F369898
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 172 | 253 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300049587|Ga0501071_0401575|Ga0501071_0401575_35_592 |
| Length | 185 |
| Sequence | VGSDFDARGDTGFDATLGTEFGAEFDDLLAANRKFAETFALAGFDGVAHRGVALVTCMDSRIDPLGMLGLEPGDAKIFRNPGGRITSAAVDALVLGVHLLGVERILVVPHTRCAMATSSEAELRDQVTEASGQDAGWTRWQVVPDQEAALFDDVARIKAHPLIPDRVAVGGFMYDVDTGLLTRLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 2 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 3 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 4 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 5 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 6 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 7 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 115 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 116 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 117 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 118 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 119 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 120 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 121 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 122 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 123 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 124 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 129 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 130 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 131 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 160 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 161 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 162 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 163 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 164 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 165 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 169 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 172 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95 |
| Metatranscriptomes | 2.31 |
| Isolates | 2.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.15 |
| Nodule | 0 |
| Rhizoplane | 4.62 |
| Rhizosphere | 86.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10026156 | 3300001991 | Bacteria | 1134 |
| 2 | JGI24735J21928_10067230 | 3300002067 | Bacteria | 1028 |
| 3 | JGI24750J21931_1042247 | 3300002070 | Bacteria | 695 |
| 4 | JGI24738J21930_10007742 | 3300002075 | Bacteria | 2466 |
| 5 | JGI24744J21845_10001073 | 3300002077 | Bacteria | 5287 |
| 6 | JGI24033J26618_1006394 | 3300002155 | Bacteria | 1320 |
| 7 | Ga0070658_10007152 | 3300005327 | Bacteria | 9014 |
| 8 | Ga0070658_10011684 | 3300005327 | Bacteria | 7043 |
| 9 | Ga0070658_10149638 | 3300005327 | Bacteria | 1954 |
| 10 | Ga0070658_10651123 | 3300005327 | Bacteria | 914 |
| 11 | Ga0070683_100008509 | 3300005329 | Bacteria | 8718 |
| 12 | Ga0070683_100154830 | 3300005329 | Bacteria | 2174 |
| 13 | Ga0070683_100398280 | 3300005329 | Bacteria | 1313 |
| 14 | Ga0070683_100583012 | 3300005329 | Bacteria | 1070 |
| 15 | Ga0070683_101026594 | 3300005329 | Bacteria | 792 |
| 16 | Ga0070670_100080629 | 3300005331 | Bacteria | 2797 |
| 17 | Ga0070680_100000530 | 3300005336 | Bacteria | 26042 |
| 18 | Ga0070680_100606434 | 3300005336 | Bacteria | 940 |
| 19 | Ga0068868_100032672 | 3300005338 | Bacteria | 4005 |
| 20 | Ga0070660_100064788 | 3300005339 | Bacteria | 2844 |
| 21 | Ga0070660_100348185 | 3300005339 | Bacteria | 1220 |
| 22 | Ga0070689_100730982 | 3300005340 | Bacteria | 866 |
| 23 | Ga0070689_100901680 | 3300005340 | Bacteria | 782 |
| 24 | Ga0070691_10061267 | 3300005341 | Bacteria | 1810 |
| 25 | Ga0070692_10063815 | 3300005345 | Bacteria | 1947 |
| 26 | Ga0070692_10514669 | 3300005345 | Bacteria | 778 |
| 27 | Ga0070668_100188987 | 3300005347 | Bacteria | 1686 |
| 28 | Ga0070675_100117953 | 3300005354 | Bacteria | 2253 |
| 29 | Ga0070674_100022693 | 3300005356 | Bacteria | 4050 |
| 30 | Ga0070673_100214362 | 3300005364 | Bacteria | 1664 |
| 31 | Ga0070659_100075710 | 3300005366 | Bacteria | 2683 |
| 32 | Ga0070659_100151540 | 3300005366 | Bacteria | 1892 |
| 33 | Ga0070667_100731929 | 3300005367 | Bacteria | 916 |
| 34 | Ga0070667_100732292 | 3300005367 | Bacteria | 916 |
| 35 | Ga0070714_100002773 | 3300005435 | Bacteria | 12909 |
| 36 | Ga0070701_10001989 | 3300005438 | Bacteria | 7750 |
| 37 | Ga0070678_100726044 | 3300005456 | Bacteria | 897 |
| 38 | Ga0070681_10000101 | 3300005458 | Bacteria | 63429 |
| 39 | Ga0070681_10480274 | 3300005458 | Bacteria | 1155 |
| 40 | Ga0068867_100004889 | 3300005459 | Bacteria | 9431 |
| 41 | Ga0070685_10107367 | 3300005466 | Bacteria | 1714 |
| 42 | Ga0070679_100030253 | 3300005530 | Bacteria | 5345 |
| 43 | Ga0070679_100572362 | 3300005530 | Bacteria | 1073 |
| 44 | Ga0070684_100003875 | 3300005535 | Bacteria | 11322 |
| 45 | Ga0070684_100014929 | 3300005535 | Bacteria | 6305 |
| 46 | Ga0070684_100034921 | 3300005535 | Bacteria | 4301 |
| 47 | Ga0070684_100422136 | 3300005535 | Bacteria | 1231 |
| 48 | Ga0070672_100001684 | 3300005543 | Bacteria | 13785 |
| 49 | Ga0068855_100304010 | 3300005563 | Bacteria | 1766 |
| 50 | Ga0068857_100217727 | 3300005577 | Bacteria | 1743 |
| 51 | Ga0068857_100245238 | 3300005577 | Bacteria | 1641 |
| 52 | Ga0070702_100006418 | 3300005615 | Bacteria | 5565 |
| 53 | Ga0068852_100008268 | 3300005616 | Bacteria | 7656 |
| 54 | Ga0068864_100209414 | 3300005618 | Bacteria | 1795 |
| 55 | Ga0068866_10086570 | 3300005718 | Bacteria | 1696 |
| 56 | Ga0068861_100007730 | 3300005719 | Bacteria | 7383 |
| 57 | Ga0068870_10090752 | 3300005840 | Bacteria | 1708 |
| 58 | Ga0068862_100232922 | 3300005844 | Bacteria | 1672 |
| 59 | Ga0075365_10011900 | 3300006038 | Bacteria | 5138 |
| 60 | Ga0075363_100014330 | 3300006048 | Bacteria | 3870 |
| 61 | Ga0075363_100019774 | 3300006048 | Bacteria | 3370 |
| 62 | Ga0075363_100027925 | 3300006048 | Bacteria | 2898 |
| 63 | Ga0075364_10434138 | 3300006051 | Bacteria | 897 |
| 64 | Ga0075370_10084150 | 3300006353 | Bacteria | 1831 |
| 65 | Ga0075428_100760588 | 3300006844 | Bacteria | 1031 |
| 66 | Ga0068865_100098388 | 3300006881 | Bacteria | 2137 |
| 67 | Ga0105240_10123465 | 3300009093 | Bacteria | 3115 |
| 68 | Ga0111539_10493644 | 3300009094 | Bacteria | 1426 |
| 69 | Ga0105245_10016311 | 3300009098 | Bacteria | 6477 |
| 70 | Ga0105243_10048775 | 3300009148 | Bacteria | 3339 |
| 71 | Ga0105242_10165364 | 3300009176 | Bacteria | 1940 |
| 72 | Ga0105248_10035320 | 3300009177 | Bacteria | 5591 |
| 73 | Ga0105249_10016635 | 3300009553 | Bacteria | 6529 |
| 74 | Ga0105239_10192734 | 3300010375 | Bacteria | 2281 |
| 75 | Ga0105246_10477075 | 3300011119 | Bacteria | 1054 |
| 76 | Ga0105246_10483859 | 3300011119 | Bacteria | 1048 |
| 77 | Ga0157369_11378436 | 3300013105 | Bacteria | 718 |
| 78 | Ga0157374_10648632 | 3300013296 | Bacteria | 1067 |
| 79 | Ga0157372_10104815 | 3300013307 | Bacteria | 3234 |
| 80 | Ga0157372_10121670 | 3300013307 | Bacteria | 2998 |
| 81 | Ga0157372_10585986 | 3300013307 | Bacteria | 1300 |
| 82 | Ga0157372_10792044 | 3300013307 | Bacteria | 1102 |
| 83 | Ga0157372_11960900 | 3300013307 | Bacteria | 673 |
| 84 | Ga0157375_10990526 | 3300013308 | Bacteria | 981 |
| 85 | Ga0163163_10092633 | 3300014325 | Bacteria | 3037 |
| 86 | Ga0157380_10012627 | 3300014326 | Bacteria | 6130 |
| 87 | Ga0157377_10004523 | 3300014745 | Bacteria | 6418 |
| 88 | Ga0157379_10313180 | 3300014968 | Bacteria | 1432 |
| 89 | Ga0163161_10183728 | 3300017792 | Bacteria | 1605 |
| 90 | Ga0206356_10070626 | 3300020070 | Bacteria | 2470 |
| 91 | Ga0206354_11543417 | 3300020081 | Bacteria | 1137 |
| 92 | Ga0206353_10301200 | 3300020082 | Bacteria | 957 |
| 93 | Ga0206353_11024863 | 3300020082 | Bacteria | 4276 |
| 94 | Ga0206353_11503956 | 3300020082 | Bacteria | 1032 |
| 95 | Ga0206353_11703101 | 3300020082 | Bacteria | 1152 |
| 96 | Ga0207642_10085198 | 3300025899 | Bacteria | 1546 |
| 97 | Ga0207688_10027151 | 3300025901 | Bacteria | 3149 |
| 98 | Ga0207647_10086728 | 3300025904 | Bacteria | 1871 |
| 99 | Ga0207643_10000932 | 3300025908 | Bacteria | 17549 |
| 100 | Ga0207705_10124562 | 3300025909 | Bacteria | 1914 |
| 101 | Ga0207707_10001741 | 3300025912 | Bacteria | 20017 |
| 102 | Ga0207695_10199243 | 3300025913 | Bacteria | 1917 |
| 103 | Ga0207660_10002519 | 3300025917 | Bacteria | 12044 |
| 104 | Ga0207660_10578034 | 3300025917 | Bacteria | 914 |
| 105 | Ga0207657_10078425 | 3300025919 | Bacteria | 2781 |
| 106 | Ga0207652_10008936 | 3300025921 | Bacteria | 8073 |
| 107 | Ga0207652_10138693 | 3300025921 | Bacteria | 2173 |
| 108 | Ga0207650_10232900 | 3300025925 | Bacteria | 1486 |
| 109 | Ga0207687_10163817 | 3300025927 | Bacteria | 1709 |
| 110 | Ga0207644_10301871 | 3300025931 | Bacteria | 1291 |
| 111 | Ga0207690_10092404 | 3300025932 | Bacteria | 2141 |
| 112 | Ga0207690_10207915 | 3300025932 | Bacteria | 1490 |
| 113 | Ga0207709_10031596 | 3300025935 | Bacteria | 3094 |
| 114 | Ga0207704_10397588 | 3300025938 | Bacteria | 1086 |
| 115 | Ga0207691_10010057 | 3300025940 | Bacteria | 9079 |
| 116 | Ga0207711_10118783 | 3300025941 | Bacteria | 2359 |
| 117 | Ga0207689_10291085 | 3300025942 | Bacteria | 1353 |
| 118 | Ga0207661_10067342 | 3300025944 | Bacteria | 2912 |
| 119 | Ga0207661_10124720 | 3300025944 | Bacteria | 2198 |
| 120 | Ga0207661_10131748 | 3300025944 | Bacteria | 2142 |
| 121 | Ga0207661_10281472 | 3300025944 | Bacteria | 1487 |
| 122 | Ga0207661_10392238 | 3300025944 | Bacteria | 1258 |
| 123 | Ga0207667_10324200 | 3300025949 | Bacteria | 1573 |
| 124 | Ga0207712_10045502 | 3300025961 | Bacteria | 3039 |
| 125 | Ga0207668_10215633 | 3300025972 | Bacteria | 1538 |
| 126 | Ga0207677_10075677 | 3300026023 | Bacteria | 2393 |
| 127 | Ga0207708_10000227 | 3300026075 | Bacteria | 44512 |
| 128 | Ga0207641_11159055 | 3300026088 | Bacteria | 772 |
| 129 | Ga0207648_10000576 | 3300026089 | Bacteria | 41193 |
| 130 | Ga0207676_10448006 | 3300026095 | Bacteria | 1216 |
| 131 | Ga0207674_10264027 | 3300026116 | Bacteria | 1669 |
| 132 | Ga0207675_100004066 | 3300026118 | Bacteria | 14158 |
| 133 | Ga0207683_10889874 | 3300026121 | Bacteria | 827 |
| 134 | Ga0207698_10157992 | 3300026142 | Bacteria | 1978 |
| 135 | Ga0207428_10067093 | 3300027907 | Bacteria | 2825 |
| 136 | Ga0268265_10100805 | 3300028380 | Bacteria | 2332 |
| 137 | Ga0307409_100905058 | 3300031995 | Bacteria | 896 |
| 138 | Ga0395899_0018143 | 3300037312 | Bacteria | 5354 |
| 139 | Ga0395900_0076778 | 3300037418 | Bacteria | 3433 |
| 140 | Ga0395898_0075502 | 3300037466 | Bacteria | 3256 |
| 141 | Ga0395901_0386577 | 3300038443 | Bacteria | 1439 |
| 142 | Ga0395901_1153586 | 3300038443 | Bacteria | 743 |
| 143 | Ga0451804_0356831 | 3300041463 | Bacteria | 601 |
| 144 | Ga0451853_3725642 | 3300041512 | Bacteria | 888 |
| 145 | Ga0466969_0246724 | 3300044656 | Bacteria | 810 |
| 146 | Ga0466972_0110610 | 3300044658 | Bacteria | 1298 |
| 147 | Ga0466972_0309380 | 3300044658 | Bacteria | 738 |
| 148 | Ga0466965_0033739 | 3300044683 | Bacteria | 2502 |
| 149 | Ga0466965_0125955 | 3300044683 | Bacteria | 1325 |
| 150 | Ga0466966_0028706 | 3300044684 | Bacteria | 3621 |
| 151 | Ga0466963_0021493 | 3300044694 | Bacteria | 4072 |
| 152 | Ga0466957_0063258 | 3300044842 | Bacteria | 2274 |
| 153 | Ga0466960_0018985 | 3300044901 | Bacteria | 3022 |
| 154 | Ga0466960_0133359 | 3300044901 | Bacteria | 1313 |
| 155 | Ga0466959_0038696 | 3300045049 | Bacteria | 3524 |
| 156 | Ga0466967_0021160 | 3300045976 | Bacteria | 5275 |
| 157 | Ga0466967_0022773 | 3300045976 | Bacteria | 5121 |
| 158 | Ga0466967_0921847 | 3300045976 | Bacteria | 869 |
| 159 | Ga0495677_0304451 | 3300047445 | Bacteria | 627 |
| 160 | Ga0496102_0482641 | 3300048905 | Bacteria | 1161 |
| 161 | Ga0496108_0826111 | 3300048911 | Bacteria | 798 |
| 162 | Ga0496109_0032620 | 3300048912 | Bacteria | 4682 |
| 163 | Ga0496109_0541099 | 3300048912 | Bacteria | 1099 |
| 164 | Ga0496110_0079478 | 3300048913 | Bacteria | 2920 |
| 165 | Ga0496110_0127964 | 3300048913 | Bacteria | 2292 |
| 166 | Ga0496110_0387081 | 3300048913 | Bacteria | 1274 |
| 167 | Ga0496111_0528138 | 3300048914 | Bacteria | 867 |
| 168 | Ga0496114_0058307 | 3300048917 | Bacteria | 3224 |
| 169 | Ga0496114_0125909 | 3300048917 | Bacteria | 2208 |
| 170 | Ga0496114_1400312 | 3300048917 | Bacteria | 587 |
| 171 | Ga0501031_0005383 | 3300049568 | Bacteria | 8336 |
| 172 | Ga0501031_0055019 | 3300049568 | Bacteria | 2593 |
| 173 | Ga0501033_0036157 | 3300049570 | Bacteria | 3702 |
| 174 | Ga0501036_0030483 | 3300049572 | Bacteria | 4555 |
| 175 | Ga0501038_0175612 | 3300049574 | Bacteria | 1731 |
| 176 | Ga0501038_0480359 | 3300049574 | Bacteria | 952 |
| 177 | Ga0501038_0807775 | 3300049574 | Bacteria | 697 |
| 178 | Ga0501039_0013136 | 3300049575 | Bacteria | 6329 |
| 179 | Ga0501039_0050826 | 3300049575 | Bacteria | 3207 |
| 180 | Ga0501040_0006621 | 3300049576 | Bacteria | 7520 |
| 181 | Ga0501040_0007068 | 3300049576 | Bacteria | 7276 |
| 182 | Ga0501041_0009045 | 3300049577 | Bacteria | 5861 |
| 183 | Ga0501041_0020404 | 3300049577 | Bacteria | 3962 |
| 184 | Ga0501041_0105322 | 3300049577 | Bacteria | 1748 |
| 185 | Ga0501041_0223754 | 3300049577 | Bacteria | 1181 |
| 186 | Ga0501042_0005774 | 3300049578 | Bacteria | 7991 |
| 187 | Ga0501043_0106067 | 3300049579 | Bacteria | 2207 |
| 188 | Ga0501043_0797077 | 3300049579 | Bacteria | 684 |
| 189 | Ga0501046_0038031 | 3300049580 | Bacteria | 3864 |
| 190 | Ga0501046_0120791 | 3300049580 | Bacteria | 1993 |
| 191 | Ga0501048_0058578 | 3300049582 | Bacteria | 2730 |
| 192 | Ga0501048_1026966 | 3300049582 | Bacteria | 593 |
| 193 | Ga0501067_0071989 | 3300049583 | Bacteria | 1915 |
| 194 | Ga0501068_0008819 | 3300049584 | Bacteria | 5625 |
| 195 | Ga0501068_0032129 | 3300049584 | Bacteria | 3120 |
| 196 | Ga0501068_0343340 | 3300049584 | Bacteria | 959 |
| 197 | Ga0501068_0461305 | 3300049584 | Bacteria | 822 |
| 198 | Ga0501070_0483177 | 3300049586 | Bacteria | 996 |
| 199 | Ga0501070_0484616 | 3300049586 | Bacteria | 994 |
| 200 | Ga0501071_0002621 | 3300049587 | Bacteria | 10998 |
| 201 | Ga0501071_0056945 | 3300049587 | Bacteria | 2824 |
| 202 | Ga0501071_0346803 | 3300049587 | Bacteria | 1130 |
| 203 | Ga0501071_0401575 | 3300049587 | Bacteria | 1046 |
| 204 | Ga0501071_1021608 | 3300049587 | Bacteria | 639 |
| 205 | Ga0501072_0002981 | 3300049588 | Bacteria | 12753 |
| 206 | Ga0501072_0004851 | 3300049588 | Bacteria | 10241 |
| 207 | Ga0501072_0037594 | 3300049588 | Bacteria | 3797 |
| 208 | Ga0501073_0106768 | 3300049589 | Bacteria | 1943 |
| 209 | Ga0501074_0015509 | 3300049590 | Bacteria | 5539 |
| 210 | Ga0501075_0000413 | 3300049591 | Bacteria | 24963 |
| 211 | Ga0501075_0091804 | 3300049591 | Bacteria | 2304 |
| 212 | Ga0501076_0010783 | 3300049592 | Bacteria | 6793 |
| 213 | Ga0501076_0047561 | 3300049592 | Bacteria | 3392 |
| 214 | Ga0501076_0272615 | 3300049592 | Bacteria | 1386 |
| 215 | Ga0501076_0631565 | 3300049592 | Bacteria | 884 |
| 216 | Ga0501076_0851214 | 3300049592 | Bacteria | 752 |
| 217 | Ga0501077_0003862 | 3300049593 | Bacteria | 9032 |
| 218 | Ga0501077_0039826 | 3300049593 | Bacteria | 2993 |
| 219 | Ga0501077_0784354 | 3300049593 | Bacteria | 613 |
| 220 | Ga0501079_0012791 | 3300049741 | Bacteria | 6408 |
| 221 | Ga0501079_0039234 | 3300049741 | Bacteria | 3652 |
| 222 | Ga0501080_0019881 | 3300049742 | Bacteria | 6219 |
| 223 | Ga0501080_0401333 | 3300049742 | Bacteria | 1233 |
| 224 | Ga0501081_0001867 | 3300049743 | Bacteria | 13091 |
| 225 | Ga0501083_0079794 | 3300049744 | Bacteria | 2170 |
| 226 | Ga0501083_0387921 | 3300049744 | Bacteria | 908 |
| 227 | Ga0501035_0045483 | 3300049822 | Bacteria | 3950 |
| 228 | Ga0501035_0591776 | 3300049822 | Bacteria | 905 |
| 229 | Ga0501044_0078755 | 3300049823 | Bacteria | 3340 |
| 230 | Ga0501045_0011860 | 3300049824 | Bacteria | 6125 |
| 231 | nmdc:mga03683_273292_c1 | 3300050489 | Bacteria | 788 |
| 232 | nmdc:mga03n38_201254_c1 | 3300050490 | Bacteria | 1031 |
| 233 | nmdc:mga03n38_42894_c1 | 3300050490 | Bacteria | 1980 |
| 234 | nmdc:mga03n38_67488_c1 | 3300050490 | Bacteria | 1646 |
| 235 | nmdc:mga00v17_397302_c1 | 3300050491 | Bacteria | 896 |
| 236 | nmdc:mga0yw44_14854_c1 | 3300050492 | Bacteria | 4150 |
| 237 | nmdc:mga0yw44_362859_c1 | 3300050492 | Bacteria | 976 |
| 238 | nmdc:mga06z11_58604_c1 | 3300050494 | Bacteria | 1998 |
| 239 | nmdc:mga07m45_113637_c1 | 3300050496 | Bacteria | 1561 |
| 240 | nmdc:mga08y16_37267_c1 | 3300050511 | Bacteria | 5108 |
| 241 | Ga0495601_0375661 | 3300053077 | Bacteria | 923 |
| 242 | Ga0495612_0198802 | 3300053078 | Bacteria | 884 |
| 243 | Ga0500643_001646 | 3300053087 | Bacteria | 12490 |
| 244 | Ga0501084_0000803 | 3300054114 | Bacteria | 24054 |
| 245 | Ga0501084_0093229 | 3300054114 | Bacteria | 2528 |
| 246 | Ga0501082_0029736 | 3300060353 | Bacteria | 4707 |
| 247 | Ga0501082_0046035 | 3300060353 | Bacteria | 3761 |
| 248 | Ga0501082_0485323 | 3300060353 | Bacteria | 1080 |
| 249 | Ga0466962_0576425 | 3300061719 | Bacteria | 573 |
| 250 | Ga0530510_0039573 | 3300061734 | Bacteria | 3404 |
| 251 | Ga0530510_0065955 | 3300061734 | Bacteria | 2623 |
| 252 | Ga0530510_0198302 | 3300061734 | Bacteria | 1490 |
| 253 | Ga0530510_0800515 | 3300061734 | Bacteria | 719 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221576 | 2643891320 | 160 |
| 2 | iso_pu_bacteria | 2643221590 | 2643960368 | 160 |
| 3 | iso_pu_bacteria | 2643221604 | 2644036210 | 160 |
| 4 | iso_pu_bacteria | 2675903058 | 2676473314 | 161 |
| 5 | iso_pu_bacteria | 2827628540 | 2827628549 | 161 |
| 6 | iso_pu_bacteria | 3001889506 | 3001890632 | 161 |
| 7 | 3300044684 | Ga0466966_0028706 | Ga0466966_0028706_1988_2476 | 162 |
| 8 | 3300045049 | Ga0466959_0038696 | Ga0466959_0038696_1167_1655 | 162 |
| 9 | 3300005367 | Ga0070667_100731929 | Ga0070667_1007319291 | 163 |
| 10 | 3300044656 | Ga0466969_0246724 | Ga0466969_0246724_87_578 | 163 |
| 11 | 3300044658 | Ga0466972_0110610 | Ga0466972_0110610_727_1218 | 163 |
| 12 | 3300005327 | Ga0070658_10007152 | Ga0070658_100071525 | 164 |
| 13 | 3300005336 | Ga0070680_100000530 | Ga0070680_10000053018 | 164 |
| 14 | 3300005340 | Ga0070689_100901680 | Ga0070689_1009016801 | 164 |
| 15 | 3300005458 | Ga0070681_10000101 | Ga0070681_1000010160 | 164 |
| 16 | 3300005530 | Ga0070679_100030253 | Ga0070679_1000302535 | 164 |
| 17 | 3300006048 | Ga0075363_100019774 | Ga0075363_1000197742 | 164 |
| 18 | 3300006048 | Ga0075363_100027925 | Ga0075363_1000279253 | 164 |
| 19 | 3300006051 | Ga0075364_10434138 | Ga0075364_104341381 | 164 |
| 20 | 3300006353 | Ga0075370_10084150 | Ga0075370_100841502 | 164 |
| 21 | 3300009093 | Ga0105240_10123465 | Ga0105240_101234652 | 164 |
| 22 | 3300011119 | Ga0105246_10477075 | Ga0105246_104770752 | 164 |
| 23 | 3300020070 | Ga0206356_10070626 | Ga0206356_100706264 | 164 |
| 24 | 3300020082 | Ga0206353_11024863 | Ga0206353_110248632 | 164 |
| 25 | 3300025912 | Ga0207707_10001741 | Ga0207707_1000174115 | 164 |
| 26 | 3300025913 | Ga0207695_10199243 | Ga0207695_101992432 | 164 |
| 27 | 3300025917 | Ga0207660_10002519 | Ga0207660_100025197 | 164 |
| 28 | 3300025921 | Ga0207652_10008936 | Ga0207652_100089363 | 164 |
| 29 | 3300037418 | Ga0395900_0076778 | Ga0395900_0076778_1896_2390 | 164 |
| 30 | 3300037466 | Ga0395898_0075502 | Ga0395898_0075502_2574_3068 | 164 |
| 31 | 3300044683 | Ga0466965_0033739 | Ga0466965_0033739_675_1169 | 164 |
| 32 | 3300049577 | Ga0501041_0105322 | Ga0501041_0105322_769_1263 | 164 |
| 33 | 3300049587 | Ga0501071_1021608 | Ga0501071_1021608_99_593 | 164 |
| 34 | 3300050489 | nmdc:mga03683_273292_c1 | nmdc:mga03683_273292_c1_40_534 | 164 |
| 35 | 3300050490 | nmdc:mga03n38_201254_c1 | nmdc:mga03n38_201254_c1_340_834 | 164 |
| 36 | 3300050490 | nmdc:mga03n38_42894_c1 | nmdc:mga03n38_42894_c1_1363_1857 | 164 |
| 37 | 3300050491 | nmdc:mga00v17_397302_c1 | nmdc:mga00v17_397302_c1_44_538 | 164 |
| 38 | 3300050494 | nmdc:mga06z11_58604_c1 | nmdc:mga06z11_58604_c1_971_1465 | 164 |
| 39 | 3300050496 | nmdc:mga07m45_113637_c1 | nmdc:mga07m45_113637_c1_536_1030 | 164 |
| 40 | 3300053077 | Ga0495601_0375661 | Ga0495601_0375661_274_768 | 164 |
| 41 | 3300053078 | Ga0495612_0198802 | Ga0495612_0198802_109_603 | 164 |
| 42 | 3300053087 | Ga0500643_001646 | Ga0500643_001646_8239_8748 | 164 |
| 43 | 3300001991 | JGI24743J22301_10026156 | JGI24743J22301_100261562 | 165 |
| 44 | 3300002067 | JGI24735J21928_10067230 | JGI24735J21928_100672302 | 165 |
| 45 | 3300002070 | JGI24750J21931_1042247 | JGI24750J21931_10422471 | 165 |
| 46 | 3300002075 | JGI24738J21930_10007742 | JGI24738J21930_100077421 | 165 |
| 47 | 3300002077 | JGI24744J21845_10001073 | JGI24744J21845_100010731 | 165 |
| 48 | 3300002155 | JGI24033J26618_1006394 | JGI24033J26618_10063942 | 165 |
| 49 | 3300005327 | Ga0070658_10011684 | Ga0070658_100116845 | 165 |
| 50 | 3300005327 | Ga0070658_10149638 | Ga0070658_101496382 | 165 |
| 51 | 3300005327 | Ga0070658_10651123 | Ga0070658_106511232 | 165 |
| 52 | 3300005329 | Ga0070683_100008509 | Ga0070683_1000085095 | 165 |
| 53 | 3300005329 | Ga0070683_100154830 | Ga0070683_1001548302 | 165 |
| 54 | 3300005329 | Ga0070683_100398280 | Ga0070683_1003982802 | 165 |
| 55 | 3300005329 | Ga0070683_100583012 | Ga0070683_1005830122 | 165 |
| 56 | 3300005329 | Ga0070683_101026594 | Ga0070683_1010265942 | 165 |
| 57 | 3300005331 | Ga0070670_100080629 | Ga0070670_1000806295 | 165 |
| 58 | 3300005336 | Ga0070680_100606434 | Ga0070680_1006064342 | 165 |
| 59 | 3300005338 | Ga0068868_100032672 | Ga0068868_1000326725 | 165 |
| 60 | 3300005339 | Ga0070660_100064788 | Ga0070660_1000647882 | 165 |
| 61 | 3300005339 | Ga0070660_100348185 | Ga0070660_1003481852 | 165 |
| 62 | 3300005340 | Ga0070689_100730982 | Ga0070689_1007309822 | 165 |
| 63 | 3300005341 | Ga0070691_10061267 | Ga0070691_100612672 | 165 |
| 64 | 3300005345 | Ga0070692_10063815 | Ga0070692_100638154 | 165 |
| 65 | 3300005345 | Ga0070692_10514669 | Ga0070692_105146692 | 165 |
| 66 | 3300005347 | Ga0070668_100188987 | Ga0070668_1001889872 | 165 |
| 67 | 3300005354 | Ga0070675_100117953 | Ga0070675_1001179532 | 165 |
| 68 | 3300005356 | Ga0070674_100022693 | Ga0070674_1000226935 | 165 |
| 69 | 3300005364 | Ga0070673_100214362 | Ga0070673_1002143623 | 165 |
| 70 | 3300005366 | Ga0070659_100075710 | Ga0070659_1000757103 | 165 |
| 71 | 3300005366 | Ga0070659_100151540 | Ga0070659_1001515401 | 165 |
| 72 | 3300005367 | Ga0070667_100732292 | Ga0070667_1007322922 | 165 |
| 73 | 3300005435 | Ga0070714_100002773 | Ga0070714_1000027734 | 165 |
| 74 | 3300005438 | Ga0070701_10001989 | Ga0070701_100019895 | 165 |
| 75 | 3300005456 | Ga0070678_100726044 | Ga0070678_1007260442 | 165 |
| 76 | 3300005458 | Ga0070681_10480274 | Ga0070681_104802742 | 165 |
| 77 | 3300005459 | Ga0068867_100004889 | Ga0068867_10000488911 | 165 |
| 78 | 3300005466 | Ga0070685_10107367 | Ga0070685_101073672 | 165 |
| 79 | 3300005530 | Ga0070679_100572362 | Ga0070679_1005723621 | 165 |
| 80 | 3300005535 | Ga0070684_100003875 | Ga0070684_1000038757 | 165 |
| 81 | 3300005535 | Ga0070684_100014929 | Ga0070684_1000149292 | 165 |
| 82 | 3300005535 | Ga0070684_100034921 | Ga0070684_1000349213 | 165 |
| 83 | 3300005535 | Ga0070684_100422136 | Ga0070684_1004221361 | 165 |
| 84 | 3300005543 | Ga0070672_100001684 | Ga0070672_1000016845 | 165 |
| 85 | 3300005563 | Ga0068855_100304010 | Ga0068855_1003040102 | 165 |
| 86 | 3300005577 | Ga0068857_100217727 | Ga0068857_1002177272 | 165 |
| 87 | 3300005577 | Ga0068857_100245238 | Ga0068857_1002452382 | 165 |
| 88 | 3300005615 | Ga0070702_100006418 | Ga0070702_1000064184 | 165 |
| 89 | 3300005616 | Ga0068852_100008268 | Ga0068852_1000082684 | 165 |
| 90 | 3300005618 | Ga0068864_100209414 | Ga0068864_1002094142 | 165 |
| 91 | 3300005718 | Ga0068866_10086570 | Ga0068866_100865704 | 165 |
| 92 | 3300005719 | Ga0068861_100007730 | Ga0068861_1000077305 | 165 |
| 93 | 3300005840 | Ga0068870_10090752 | Ga0068870_100907522 | 165 |
| 94 | 3300005844 | Ga0068862_100232922 | Ga0068862_1002329222 | 165 |
| 95 | 3300006038 | Ga0075365_10011900 | Ga0075365_100119002 | 165 |
| 96 | 3300006048 | Ga0075363_100014330 | Ga0075363_1000143302 | 165 |
| 97 | 3300006844 | Ga0075428_100760588 | Ga0075428_1007605881 | 165 |
| 98 | 3300006881 | Ga0068865_100098388 | Ga0068865_1000983882 | 165 |
| 99 | 3300009094 | Ga0111539_10493644 | Ga0111539_104936441 | 165 |
| 100 | 3300009098 | Ga0105245_10016311 | Ga0105245_100163115 | 165 |
| 101 | 3300009148 | Ga0105243_10048775 | Ga0105243_100487752 | 165 |
| 102 | 3300009176 | Ga0105242_10165364 | Ga0105242_101653641 | 165 |
| 103 | 3300009177 | Ga0105248_10035320 | Ga0105248_100353205 | 165 |
| 104 | 3300009553 | Ga0105249_10016635 | Ga0105249_100166358 | 165 |
| 105 | 3300010375 | Ga0105239_10192734 | Ga0105239_101927341 | 165 |
| 106 | 3300011119 | Ga0105246_10483859 | Ga0105246_104838591 | 165 |
| 107 | 3300013105 | Ga0157369_11378436 | Ga0157369_113784361 | 165 |
| 108 | 3300013296 | Ga0157374_10648632 | Ga0157374_106486321 | 165 |
| 109 | 3300013307 | Ga0157372_10104815 | Ga0157372_101048152 | 165 |
| 110 | 3300013307 | Ga0157372_10121670 | Ga0157372_101216703 | 165 |
| 111 | 3300013307 | Ga0157372_10585986 | Ga0157372_105859862 | 165 |
| 112 | 3300013307 | Ga0157372_10792044 | Ga0157372_107920442 | 165 |
| 113 | 3300013307 | Ga0157372_11960900 | Ga0157372_119609001 | 165 |
| 114 | 3300013308 | Ga0157375_10990526 | Ga0157375_109905261 | 165 |
| 115 | 3300014325 | Ga0163163_10092633 | Ga0163163_100926334 | 165 |
| 116 | 3300014326 | Ga0157380_10012627 | Ga0157380_100126274 | 165 |
| 117 | 3300014745 | Ga0157377_10004523 | Ga0157377_100045232 | 165 |
| 118 | 3300014968 | Ga0157379_10313180 | Ga0157379_103131802 | 165 |
| 119 | 3300017792 | Ga0163161_10183728 | Ga0163161_101837282 | 165 |
| 120 | 3300020081 | Ga0206354_11543417 | Ga0206354_115434172 | 165 |
| 121 | 3300020082 | Ga0206353_10301200 | Ga0206353_103012002 | 165 |
| 122 | 3300020082 | Ga0206353_11503956 | Ga0206353_115039562 | 165 |
| 123 | 3300020082 | Ga0206353_11703101 | Ga0206353_117031012 | 165 |
| 124 | 3300025899 | Ga0207642_10085198 | Ga0207642_100851982 | 165 |
| 125 | 3300025901 | Ga0207688_10027151 | Ga0207688_100271511 | 165 |
| 126 | 3300025904 | Ga0207647_10086728 | Ga0207647_100867282 | 165 |
| 127 | 3300025908 | Ga0207643_10000932 | Ga0207643_1000093214 | 165 |
| 128 | 3300025909 | Ga0207705_10124562 | Ga0207705_101245622 | 165 |
| 129 | 3300025917 | Ga0207660_10578034 | Ga0207660_105780342 | 165 |
| 130 | 3300025919 | Ga0207657_10078425 | Ga0207657_100784253 | 165 |
| 131 | 3300025921 | Ga0207652_10138693 | Ga0207652_101386932 | 165 |
| 132 | 3300025925 | Ga0207650_10232900 | Ga0207650_102329001 | 165 |
| 133 | 3300025927 | Ga0207687_10163817 | Ga0207687_101638171 | 165 |
| 134 | 3300025931 | Ga0207644_10301871 | Ga0207644_103018712 | 165 |
| 135 | 3300025932 | Ga0207690_10092404 | Ga0207690_100924042 | 165 |
| 136 | 3300025932 | Ga0207690_10207915 | Ga0207690_102079152 | 165 |
| 137 | 3300025935 | Ga0207709_10031596 | Ga0207709_100315962 | 165 |
| 138 | 3300025938 | Ga0207704_10397588 | Ga0207704_103975881 | 165 |
| 139 | 3300025940 | Ga0207691_10010057 | Ga0207691_100100574 | 165 |
| 140 | 3300025941 | Ga0207711_10118783 | Ga0207711_101187832 | 165 |
| 141 | 3300025942 | Ga0207689_10291085 | Ga0207689_102910852 | 165 |
| 142 | 3300025944 | Ga0207661_10067342 | Ga0207661_100673422 | 165 |
| 143 | 3300025944 | Ga0207661_10124720 | Ga0207661_101247202 | 165 |
| 144 | 3300025944 | Ga0207661_10131748 | Ga0207661_101317482 | 165 |
| 145 | 3300025944 | Ga0207661_10281472 | Ga0207661_102814722 | 165 |
| 146 | 3300025944 | Ga0207661_10392238 | Ga0207661_103922382 | 165 |
| 147 | 3300025949 | Ga0207667_10324200 | Ga0207667_103242003 | 165 |
| 148 | 3300025961 | Ga0207712_10045502 | Ga0207712_100455022 | 165 |
| 149 | 3300025972 | Ga0207668_10215633 | Ga0207668_102156332 | 165 |
| 150 | 3300026023 | Ga0207677_10075677 | Ga0207677_100756775 | 165 |
| 151 | 3300026075 | Ga0207708_10000227 | Ga0207708_100002279 | 165 |
| 152 | 3300026088 | Ga0207641_11159055 | Ga0207641_111590551 | 165 |
| 153 | 3300026089 | Ga0207648_10000576 | Ga0207648_1000057614 | 165 |
| 154 | 3300026095 | Ga0207676_10448006 | Ga0207676_104480062 | 165 |
| 155 | 3300026116 | Ga0207674_10264027 | Ga0207674_102640272 | 165 |
| 156 | 3300026118 | Ga0207675_100004066 | Ga0207675_1000040664 | 165 |
| 157 | 3300026121 | Ga0207683_10889874 | Ga0207683_108898742 | 165 |
| 158 | 3300026142 | Ga0207698_10157992 | Ga0207698_101579922 | 165 |
| 159 | 3300027907 | Ga0207428_10067093 | Ga0207428_100670934 | 165 |
| 160 | 3300028380 | Ga0268265_10100805 | Ga0268265_101008052 | 165 |
| 161 | 3300031995 | Ga0307409_100905058 | Ga0307409_1009050582 | 165 |
| 162 | 3300037312 | Ga0395899_0018143 | Ga0395899_0018143_3806_4303 | 165 |
| 163 | 3300038443 | Ga0395901_0386577 | Ga0395901_0386577_140_637 | 165 |
| 164 | 3300038443 | Ga0395901_1153586 | Ga0395901_1153586_27_545 | 165 |
| 165 | 3300041463 | Ga0451804_0356831 | Ga0451804_0356831_34_531 | 165 |
| 166 | 3300041512 | Ga0451853_3725642 | Ga0451853_3725642_140_637 | 165 |
| 167 | 3300044658 | Ga0466972_0309380 | Ga0466972_0309380_109_606 | 165 |
| 168 | 3300044683 | Ga0466965_0125955 | Ga0466965_0125955_442_939 | 165 |
| 169 | 3300044694 | Ga0466963_0021493 | Ga0466963_0021493_887_1396 | 165 |
| 170 | 3300044842 | Ga0466957_0063258 | Ga0466957_0063258_141_638 | 165 |
| 171 | 3300044901 | Ga0466960_0018985 | Ga0466960_0018985_587_1084 | 165 |
| 172 | 3300044901 | Ga0466960_0133359 | Ga0466960_0133359_803_1300 | 165 |
| 173 | 3300045976 | Ga0466967_0021160 | Ga0466967_0021160_4129_4626 | 165 |
| 174 | 3300045976 | Ga0466967_0022773 | Ga0466967_0022773_4509_5006 | 165 |
| 175 | 3300045976 | Ga0466967_0921847 | Ga0466967_0921847_40_543 | 165 |
| 176 | 3300047445 | Ga0495677_0304451 | Ga0495677_0304451_113_613 | 165 |
| 177 | 3300048905 | Ga0496102_0482641 | Ga0496102_0482641_210_707 | 165 |
| 178 | 3300048911 | Ga0496108_0826111 | Ga0496108_0826111_115_612 | 165 |
| 179 | 3300048912 | Ga0496109_0032620 | Ga0496109_0032620_3990_4487 | 165 |
| 180 | 3300048912 | Ga0496109_0541099 | Ga0496109_0541099_259_756 | 165 |
| 181 | 3300048913 | Ga0496110_0079478 | Ga0496110_0079478_1199_1696 | 165 |
| 182 | 3300048913 | Ga0496110_0127964 | Ga0496110_0127964_1177_1674 | 165 |
| 183 | 3300048913 | Ga0496110_0387081 | Ga0496110_0387081_315_812 | 165 |
| 184 | 3300048914 | Ga0496111_0528138 | Ga0496111_0528138_216_713 | 165 |
| 185 | 3300048917 | Ga0496114_0058307 | Ga0496114_0058307_1113_1610 | 165 |
| 186 | 3300048917 | Ga0496114_0125909 | Ga0496114_0125909_1032_1529 | 165 |
| 187 | 3300048917 | Ga0496114_1400312 | Ga0496114_1400312_59_556 | 165 |
| 188 | 3300049568 | Ga0501031_0005383 | Ga0501031_0005383_3388_3897 | 165 |
| 189 | 3300049568 | Ga0501031_0055019 | Ga0501031_0055019_1275_1772 | 165 |
| 190 | 3300049570 | Ga0501033_0036157 | Ga0501033_0036157_3051_3548 | 165 |
| 191 | 3300049572 | Ga0501036_0030483 | Ga0501036_0030483_2753_3262 | 165 |
| 192 | 3300049574 | Ga0501038_0175612 | Ga0501038_0175612_105_614 | 165 |
| 193 | 3300049574 | Ga0501038_0480359 | Ga0501038_0480359_261_758 | 165 |
| 194 | 3300049574 | Ga0501038_0807775 | Ga0501038_0807775_59_568 | 165 |
| 195 | 3300049575 | Ga0501039_0013136 | Ga0501039_0013136_2722_3231 | 165 |
| 196 | 3300049575 | Ga0501039_0050826 | Ga0501039_0050826_497_994 | 165 |
| 197 | 3300049576 | Ga0501040_0006621 | Ga0501040_0006621_4448_4957 | 165 |
| 198 | 3300049576 | Ga0501040_0007068 | Ga0501040_0007068_1576_2073 | 165 |
| 199 | 3300049577 | Ga0501041_0009045 | Ga0501041_0009045_272_769 | 165 |
| 200 | 3300049577 | Ga0501041_0020404 | Ga0501041_0020404_316_825 | 165 |
| 201 | 3300049577 | Ga0501041_0223754 | Ga0501041_0223754_257_754 | 165 |
| 202 | 3300049578 | Ga0501042_0005774 | Ga0501042_0005774_3391_3900 | 165 |
| 203 | 3300049579 | Ga0501043_0106067 | Ga0501043_0106067_67_564 | 165 |
| 204 | 3300049579 | Ga0501043_0797077 | Ga0501043_0797077_15_524 | 165 |
| 205 | 3300049580 | Ga0501046_0038031 | Ga0501046_0038031_1031_1540 | 165 |
| 206 | 3300049580 | Ga0501046_0120791 | Ga0501046_0120791_1374_1871 | 165 |
| 207 | 3300049582 | Ga0501048_0058578 | Ga0501048_0058578_93_602 | 165 |
| 208 | 3300049582 | Ga0501048_1026966 | Ga0501048_1026966_58_567 | 165 |
| 209 | 3300049583 | Ga0501067_0071989 | Ga0501067_0071989_50_550 | 165 |
| 210 | 3300049584 | Ga0501068_0008819 | Ga0501068_0008819_3360_3869 | 165 |
| 211 | 3300049584 | Ga0501068_0032129 | Ga0501068_0032129_469_966 | 165 |
| 212 | 3300049584 | Ga0501068_0343340 | Ga0501068_0343340_358_867 | 165 |
| 213 | 3300049584 | Ga0501068_0461305 | Ga0501068_0461305_31_537 | 165 |
| 214 | 3300049586 | Ga0501070_0483177 | Ga0501070_0483177_301_798 | 165 |
| 215 | 3300049586 | Ga0501070_0484616 | Ga0501070_0484616_304_801 | 165 |
| 216 | 3300049587 | Ga0501071_0002621 | Ga0501071_0002621_7957_8466 | 165 |
| 217 | 3300049587 | Ga0501071_0056945 | Ga0501071_0056945_579_1076 | 165 |
| 218 | 3300049587 | Ga0501071_0346803 | Ga0501071_0346803_560_1057 | 165 |
| 219 | 3300049587 | Ga0501071_0401575 | Ga0501071_0401575_35_592 | 165 |
| 220 | 3300049588 | Ga0501072_0002981 | Ga0501072_0002981_11239_11748 | 165 |
| 221 | 3300049588 | Ga0501072_0004851 | Ga0501072_0004851_2055_2552 | 165 |
| 222 | 3300049588 | Ga0501072_0037594 | Ga0501072_0037594_3028_3585 | 165 |
| 223 | 3300049589 | Ga0501073_0106768 | Ga0501073_0106768_22_519 | 165 |
| 224 | 3300049590 | Ga0501074_0015509 | Ga0501074_0015509_4983_5492 | 165 |
| 225 | 3300049591 | Ga0501075_0000413 | Ga0501075_0000413_21922_22431 | 165 |
| 226 | 3300049591 | Ga0501075_0091804 | Ga0501075_0091804_1742_2239 | 165 |
| 227 | 3300049592 | Ga0501076_0010783 | Ga0501076_0010783_3051_3560 | 165 |
| 228 | 3300049592 | Ga0501076_0047561 | Ga0501076_0047561_22_519 | 165 |
| 229 | 3300049592 | Ga0501076_0272615 | Ga0501076_0272615_212_709 | 165 |
| 230 | 3300049592 | Ga0501076_0631565 | Ga0501076_0631565_238_795 | 165 |
| 231 | 3300049592 | Ga0501076_0851214 | Ga0501076_0851214_170_703 | 165 |
| 232 | 3300049593 | Ga0501077_0003862 | Ga0501077_0003862_346_855 | 165 |
| 233 | 3300049593 | Ga0501077_0039826 | Ga0501077_0039826_362_859 | 165 |
| 234 | 3300049593 | Ga0501077_0784354 | Ga0501077_0784354_29_526 | 165 |
| 235 | 3300049741 | Ga0501079_0012791 | Ga0501079_0012791_4530_5039 | 165 |
| 236 | 3300049741 | Ga0501079_0039234 | Ga0501079_0039234_561_1058 | 165 |
| 237 | 3300049742 | Ga0501080_0019881 | Ga0501080_0019881_3357_3866 | 165 |
| 238 | 3300049742 | Ga0501080_0401333 | Ga0501080_0401333_316_813 | 165 |
| 239 | 3300049743 | Ga0501081_0001867 | Ga0501081_0001867_5393_5902 | 165 |
| 240 | 3300049744 | Ga0501083_0079794 | Ga0501083_0079794_281_790 | 165 |
| 241 | 3300049744 | Ga0501083_0387921 | Ga0501083_0387921_30_527 | 165 |
| 242 | 3300049822 | Ga0501035_0045483 | Ga0501035_0045483_1261_1770 | 165 |
| 243 | 3300049822 | Ga0501035_0591776 | Ga0501035_0591776_88_585 | 165 |
| 244 | 3300049823 | Ga0501044_0078755 | Ga0501044_0078755_1585_2082 | 165 |
| 245 | 3300049824 | Ga0501045_0011860 | Ga0501045_0011860_2929_3438 | 165 |
| 246 | 3300050490 | nmdc:mga03n38_67488_c1 | nmdc:mga03n38_67488_c1_1032_1538 | 165 |
| 247 | 3300050492 | nmdc:mga0yw44_14854_c1 | nmdc:mga0yw44_14854_c1_2033_2530 | 165 |
| 248 | 3300050492 | nmdc:mga0yw44_362859_c1 | nmdc:mga0yw44_362859_c1_455_952 | 165 |
| 249 | 3300050511 | nmdc:mga08y16_37267_c1 | nmdc:mga08y16_37267_c1_3111_3608 | 165 |
| 250 | 3300054114 | Ga0501084_0000803 | Ga0501084_0000803_4425_4934 | 165 |
| 251 | 3300054114 | Ga0501084_0093229 | Ga0501084_0093229_2010_2507 | 165 |
| 252 | 3300060353 | Ga0501082_0029736 | Ga0501082_0029736_2564_3061 | 165 |
| 253 | 3300060353 | Ga0501082_0046035 | Ga0501082_0046035_185_694 | 165 |
| 254 | 3300060353 | Ga0501082_0485323 | Ga0501082_0485323_378_911 | 165 |
| 255 | 3300061719 | Ga0466962_0576425 | Ga0466962_0576425_49_546 | 165 |
| 256 | 3300061734 | Ga0530510_0039573 | Ga0530510_0039573_2554_3063 | 165 |
| 257 | 3300061734 | Ga0530510_0065955 | Ga0530510_0065955_527_1024 | 165 |
| 258 | 3300061734 | Ga0530510_0198302 | Ga0530510_0198302_804_1301 | 165 |
| 259 | 3300061734 | Ga0530510_0800515 | Ga0530510_0800515_203_703 | 165 |
| 260 | iso_pu_bacteria | 2739367898 | 2740169051 | 165 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jqd-assembly1.cif.gz_B | the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus | 0.8703 | 2 | 165 |
| 6jqc-assembly1.cif.gz_B | the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus | 0.8673 | 2 | 165 |
| 6y04-assembly1.cif.gz_B | crystal structure of beta-carbonic anhydrase isoform i (tvaca1) from the trichomonas vaginalis protozoan. | 0.8543 | 2 | 163 |
| 3las-assembly1.cif.gz_B | crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution | 0.8534 | 1 | 163 |
| 6jqd-assembly1.cif.gz_B | the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus | 0.8511 | 2 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A207_1_162_3.40.1050.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8593 | 6 | 163 | 3.40.1050.10 |
| 3lasB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8534 | 1 | 163 | 3.40.1050.10 |
| 1g5cD00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8504 | 31 | 163 | 3.40.1050.10 |
| 3lasB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8395 | 1 | 163 | 3.40.1050.10 |
| 1ylkA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8337 | 2 | 165 | 3.40.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S9QBD2-F1-model_v4 | Carbonic anhydrase | 0.9937 | 10 | 165 |
GO:0004089
GO:0008270 |
| AF-A0A7V9F6I8-F1-model_v4 | Carbonic anhydrase | 0.9882 | 1 | 165 |
GO:0004089
GO:0008270 |
| AF-A0A838KN49-F1-model_v4 | Carbonic anhydrase | 0.9866 | 1 | 165 |
GO:0004089
GO:0008270 |
| AF-A0A7V9F6I8-F1-model_v4 | Carbonic anhydrase | 0.9823 | 1 | 165 |
GO:0004089
GO:0008270 |
| AF-A0A0S9QBD2-F1-model_v4 | Carbonic anhydrase | 0.9812 | 10 | 165 |
GO:0004089
GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar