084737 3300027876 Bacteria 1094
131 Ga0268265_10000080 3300028380 Bacteria 121220
132 Ga0268265_10039101 3300028380 Bacteria 3494
133 Ga0268264_10000342 3300028381 Bacteria 71753
134 Ga0268264_10031764 3300028381 Bacteria 4330
135 Ga0316181_1255670 3300030744 Bacteria 617
136 Ga0307413_11821013 3300031824 Bacteria 545
137 Ga0307406_10461828 3300031901 Bacteria 1021
138 Ga0307412_10020826 3300031911 Bacteria 3997
139 Ga0307412_10129657 3300031911 Bacteria 1830
140 Ga0307412_10404520 3300031911 Bacteria 1112
141 Ga0307414_10332181 3300032004 Bacteria 1298
142 Ga0373949_0095677 3300035090 Bacteria 808
143 Ga0237819_00121 3300038705 Bacteria 29067
144 Ga0237816_00131 3300039145 Bacteria 5764
145 Ga0451843_0485450 3300041509 Bacteria 1078
146 Ga0451577_1900442 3300042876 Bacteria 521
147 Ga0495638_0217111 3300046460 Bacteria 1071
148 Ga0495605_0156660 3300046474 Bacteria 1013
149 Ga0495596_0000305 3300046500 Bacteria 32490
150 Ga0495596_0001301 3300046500 Bacteria 14402
151 Ga0495607_0075605 3300046501 Bacteria 1866
152 Ga0495583_0000054 3300046506 Bacteria 208592
153 Ga0495583_0082618 3300046506 Bacteria 1394
154 Ga0495606_0008052 3300046507 Bacteria 9251
155 Ga0495610_0002173 3300046512 Bacteria 16655
156 Ga0495610_0002722 3300046512 Bacteria 14543
157 Ga0495632_0007210 3300046519 Bacteria 7020
158 Ga0495637_0000036 3300046520 Bacteria 122003
159 Ga0495643_0000037 3300046522 Bacteria 237688
160 Ga0495643_0000843 3300046522 Bacteria 33281
161 Ga0495643_0426744 3300046522 Bacteria 580
162 Ga0495648_0210659 3300046524 Bacteria 966
163 Ga0495654_0089763 3300046530 Bacteria 1428
164 Ga0495654_0208692 3300046530 Bacteria 832
165 Ga0495609_0002171 3300046538 Bacteria 12330
166 Ga0495633_0017115 3300046558 Bacteria 3716
167 Ga0495633_0276341 3300046558 Bacteria 764
168 Ga0495668_0055013 3300046616 Bacteria 2198
169 Ga0495625_0128775 3300046660 Bacteria 1716
170 Ga0495671_0000025 3300046692 Bacteria 240277
171 Ga0495673_0128616 3300047469 Bacteria 997
172 Ga0495681_0362032 3300047470 Bacteria 549
173 Ga0495686_0000177 3300047472 Bacteria 121808
174 Ga0496100_1341284 3300048903 Bacteria 565
175 Ga0496101_0213393 3300048904 Bacteria 1496
176 Ga0496102_0000301 3300048905 Bacteria 63014
177 Ga0496102_0367172 3300048905 Bacteria 1355
178 Ga0496103_0000184 3300048906 Bacteria 62987
179 Ga0496103_0219287 3300048906 Bacteria 1223
180 Ga0496103_0922231 3300048906 Bacteria 547
181 Ga0496104_0243132 3300048907 Bacteria 1712
182 Ga0496104_0252620 3300048907 Bacteria 1676
183 Ga0496116_0000465 3300048919 Bacteria 56103
184 Ga0496116_0004306 3300048919 Bacteria 13620
185 Ga0496116_0371169 3300048919 Bacteria 646
186 Ga0496117_0000493 3300048920 Bacteria 65248
187 Ga0496117_0077418 3300048920 Bacteria 2201
188 Ga0496117_0118161 3300048920 Bacteria 1635
189 Ga0496117_0622499 3300048920 Unclassified 501
190 Ga0496118_0002062 3300048921 Bacteria 28313
191 Ga0496118_0016461 3300048921 Bacteria 6782
192 Ga0496119_0092599 3300048922 Bacteria 1714
193 Ga0496120_0060746 3300048923 Bacteria 2113
194 Ga0496121_0000085 3300048924 Bacteria 223810
195 Ga0496121_0000204 3300048924 Bacteria 130959
196 Ga0496121_0001253 3300048924 Bacteria 43985
197 Ga0496121_0005775 3300048924 Bacteria 15700
198 Ga0496121_0097396 3300048924 Bacteria 2280
199 Ga0496122_0000715 3300048925 Bacteria 65476
200 Ga0496122_0027964 3300048925 Bacteria 4802
201 Ga0496123_0000546 3300048926 Bacteria 64477
202 Ga0496123_0000668 3300048926 Bacteria 56721
203 Ga0496123_0268758 3300048926 Bacteria 831
204 Ga0496124_0000523 3300048927 Bacteria 65248
205 Ga0496124_0002281 3300048927 Bacteria 25370
206 Ga0496124_0025954 3300048927 Bacteria 5293
207 Ga0496124_0027654 3300048927 Bacteria 5085
208 Ga0496124_0251233 3300048927 Bacteria 1308
209 Ga0496125_0002524 3300048928 Bacteria 23632
210 Ga0496126_0000437 3300048929 Bacteria 83133
211 Ga0496126_0002306 3300048929 Bacteria 26205
212 Ga0496126_0932814 3300048929 Bacteria 656
213 Ga0496126_1077677 3300048929 Bacteria 598
214 Ga0495682_0172154 3300049460 Bacteria 770
215 Ga0501031_0157649 3300049568 Bacteria 1484
216 Ga0501032_0011017 3300049569 Bacteria 6501
217 Ga0501032_0104258 3300049569 Bacteria 1879
218 Ga0501033_0000486 3300049570 Bacteria 37382
219 Ga0501033_0001573 3300049570 Bacteria 20122
220 Ga0501034_0063424 3300049571 Bacteria 3708
221 Ga0501037_0133197 3300049573 Bacteria 1781
222 Ga0501037_0542911 3300049573 Bacteria 785
223 Ga0501038_0321491 3300049574 Bacteria 1210
224 Ga0501038_1023912 3300049574 Bacteria 605
225 Ga0501039_0312018 3300049575 Bacteria 1236
226 Ga0501043_0270939 3300049579 Bacteria 1303
227 Ga0501047_0500113 3300049581 Bacteria 1042
228 Ga0501035_0180970 3300049822 Bacteria 1816
229 Ga0501035_0426417 3300049822 Bacteria 1100
230 Ga0501044_0000058 3300049823 Bacteria 135713
231 Ga0501044_0001660 3300049823 Bacteria 26109
232 nmdc:mga03683_32416_c1 3300050489 Bacteria 2102
233 nmdc:mga03n38_1124_c1 3300050490 Bacteria 7395
234 nmdc:mga03n38_685328_c1 3300050490 Bacteria 590
235 nmdc:mga00v17_207_c1 3300050491 Bacteria 35541
236 nmdc:mga00v17_529974_c1 3300050491 Bacteria 762
237 nmdc:mga0yw44_133146_c1 3300050492 Bacteria 1611
238 nmdc:mga0k408_1918_c1 3300050493 Bacteria 11134
239 nmdc:mga0k408_472326_c1 3300050493 Bacteria 744
240 nmdc:mga06z11_185_c1 3300050494 Bacteria 24897
241 nmdc:mga06z11_87289_c1 3300050494 Bacteria 1687
242 nmdc:mga04h51_683_c1 3300050495 Bacteria 7880
243 nmdc:mga07m45_181863_c1 3300050496 Bacteria 1222
244 nmdc:mga07m45_22602_c1 3300050496 Bacteria 3435
245 nmdc:mga07m45_32513_c1 3300050496 Bacteria 2893
246 nmdc:mga07m45_54630_c1 3300050496 Bacteria 2256
247 nmdc:mga0sz30_97_c1 3300050516 Bacteria 33144
248 Ga0500592_010173 3300053116 Bacteria 1497
249 Ga0500568_0134914 3300053139 Bacteria 917
250 Ga0500604_0046408 3300053151 Bacteria 1329
251 Ga0500622_0002941 3300053156 Bacteria 11822
252 Ga0500627_0000020 3300053158 Bacteria 109977
253 Ga0500627_0014168 3300053158 Bacteria 3046
254 2643833900 2643221563 Bacteria 4726935
255 2644054826 2643221608 Bacteria 4724829
256 2778124833 2775507255 Bacteria 3945731
257 2819555525 2818991438 Bacteria 5793701
258 2852655753 2852653556 Bacteria 4050083
259 8054303355 8054302542 Bacteria 5698134
260 8057104157 8057101203 Bacteria 5034064
261 Ga0105251_10013417
262 JGI24752J21851_1001080
263 JGI24739J22299_10000723
264 JGI24034J26672_10043112
265 JGI25162J39368_1009714
266 JGI25165J46597_1032705
267 JGI25165J46597_1032760
268 Ga0055536_1000915
269 Ga0055536_1072739
270 Ga0055530_10000070
271 Ga0055530_10005349
272 Ga0055531_10000119
273 Ga0065704_10311482
274 Ga0070670_100000317
275 Ga0070670_100422241
276 Ga0070666_10031538
277 Ga0070666_10473972
278 Ga0070668_100015084
279 Ga0070668_100029033
280 Ga0070669_100010041
281 Ga0070659_100171154
282 Ga0070667_100003913
283 Ga0070667_100009143
284 Ga0070667_100604646
285 Ga0070685_10807723
286 Ga0070665_100181452
287 Ga0068854_100029310
288 Ga0068854_100029743
289 Ga0068854_100215287
290 Ga0068852_102196656
291 Ga0068859_100218461
292 Ga0068859_101309212
293 Ga0068859_101857589
294 Ga0068864_100000062
295 Ga0068851_10001107
296 Ga0068863_100000055
297 Ga0068863_100000064
298 Ga0068863_100853667
299 Ga0068858_100394102
300 Ga0068860_100000288
301 Ga0068860_100013301
302 Ga0068862_100028257
303 Ga0068862_100470169
304 Ga0081455_10318054
305 Ga0075368_10004005
306 Ga0075368_10016622
307 Ga0075363_100002384
308 Ga0075363_100175273
309 Ga0075364_10000105
310 Ga0075364_10479386
311 Ga0075362_10014661
312 Ga0075367_10034224
313 Ga0075367_10035818
314 Ga0075369_10000046
315 Ga0075369_10002404
316 Ga0075366_10001719
317 Ga0075366_10882828
318 Ga0075370_10002775
319 Ga0075370_10080422
320 Ga0075370_10084520
321 Ga0075370_10135122
322 Ga0075370_10155309
323 Ga0075370_10349282
324 Ga0097620_100218466
325 Ga0097620_101309214
326 Ga0097620_101856739
327 Ga0079104_1008301
328 Ga0105240_10201461
329 Ga0105240_10282383
330 Ga0105240_10678431
331 Ga0105240_11167884
332 Ga0105247_10005438
333 Ga0105243_12258380
334 Ga0105241_10310309
335 Ga0105248_10000014
336 Ga0105237_10025772
337 Ga0105237_11106237
338 Ga0105238_10376431
339 Ga0105249_10000253
340 Ga0105239_10001791
341 Ga0105239_10040213
342 Ga0157373_10038827
343 Ga0157370_10531159
344 Ga0157369_12139061
345 Ga0163162_10344770
346 Ga0163162_10506379
347 Ga0157379_10109996
348 Ga0207427_113162
349 Ga0209233_1016337
350 Ga0209455_1015468
351 Ga0209676_1000060
352 Ga0209676_1004948
353 Ga0209676_1010352
354 Ga0209050_1000355
355 Ga0209050_1000688
356 Ga0209257_1000384
357 Ga0209257_1012709
358 Ga0207656_10001271
359 Ga0207713_1011687
360 Ga0207680_10346559
361 Ga0207680_10362148
362 Ga0207695_10002128
363 Ga0207695_10065247
364 Ga0207695_10181661
365 Ga0207695_10187724
366 Ga0207671_10004867
367 Ga0207681_10007391
368 Ga0207694_10058745
369 Ga0207650_10000383
370 Ga0207650_10284594
371 Ga0207659_11168135
372 Ga0207690_10169587
373 Ga0207709_10915733
374 Ga0207711_10000021
375 Ga0207712_10000199
376 Ga0207668_10000373
377 Ga0207668_10027524
378 Ga0207640_10034929
379 Ga0207640_10264177
380 Ga0207640_10542427
381 Ga0207658_10000137
382 Ga0207658_10000184
383 Ga0207658_10000332
384 Ga0207703_10191860
385 Ga0207703_12258414
386 Ga0207641_10000107
387 Ga0207641_10000110
388 Ga0207676_10000057
389 Ga0209813_10000351
390 Ga0209974_10084737
391 Ga0268265_10000080
392 Ga0268265_10039101
393 Ga0268264_10000342
394 Ga0268264_10031764
395 Ga0316181_1255670
396 Ga0307413_11821013
397 Ga0307406_10461828
398 Ga0307412_10020826
399 Ga0307412_10129657
400 Ga0307412_10404520
401 Ga0307414_10332181
402 Ga0373949_0095677
403 Ga0237819_00121
404 Ga0237816_00131
405 Ga0451843_0485450
406 Ga0451577_1900442
407 Ga0495638_0217111
408 Ga0495605_0156660
409 Ga0495596_0000305
410 Ga0495596_0001301
411 Ga0495607_0075605
412 Ga0495583_0000054
413 Ga0495583_0082618
414 Ga0495606_0008052
415 Ga0495610_0002173
416 Ga0495610_0002722
417 Ga0495632_0007210
418 Ga0495637_0000036
419 Ga0495643_0000037
420 Ga0495643_0000843
421 Ga0495643_0426744
422 Ga0495648_0210659
423 Ga0495654_0089763
424 Ga0495654_0208692
425 Ga0495609_0002171
426 Ga0495633_0017115
427 Ga0495633_0276341
428 Ga0495668_0055013
429 Ga0495625_0128775
430 Ga0495671_0000025
431 Ga0495673_0128616
432 Ga0495681_0362032
433 Ga0495686_0000177
434 Ga0496100_1341284
435 Ga0496101_0213393
436 Ga0496102_0000301
437 Ga0496102_0367172
438 Ga0496103_0000184
439 Ga0496103_0219287
440 Ga0496103_0922231
441 Ga0496104_0243132
442 Ga0496104_0252620
443 Ga0496116_0000465
444 Ga0496116_0004306
445 Ga0496116_0371169
446 Ga0496117_0000493
447 Ga0496117_0077418
448 Ga0496117_0118161
449 Ga0496117_0622499
450 Ga0496118_0002062
451 Ga0496118_0016461
452 Ga0496119_0092599
453 Ga0496120_0060746
454 Ga0496121_0000085
455 Ga0496121_0000204
456 Ga0496121_0001253
457 Ga0496121_0005775
458 Ga0496121_0097396
459 Ga0496122_0000715
460 Ga0496122_0027964
461 Ga0496123_0000546
462 Ga0496123_0000668
463 Ga0496123_0268758
464 Ga0496124_0000523
465 Ga0496124_0002281
466 Ga0496124_0025954
467 Ga0496124_0027654
468 Ga0496124_0251233
469 Ga0496125_0002524
470 Ga0496126_0000437
471 Ga0496126_0002306
472 Ga0496126_0932814
473 Ga0496126_1077677
474 Ga0495682_0172154
475 Ga0501031_0157649
476 Ga0501032_0011017
477 Ga0501032_0104258
478 Ga0501033_0000486
479 Ga0501033_0001573
480 Ga0501034_0063424
481 Ga0501037_0133197
482 Ga0501037_0542911
483 Ga0501038_0321491
484 Ga0501038_1023912
485 Ga0501039_0312018
486 Ga0501043_0270939
487 Ga0501047_0500113
488 Ga0501035_0180970
489 Ga0501035_0426417
490 Ga0501044_0000058
491 Ga0501044_0001660
492 nmdc:mga03683_32416_c1
493 nmdc:mga03n38_1124_c1
494 nmdc:mga03n38_685328_c1
495 nmdc:mga00v17_207_c1
496 nmdc:mga00v17_529974_c1
497 nmdc:mga0yw44_133146_c1
498 nmdc:mga0k408_1918_c1
499 nmdc:mga0k408_472326_c1
500 nmdc:mga06z11_185_c1
501 nmdc:mga06z11_87289_c1
502 nmdc:mga04h51_683_c1
503 nmdc:mga07m45_181863_c1
504 nmdc:mga07m45_22602_c1
505 nmdc:mga07m45_32513_c1
506 nmdc:mga07m45_54630_c1
507 nmdc:mga0sz30_97_c1
508 Ga0500592_010173
509 Ga0500568_0134914
510 Ga0500604_0046408
511 Ga0500622_0002941
512 Ga0500627_0000020
513 Ga0500627_0014168
514 2643833900
515 2644054826
516 2778124833
517 2819555525
518 2852655753
519 8054303355
520 8057104157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7awe-assembly1.cif.gz_Q human immunoproteasome 20s particle in complex with [(1r)-2-(1-benzofuran-3-yl)-1-{[(1s,2r,4r)-7-oxabicyclo[2.2.1]heptan-2-yl]formamido}ethyl]boronic acid 0.6746 45 78
1kr3-assembly2.cif.gz_B crystal structure of the metallo beta-lactamase from bacteroides fragilis (cfia) in complex with the tricyclic inhibitor sb-236050. 0.5746 18 74
6r79-assembly4.cif.gz_D structure of imp-13 metallo-beta-lactamase in apo form (loop open) 0.5625 9 75
6r79-assembly1.cif.gz_A structure of imp-13 metallo-beta-lactamase in apo form (loop open) 0.5615 9 75
1wuo-assembly4.cif.gz_D crystal structure of metallo-beta-lactamase imp-1 mutant (d81a) 0.547 8 74
ID Description Score Start End Superfamily
af_Q09583_1_250_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8464 53 75 3.60.20.10
af_Q7K7W5_337_480_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7089 59 83 1.25.40.10
af_O86346_330_578_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.6709 18 74 3.60.15.10
af_Q9BI98_963_1156_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.6617 47 78 3.30.930.10
1znbB00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.6414 18 76 3.60.15.10
ID Description Score Start End GO Terms
AF-T0H8N2-F1-model_v4 Uncharacterized protein 0.9714 20 70
AF-A0A4P7RX90-F1-model_v4 Uncharacterized protein 0.9712 1 72
AF-A0A2G5QHK5-F1-model_v4 Antitoxin Xre/MbcA/ParS-like toxin-binding domain-containing protein 0.9604 8 72
AF-W6S1E3-F1-model_v4 Uncharacterized protein 0.9576 8 70
AF-A0A1G2WA04-F1-model_v4 Uncharacterized protein 0.9557 8 74

Map