F369898

General Info

Members Datasets Scaffolds Average Seq Length
260 172 253 167

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0401575|Ga0501071_0401575_35_592
Length 185
Sequence VGSDFDARGDTGFDATLGTEFGAEFDDLLAANRKFAETFALAGFDGVAHRGVALVTCMDSRIDPLGMLGLEPGDAKIFRNPGGRITSAAVDALVLGVHLLGVERILVVPHTRCAMATSSEAELRDQVTEASGQDAGWTRWQVVPDQEAALFDDVARIKAHPLIPDRVAVGGFMYDVDTGLLTRLT

Samples

Sample ID Description Type Environment
1 2643221576 Nocardioides sp. Root614 Isolate Unclassified
2 2643221590 Nocardioides sp. Root682 Isolate Unclassified
3 2643221604 Nocardioides sp. Root190 Isolate Unclassified
4 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
5 2739367898 Nocardioides sp. CF479 Isolate Unclassified
6 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
7 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
168 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 2.31
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 4.62
Rhizosphere 86.92
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10026156 3300001991 Bacteria 1134
2 JGI24735J21928_10067230 3300002067 Bacteria 1028
3 JGI24750J21931_1042247 3300002070 Bacteria 695
4 JGI24738J21930_10007742 3300002075 Bacteria 2466
5 JGI24744J21845_10001073 3300002077 Bacteria 5287
6 JGI24033J26618_1006394 3300002155 Bacteria 1320
7 Ga0070658_10007152 3300005327 Bacteria 9014
8 Ga0070658_10011684 3300005327 Bacteria 7043
9 Ga0070658_10149638 3300005327 Bacteria 1954
10 Ga0070658_10651123 3300005327 Bacteria 914
11 Ga0070683_100008509 3300005329 Bacteria 8718
12 Ga0070683_100154830 3300005329 Bacteria 2174
13 Ga0070683_100398280 3300005329 Bacteria 1313
14 Ga0070683_100583012 3300005329 Bacteria 1070
15 Ga0070683_101026594 3300005329 Bacteria 792
16 Ga0070670_100080629 3300005331 Bacteria 2797
17 Ga0070680_100000530 3300005336 Bacteria 26042
18 Ga0070680_100606434 3300005336 Bacteria 940
19 Ga0068868_100032672 3300005338 Bacteria 4005
20 Ga0070660_100064788 3300005339 Bacteria 2844
21 Ga0070660_100348185 3300005339 Bacteria 1220
22 Ga0070689_100730982 3300005340 Bacteria 866
23 Ga0070689_100901680 3300005340 Bacteria 782
24 Ga0070691_10061267 3300005341 Bacteria 1810
25 Ga0070692_10063815 3300005345 Bacteria 1947
26 Ga0070692_10514669 3300005345 Bacteria 778
27 Ga0070668_100188987 3300005347 Bacteria 1686
28 Ga0070675_100117953 3300005354 Bacteria 2253
29 Ga0070674_100022693 3300005356 Bacteria 4050
30 Ga0070673_100214362 3300005364 Bacteria 1664
31 Ga0070659_100075710 3300005366 Bacteria 2683
32 Ga0070659_100151540 3300005366 Bacteria 1892
33 Ga0070667_100731929 3300005367 Bacteria 916
34 Ga0070667_100732292 3300005367 Bacteria 916
35 Ga0070714_100002773 3300005435 Bacteria 12909
36 Ga0070701_10001989 3300005438 Bacteria 7750
37 Ga0070678_100726044 3300005456 Bacteria 897
38 Ga0070681_10000101 3300005458 Bacteria 63429
39 Ga0070681_10480274 3300005458 Bacteria 1155
40 Ga0068867_100004889 3300005459 Bacteria 9431
41 Ga0070685_10107367 3300005466 Bacteria 1714
42 Ga0070679_100030253 3300005530 Bacteria 5345
43 Ga0070679_100572362 3300005530 Bacteria 1073
44 Ga0070684_100003875 3300005535 Bacteria 11322
45 Ga0070684_100014929 3300005535 Bacteria 6305
46 Ga0070684_100034921 3300005535 Bacteria 4301
47 Ga0070684_100422136 3300005535 Bacteria 1231
48 Ga0070672_100001684 3300005543 Bacteria 13785
49 Ga0068855_100304010 3300005563 Bacteria 1766
50 Ga0068857_100217727 3300005577 Bacteria 1743
51 Ga0068857_100245238 3300005577 Bacteria 1641
52 Ga0070702_100006418 3300005615 Bacteria 5565
53 Ga0068852_100008268 3300005616 Bacteria 7656
54 Ga0068864_100209414 3300005618 Bacteria 1795
55 Ga0068866_10086570 3300005718 Bacteria 1696
56 Ga0068861_100007730 3300005719 Bacteria 7383
57 Ga0068870_10090752 3300005840 Bacteria 1708
58 Ga0068862_100232922 3300005844 Bacteria 1672
59 Ga0075365_10011900 3300006038 Bacteria 5138
60 Ga0075363_100014330 3300006048 Bacteria 3870
61 Ga0075363_100019774 3300006048 Bacteria 3370
62 Ga0075363_100027925 3300006048 Bacteria 2898
63 Ga0075364_10434138 3300006051 Bacteria 897
64 Ga0075370_10084150 3300006353 Bacteria 1831
65 Ga0075428_100760588 3300006844 Bacteria 1031
66 Ga0068865_100098388 3300006881 Bacteria 2137
67 Ga0105240_10123465 3300009093 Bacteria 3115
68 Ga0111539_10493644 3300009094 Bacteria 1426
69 Ga0105245_10016311 3300009098 Bacteria 6477
70 Ga0105243_10048775 3300009148 Bacteria 3339
71 Ga0105242_10165364 3300009176 Bacteria 1940
72 Ga0105248_10035320 3300009177 Bacteria 5591
73 Ga0105249_10016635 3300009553 Bacteria 6529
74 Ga0105239_10192734 3300010375 Bacteria 2281
75 Ga0105246_10477075 3300011119 Bacteria 1054
76 Ga0105246_10483859 3300011119 Bacteria 1048
77 Ga0157369_11378436 3300013105 Bacteria 718
78 Ga0157374_10648632 3300013296 Bacteria 1067
79 Ga0157372_10104815 3300013307 Bacteria 3234
80 Ga0157372_10121670 3300013307 Bacteria 2998
81 Ga0157372_10585986 3300013307 Bacteria 1300
82 Ga0157372_10792044 3300013307 Bacteria 1102
83 Ga0157372_11960900 3300013307 Bacteria 673
84 Ga0157375_10990526 3300013308 Bacteria 981
85 Ga0163163_10092633 3300014325 Bacteria 3037
86 Ga0157380_10012627 3300014326 Bacteria 6130
87 Ga0157377_10004523 3300014745 Bacteria 6418
88 Ga0157379_10313180 3300014968 Bacteria 1432
89 Ga0163161_10183728 3300017792 Bacteria 1605
90 Ga0206356_10070626 3300020070 Bacteria 2470
91 Ga0206354_11543417 3300020081 Bacteria 1137
92 Ga0206353_10301200 3300020082 Bacteria 957
93 Ga0206353_11024863 3300020082 Bacteria 4276
94 Ga0206353_11503956 3300020082 Bacteria 1032
95 Ga0206353_11703101 3300020082 Bacteria 1152
96 Ga0207642_10085198 3300025899 Bacteria 1546
97 Ga0207688_10027151 3300025901 Bacteria 3149
98 Ga0207647_10086728 3300025904 Bacteria 1871
99 Ga0207643_10000932 3300025908 Bacteria 17549
100 Ga0207705_10124562 3300025909 Bacteria 1914
101 Ga0207707_10001741 3300025912 Bacteria 20017
102 Ga0207695_10199243 3300025913 Bacteria 1917
103 Ga0207660_10002519 3300025917 Bacteria 12044
104 Ga0207660_10578034 3300025917 Bacteria 914
105 Ga0207657_10078425 3300025919 Bacteria 2781
106 Ga0207652_10008936 3300025921 Bacteria 8073
107 Ga0207652_10138693 3300025921 Bacteria 2173
108 Ga0207650_10232900 3300025925 Bacteria 1486
109 Ga0207687_10163817 3300025927 Bacteria 1709
110 Ga0207644_10301871 3300025931 Bacteria 1291
111 Ga0207690_10092404 3300025932 Bacteria 2141
112 Ga0207690_10207915 3300025932 Bacteria 1490
113 Ga0207709_10031596 3300025935 Bacteria 3094
114 Ga0207704_10397588 3300025938 Bacteria 1086
115 Ga0207691_10010057 3300025940 Bacteria 9079
116 Ga0207711_10118783 3300025941 Bacteria 2359
117 Ga0207689_10291085 3300025942 Bacteria 1353
118 Ga0207661_10067342 3300025944 Bacteria 2912
119 Ga0207661_10124720 3300025944 Bacteria 2198
120 Ga0207661_10131748 3300025944 Bacteria 2142
121 Ga0207661_10281472 3300025944 Bacteria 1487
122 Ga0207661_10392238 3300025944 Bacteria 1258
123 Ga0207667_10324200 3300025949 Bacteria 1573
124 Ga0207712_10045502 3300025961 Bacteria 3039
125 Ga0207668_10215633 3300025972 Bacteria 1538
126 Ga0207677_10075677 3300026023 Bacteria 2393
127 Ga0207708_10000227 3300026075 Bacteria 44512
128 Ga0207641_11159055 3300026088 Bacteria 772
129 Ga0207648_10000576 3300026089 Bacteria 41193
130 Ga0207676_10448006 3300026095 Bacteria 1216
131 Ga0207674_10264027 3300026116 Bacteria 1669
132 Ga0207675_100004066 3300026118 Bacteria 14158
133 Ga0207683_10889874 3300026121 Bacteria 827
134 Ga0207698_10157992 3300026142 Bacteria 1978
135 Ga0207428_10067093 3300027907 Bacteria 2825
136 Ga0268265_10100805 3300028380 Bacteria 2332
137 Ga0307409_100905058 3300031995 Bacteria 896
138 Ga0395899_0018143 3300037312 Bacteria 5354
139 Ga0395900_0076778 3300037418 Bacteria 3433
140 Ga0395898_0075502 3300037466 Bacteria 3256
141 Ga0395901_0386577 3300038443 Bacteria 1439
142 Ga0395901_1153586 3300038443 Bacteria 743
143 Ga0451804_0356831 3300041463 Bacteria 601
144 Ga0451853_3725642 3300041512 Bacteria 888
145 Ga0466969_0246724 3300044656 Bacteria 810
146 Ga0466972_0110610 3300044658 Bacteria 1298
147 Ga0466972_0309380 3300044658 Bacteria 738
148 Ga0466965_0033739 3300044683 Bacteria 2502
149 Ga0466965_0125955 3300044683 Bacteria 1325
150 Ga0466966_0028706 3300044684 Bacteria 3621
151 Ga0466963_0021493 3300044694 Bacteria 4072
152 Ga0466957_0063258 3300044842 Bacteria 2274
153 Ga0466960_0018985 3300044901 Bacteria 3022
154 Ga0466960_0133359 3300044901 Bacteria 1313
155 Ga0466959_0038696 3300045049 Bacteria 3524
156 Ga0466967_0021160 3300045976 Bacteria 5275
157 Ga0466967_0022773 3300045976 Bacteria 5121
158 Ga0466967_0921847 3300045976 Bacteria 869
159 Ga0495677_0304451 3300047445 Bacteria 627
160 Ga0496102_0482641 3300048905 Bacteria 1161
161 Ga0496108_0826111 3300048911 Bacteria 798
162 Ga0496109_0032620 3300048912 Bacteria 4682
163 Ga0496109_0541099 3300048912 Bacteria 1099
164 Ga0496110_0079478 3300048913 Bacteria 2920
165 Ga0496110_0127964 3300048913 Bacteria 2292
166 Ga0496110_0387081 3300048913 Bacteria 1274
167 Ga0496111_0528138 3300048914 Bacteria 867
168 Ga0496114_0058307 3300048917 Bacteria 3224
169 Ga0496114_0125909 3300048917 Bacteria 2208
170 Ga0496114_1400312 3300048917 Bacteria 587
171 Ga0501031_0005383 3300049568 Bacteria 8336
172 Ga0501031_0055019 3300049568 Bacteria 2593
173 Ga0501033_0036157 3300049570 Bacteria 3702
174 Ga0501036_0030483 3300049572 Bacteria 4555
175 Ga0501038_0175612 3300049574 Bacteria 1731
176 Ga0501038_0480359 3300049574 Bacteria 952
177 Ga0501038_0807775 3300049574 Bacteria 697
178 Ga0501039_0013136 3300049575 Bacteria 6329
179 Ga0501039_0050826 3300049575 Bacteria 3207
180 Ga0501040_0006621 3300049576 Bacteria 7520
181 Ga0501040_0007068 3300049576 Bacteria 7276
182 Ga0501041_0009045 3300049577 Bacteria 5861
183 Ga0501041_0020404 3300049577 Bacteria 3962
184 Ga0501041_0105322 3300049577 Bacteria 1748
185 Ga0501041_0223754 3300049577 Bacteria 1181
186 Ga0501042_0005774 3300049578 Bacteria 7991
187 Ga0501043_0106067 3300049579 Bacteria 2207
188 Ga0501043_0797077 3300049579 Bacteria 684
189 Ga0501046_0038031 3300049580 Bacteria 3864
190 Ga0501046_0120791 3300049580 Bacteria 1993
191 Ga0501048_0058578 3300049582 Bacteria 2730
192 Ga0501048_1026966 3300049582 Bacteria 593
193 Ga0501067_0071989 3300049583 Bacteria 1915
194 Ga0501068_0008819 3300049584 Bacteria 5625
195 Ga0501068_0032129 3300049584 Bacteria 3120
196 Ga0501068_0343340 3300049584 Bacteria 959
197 Ga0501068_0461305 3300049584 Bacteria 822
198 Ga0501070_0483177 3300049586 Bacteria 996
199 Ga0501070_0484616 3300049586 Bacteria 994
200 Ga0501071_0002621 3300049587 Bacteria 10998
201 Ga0501071_0056945 3300049587 Bacteria 2824
202 Ga0501071_0346803 3300049587 Bacteria 1130
203 Ga0501071_0401575 3300049587 Bacteria 1046
204 Ga0501071_1021608 3300049587 Bacteria 639
205 Ga0501072_0002981 3300049588 Bacteria 12753
206 Ga0501072_0004851 3300049588 Bacteria 10241
207 Ga0501072_0037594 3300049588 Bacteria 3797
208 Ga0501073_0106768 3300049589 Bacteria 1943
209 Ga0501074_0015509 3300049590 Bacteria 5539
210 Ga0501075_0000413 3300049591 Bacteria 24963
211 Ga0501075_0091804 3300049591 Bacteria 2304
212 Ga0501076_0010783 3300049592 Bacteria 6793
213 Ga0501076_0047561 3300049592 Bacteria 3392
214 Ga0501076_0272615 3300049592 Bacteria 1386
215 Ga0501076_0631565 3300049592 Bacteria 884
216 Ga0501076_0851214 3300049592 Bacteria 752
217 Ga0501077_0003862 3300049593 Bacteria 9032
218 Ga0501077_0039826 3300049593 Bacteria 2993
219 Ga0501077_0784354 3300049593 Bacteria 613
220 Ga0501079_0012791 3300049741 Bacteria 6408
221 Ga0501079_0039234 3300049741 Bacteria 3652
222 Ga0501080_0019881 3300049742 Bacteria 6219
223 Ga0501080_0401333 3300049742 Bacteria 1233
224 Ga0501081_0001867 3300049743 Bacteria 13091
225 Ga0501083_0079794 3300049744 Bacteria 2170
226 Ga0501083_0387921 3300049744 Bacteria 908
227 Ga0501035_0045483 3300049822 Bacteria 3950
228 Ga0501035_0591776 3300049822 Bacteria 905
229 Ga0501044_0078755 3300049823 Bacteria 3340
230 Ga0501045_0011860 3300049824 Bacteria 6125
231 nmdc:mga03683_273292_c1 3300050489 Bacteria 788
232 nmdc:mga03n38_201254_c1 3300050490 Bacteria 1031
233 nmdc:mga03n38_42894_c1 3300050490 Bacteria 1980
234 nmdc:mga03n38_67488_c1 3300050490 Bacteria 1646
235 nmdc:mga00v17_397302_c1 3300050491 Bacteria 896
236 nmdc:mga0yw44_14854_c1 3300050492 Bacteria 4150
237 nmdc:mga0yw44_362859_c1 3300050492 Bacteria 976
238 nmdc:mga06z11_58604_c1 3300050494 Bacteria 1998
239 nmdc:mga07m45_113637_c1 3300050496 Bacteria 1561
240 nmdc:mga08y16_37267_c1 3300050511 Bacteria 5108
241 Ga0495601_0375661 3300053077 Bacteria 923
242 Ga0495612_0198802 3300053078 Bacteria 884
243 Ga0500643_001646 3300053087 Bacteria 12490
244 Ga0501084_0000803 3300054114 Bacteria 24054
245 Ga0501084_0093229 3300054114 Bacteria 2528
246 Ga0501082_0029736 3300060353 Bacteria 4707
247 Ga0501082_0046035 3300060353 Bacteria 3761
248 Ga0501082_0485323 3300060353 Bacteria 1080
249 Ga0466962_0576425 3300061719 Bacteria 573
250 Ga0530510_0039573 3300061734 Bacteria 3404
251 Ga0530510_0065955 3300061734 Bacteria 2623
252 Ga0530510_0198302 3300061734 Bacteria 1490
253 Ga0530510_0800515 3300061734 Bacteria 719

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221576 2643891320 160
2 iso_pu_bacteria 2643221590 2643960368 160
3 iso_pu_bacteria 2643221604 2644036210 160
4 iso_pu_bacteria 2675903058 2676473314 161
5 iso_pu_bacteria 2827628540 2827628549 161
6 iso_pu_bacteria 3001889506 3001890632 161
7 3300044684 Ga0466966_0028706 Ga0466966_0028706_1988_2476 162
8 3300045049 Ga0466959_0038696 Ga0466959_0038696_1167_1655 162
9 3300005367 Ga0070667_100731929 Ga0070667_1007319291 163
10 3300044656 Ga0466969_0246724 Ga0466969_0246724_87_578 163
11 3300044658 Ga0466972_0110610 Ga0466972_0110610_727_1218 163
12 3300005327 Ga0070658_10007152 Ga0070658_100071525 164
13 3300005336 Ga0070680_100000530 Ga0070680_10000053018 164
14 3300005340 Ga0070689_100901680 Ga0070689_1009016801 164
15 3300005458 Ga0070681_10000101 Ga0070681_1000010160 164
16 3300005530 Ga0070679_100030253 Ga0070679_1000302535 164
17 3300006048 Ga0075363_100019774 Ga0075363_1000197742 164
18 3300006048 Ga0075363_100027925 Ga0075363_1000279253 164
19 3300006051 Ga0075364_10434138 Ga0075364_104341381 164
20 3300006353 Ga0075370_10084150 Ga0075370_100841502 164
21 3300009093 Ga0105240_10123465 Ga0105240_101234652 164
22 3300011119 Ga0105246_10477075 Ga0105246_104770752 164
23 3300020070 Ga0206356_10070626 Ga0206356_100706264 164
24 3300020082 Ga0206353_11024863 Ga0206353_110248632 164
25 3300025912 Ga0207707_10001741 Ga0207707_1000174115 164
26 3300025913 Ga0207695_10199243 Ga0207695_101992432 164
27 3300025917 Ga0207660_10002519 Ga0207660_100025197 164
28 3300025921 Ga0207652_10008936 Ga0207652_100089363 164
29 3300037418 Ga0395900_0076778 Ga0395900_0076778_1896_2390 164
30 3300037466 Ga0395898_0075502 Ga0395898_0075502_2574_3068 164
31 3300044683 Ga0466965_0033739 Ga0466965_0033739_675_1169 164
32 3300049577 Ga0501041_0105322 Ga0501041_0105322_769_1263 164
33 3300049587 Ga0501071_1021608 Ga0501071_1021608_99_593 164
34 3300050489 nmdc:mga03683_273292_c1 nmdc:mga03683_273292_c1_40_534 164
35 3300050490 nmdc:mga03n38_201254_c1 nmdc:mga03n38_201254_c1_340_834 164
36 3300050490 nmdc:mga03n38_42894_c1 nmdc:mga03n38_42894_c1_1363_1857 164
37 3300050491 nmdc:mga00v17_397302_c1 nmdc:mga00v17_397302_c1_44_538 164
38 3300050494 nmdc:mga06z11_58604_c1 nmdc:mga06z11_58604_c1_971_1465 164
39 3300050496 nmdc:mga07m45_113637_c1 nmdc:mga07m45_113637_c1_536_1030 164
40 3300053077 Ga0495601_0375661 Ga0495601_0375661_274_768 164
41 3300053078 Ga0495612_0198802 Ga0495612_0198802_109_603 164
42 3300053087 Ga0500643_001646 Ga0500643_001646_8239_8748 164
43 3300001991 JGI24743J22301_10026156 JGI24743J22301_100261562 165
44 3300002067 JGI24735J21928_10067230 JGI24735J21928_100672302 165
45 3300002070 JGI24750J21931_1042247 JGI24750J21931_10422471 165
46 3300002075 JGI24738J21930_10007742 JGI24738J21930_100077421 165
47 3300002077 JGI24744J21845_10001073 JGI24744J21845_100010731 165
48 3300002155 JGI24033J26618_1006394 JGI24033J26618_10063942 165
49 3300005327 Ga0070658_10011684 Ga0070658_100116845 165
50 3300005327 Ga0070658_10149638 Ga0070658_101496382 165
51 3300005327 Ga0070658_10651123 Ga0070658_106511232 165
52 3300005329 Ga0070683_100008509 Ga0070683_1000085095 165
53 3300005329 Ga0070683_100154830 Ga0070683_1001548302 165
54 3300005329 Ga0070683_100398280 Ga0070683_1003982802 165
55 3300005329 Ga0070683_100583012 Ga0070683_1005830122 165
56 3300005329 Ga0070683_101026594 Ga0070683_1010265942 165
57 3300005331 Ga0070670_100080629 Ga0070670_1000806295 165
58 3300005336 Ga0070680_100606434 Ga0070680_1006064342 165
59 3300005338 Ga0068868_100032672 Ga0068868_1000326725 165
60 3300005339 Ga0070660_100064788 Ga0070660_1000647882 165
61 3300005339 Ga0070660_100348185 Ga0070660_1003481852 165
62 3300005340 Ga0070689_100730982 Ga0070689_1007309822 165
63 3300005341 Ga0070691_10061267 Ga0070691_100612672 165
64 3300005345 Ga0070692_10063815 Ga0070692_100638154 165
65 3300005345 Ga0070692_10514669 Ga0070692_105146692 165
66 3300005347 Ga0070668_100188987 Ga0070668_1001889872 165
67 3300005354 Ga0070675_100117953 Ga0070675_1001179532 165
68 3300005356 Ga0070674_100022693 Ga0070674_1000226935 165
69 3300005364 Ga0070673_100214362 Ga0070673_1002143623 165
70 3300005366 Ga0070659_100075710 Ga0070659_1000757103 165
71 3300005366 Ga0070659_100151540 Ga0070659_1001515401 165
72 3300005367 Ga0070667_100732292 Ga0070667_1007322922 165
73 3300005435 Ga0070714_100002773 Ga0070714_1000027734 165
74 3300005438 Ga0070701_10001989 Ga0070701_100019895 165
75 3300005456 Ga0070678_100726044 Ga0070678_1007260442 165
76 3300005458 Ga0070681_10480274 Ga0070681_104802742 165
77 3300005459 Ga0068867_100004889 Ga0068867_10000488911 165
78 3300005466 Ga0070685_10107367 Ga0070685_101073672 165
79 3300005530 Ga0070679_100572362 Ga0070679_1005723621 165
80 3300005535 Ga0070684_100003875 Ga0070684_1000038757 165
81 3300005535 Ga0070684_100014929 Ga0070684_1000149292 165
82 3300005535 Ga0070684_100034921 Ga0070684_1000349213 165
83 3300005535 Ga0070684_100422136 Ga0070684_1004221361 165
84 3300005543 Ga0070672_100001684 Ga0070672_1000016845 165
85 3300005563 Ga0068855_100304010 Ga0068855_1003040102 165
86 3300005577 Ga0068857_100217727 Ga0068857_1002177272 165
87 3300005577 Ga0068857_100245238 Ga0068857_1002452382 165
88 3300005615 Ga0070702_100006418 Ga0070702_1000064184 165
89 3300005616 Ga0068852_100008268 Ga0068852_1000082684 165
90 3300005618 Ga0068864_100209414 Ga0068864_1002094142 165
91 3300005718 Ga0068866_10086570 Ga0068866_100865704 165
92 3300005719 Ga0068861_100007730 Ga0068861_1000077305 165
93 3300005840 Ga0068870_10090752 Ga0068870_100907522 165
94 3300005844 Ga0068862_100232922 Ga0068862_1002329222 165
95 3300006038 Ga0075365_10011900 Ga0075365_100119002 165
96 3300006048 Ga0075363_100014330 Ga0075363_1000143302 165
97 3300006844 Ga0075428_100760588 Ga0075428_1007605881 165
98 3300006881 Ga0068865_100098388 Ga0068865_1000983882 165
99 3300009094 Ga0111539_10493644 Ga0111539_104936441 165
100 3300009098 Ga0105245_10016311 Ga0105245_100163115 165
101 3300009148 Ga0105243_10048775 Ga0105243_100487752 165
102 3300009176 Ga0105242_10165364 Ga0105242_101653641 165
103 3300009177 Ga0105248_10035320 Ga0105248_100353205 165
104 3300009553 Ga0105249_10016635 Ga0105249_100166358 165
105 3300010375 Ga0105239_10192734 Ga0105239_101927341 165
106 3300011119 Ga0105246_10483859 Ga0105246_104838591 165
107 3300013105 Ga0157369_11378436 Ga0157369_113784361 165
108 3300013296 Ga0157374_10648632 Ga0157374_106486321 165
109 3300013307 Ga0157372_10104815 Ga0157372_101048152 165
110 3300013307 Ga0157372_10121670 Ga0157372_101216703 165
111 3300013307 Ga0157372_10585986 Ga0157372_105859862 165
112 3300013307 Ga0157372_10792044 Ga0157372_107920442 165
113 3300013307 Ga0157372_11960900 Ga0157372_119609001 165
114 3300013308 Ga0157375_10990526 Ga0157375_109905261 165
115 3300014325 Ga0163163_10092633 Ga0163163_100926334 165
116 3300014326 Ga0157380_10012627 Ga0157380_100126274 165
117 3300014745 Ga0157377_10004523 Ga0157377_100045232 165
118 3300014968 Ga0157379_10313180 Ga0157379_103131802 165
119 3300017792 Ga0163161_10183728 Ga0163161_101837282 165
120 3300020081 Ga0206354_11543417 Ga0206354_115434172 165
121 3300020082 Ga0206353_10301200 Ga0206353_103012002 165
122 3300020082 Ga0206353_11503956 Ga0206353_115039562 165
123 3300020082 Ga0206353_11703101 Ga0206353_117031012 165
124 3300025899 Ga0207642_10085198 Ga0207642_100851982 165
125 3300025901 Ga0207688_10027151 Ga0207688_100271511 165
126 3300025904 Ga0207647_10086728 Ga0207647_100867282 165
127 3300025908 Ga0207643_10000932 Ga0207643_1000093214 165
128 3300025909 Ga0207705_10124562 Ga0207705_101245622 165
129 3300025917 Ga0207660_10578034 Ga0207660_105780342 165
130 3300025919 Ga0207657_10078425 Ga0207657_100784253 165
131 3300025921 Ga0207652_10138693 Ga0207652_101386932 165
132 3300025925 Ga0207650_10232900 Ga0207650_102329001 165
133 3300025927 Ga0207687_10163817 Ga0207687_101638171 165
134 3300025931 Ga0207644_10301871 Ga0207644_103018712 165
135 3300025932 Ga0207690_10092404 Ga0207690_100924042 165
136 3300025932 Ga0207690_10207915 Ga0207690_102079152 165
137 3300025935 Ga0207709_10031596 Ga0207709_100315962 165
138 3300025938 Ga0207704_10397588 Ga0207704_103975881 165
139 3300025940 Ga0207691_10010057 Ga0207691_100100574 165
140 3300025941 Ga0207711_10118783 Ga0207711_101187832 165
141 3300025942 Ga0207689_10291085 Ga0207689_102910852 165
142 3300025944 Ga0207661_10067342 Ga0207661_100673422 165
143 3300025944 Ga0207661_10124720 Ga0207661_101247202 165
144 3300025944 Ga0207661_10131748 Ga0207661_101317482 165
145 3300025944 Ga0207661_10281472 Ga0207661_102814722 165
146 3300025944 Ga0207661_10392238 Ga0207661_103922382 165
147 3300025949 Ga0207667_10324200 Ga0207667_103242003 165
148 3300025961 Ga0207712_10045502 Ga0207712_100455022 165
149 3300025972 Ga0207668_10215633 Ga0207668_102156332 165
150 3300026023 Ga0207677_10075677 Ga0207677_100756775 165
151 3300026075 Ga0207708_10000227 Ga0207708_100002279 165
152 3300026088 Ga0207641_11159055 Ga0207641_111590551 165
153 3300026089 Ga0207648_10000576 Ga0207648_1000057614 165
154 3300026095 Ga0207676_10448006 Ga0207676_104480062 165
155 3300026116 Ga0207674_10264027 Ga0207674_102640272 165
156 3300026118 Ga0207675_100004066 Ga0207675_1000040664 165
157 3300026121 Ga0207683_10889874 Ga0207683_108898742 165
158 3300026142 Ga0207698_10157992 Ga0207698_101579922 165
159 3300027907 Ga0207428_10067093 Ga0207428_100670934 165
160 3300028380 Ga0268265_10100805 Ga0268265_101008052 165
161 3300031995 Ga0307409_100905058 Ga0307409_1009050582 165
162 3300037312 Ga0395899_0018143 Ga0395899_0018143_3806_4303 165
163 3300038443 Ga0395901_0386577 Ga0395901_0386577_140_637 165
164 3300038443 Ga0395901_1153586 Ga0395901_1153586_27_545 165
165 3300041463 Ga0451804_0356831 Ga0451804_0356831_34_531 165
166 3300041512 Ga0451853_3725642 Ga0451853_3725642_140_637 165
167 3300044658 Ga0466972_0309380 Ga0466972_0309380_109_606 165
168 3300044683 Ga0466965_0125955 Ga0466965_0125955_442_939 165
169 3300044694 Ga0466963_0021493 Ga0466963_0021493_887_1396 165
170 3300044842 Ga0466957_0063258 Ga0466957_0063258_141_638 165
171 3300044901 Ga0466960_0018985 Ga0466960_0018985_587_1084 165
172 3300044901 Ga0466960_0133359 Ga0466960_0133359_803_1300 165
173 3300045976 Ga0466967_0021160 Ga0466967_0021160_4129_4626 165
174 3300045976 Ga0466967_0022773 Ga0466967_0022773_4509_5006 165
175 3300045976 Ga0466967_0921847 Ga0466967_0921847_40_543 165
176 3300047445 Ga0495677_0304451 Ga0495677_0304451_113_613 165
177 3300048905 Ga0496102_0482641 Ga0496102_0482641_210_707 165
178 3300048911 Ga0496108_0826111 Ga0496108_0826111_115_612 165
179 3300048912 Ga0496109_0032620 Ga0496109_0032620_3990_4487 165
180 3300048912 Ga0496109_0541099 Ga0496109_0541099_259_756 165
181 3300048913 Ga0496110_0079478 Ga0496110_0079478_1199_1696 165
182 3300048913 Ga0496110_0127964 Ga0496110_0127964_1177_1674 165
183 3300048913 Ga0496110_0387081 Ga0496110_0387081_315_812 165
184 3300048914 Ga0496111_0528138 Ga0496111_0528138_216_713 165
185 3300048917 Ga0496114_0058307 Ga0496114_0058307_1113_1610 165
186 3300048917 Ga0496114_0125909 Ga0496114_0125909_1032_1529 165
187 3300048917 Ga0496114_1400312 Ga0496114_1400312_59_556 165
188 3300049568 Ga0501031_0005383 Ga0501031_0005383_3388_3897 165
189 3300049568 Ga0501031_0055019 Ga0501031_0055019_1275_1772 165
190 3300049570 Ga0501033_0036157 Ga0501033_0036157_3051_3548 165
191 3300049572 Ga0501036_0030483 Ga0501036_0030483_2753_3262 165
192 3300049574 Ga0501038_0175612 Ga0501038_0175612_105_614 165
193 3300049574 Ga0501038_0480359 Ga0501038_0480359_261_758 165
194 3300049574 Ga0501038_0807775 Ga0501038_0807775_59_568 165
195 3300049575 Ga0501039_0013136 Ga0501039_0013136_2722_3231 165
196 3300049575 Ga0501039_0050826 Ga0501039_0050826_497_994 165
197 3300049576 Ga0501040_0006621 Ga0501040_0006621_4448_4957 165
198 3300049576 Ga0501040_0007068 Ga0501040_0007068_1576_2073 165
199 3300049577 Ga0501041_0009045 Ga0501041_0009045_272_769 165
200 3300049577 Ga0501041_0020404 Ga0501041_0020404_316_825 165
201 3300049577 Ga0501041_0223754 Ga0501041_0223754_257_754 165
202 3300049578 Ga0501042_0005774 Ga0501042_0005774_3391_3900 165
203 3300049579 Ga0501043_0106067 Ga0501043_0106067_67_564 165
204 3300049579 Ga0501043_0797077 Ga0501043_0797077_15_524 165
205 3300049580 Ga0501046_0038031 Ga0501046_0038031_1031_1540 165
206 3300049580 Ga0501046_0120791 Ga0501046_0120791_1374_1871 165
207 3300049582 Ga0501048_0058578 Ga0501048_0058578_93_602 165
208 3300049582 Ga0501048_1026966 Ga0501048_1026966_58_567 165
209 3300049583 Ga0501067_0071989 Ga0501067_0071989_50_550 165
210 3300049584 Ga0501068_0008819 Ga0501068_0008819_3360_3869 165
211 3300049584 Ga0501068_0032129 Ga0501068_0032129_469_966 165
212 3300049584 Ga0501068_0343340 Ga0501068_0343340_358_867 165
213 3300049584 Ga0501068_0461305 Ga0501068_0461305_31_537 165
214 3300049586 Ga0501070_0483177 Ga0501070_0483177_301_798 165
215 3300049586 Ga0501070_0484616 Ga0501070_0484616_304_801 165
216 3300049587 Ga0501071_0002621 Ga0501071_0002621_7957_8466 165
217 3300049587 Ga0501071_0056945 Ga0501071_0056945_579_1076 165
218 3300049587 Ga0501071_0346803 Ga0501071_0346803_560_1057 165
219 3300049587 Ga0501071_0401575 Ga0501071_0401575_35_592 165
220 3300049588 Ga0501072_0002981 Ga0501072_0002981_11239_11748 165
221 3300049588 Ga0501072_0004851 Ga0501072_0004851_2055_2552 165
222 3300049588 Ga0501072_0037594 Ga0501072_0037594_3028_3585 165
223 3300049589 Ga0501073_0106768 Ga0501073_0106768_22_519 165
224 3300049590 Ga0501074_0015509 Ga0501074_0015509_4983_5492 165
225 3300049591 Ga0501075_0000413 Ga0501075_0000413_21922_22431 165
226 3300049591 Ga0501075_0091804 Ga0501075_0091804_1742_2239 165
227 3300049592 Ga0501076_0010783 Ga0501076_0010783_3051_3560 165
228 3300049592 Ga0501076_0047561 Ga0501076_0047561_22_519 165
229 3300049592 Ga0501076_0272615 Ga0501076_0272615_212_709 165
230 3300049592 Ga0501076_0631565 Ga0501076_0631565_238_795 165
231 3300049592 Ga0501076_0851214 Ga0501076_0851214_170_703 165
232 3300049593 Ga0501077_0003862 Ga0501077_0003862_346_855 165
233 3300049593 Ga0501077_0039826 Ga0501077_0039826_362_859 165
234 3300049593 Ga0501077_0784354 Ga0501077_0784354_29_526 165
235 3300049741 Ga0501079_0012791 Ga0501079_0012791_4530_5039 165
236 3300049741 Ga0501079_0039234 Ga0501079_0039234_561_1058 165
237 3300049742 Ga0501080_0019881 Ga0501080_0019881_3357_3866 165
238 3300049742 Ga0501080_0401333 Ga0501080_0401333_316_813 165
239 3300049743 Ga0501081_0001867 Ga0501081_0001867_5393_5902 165
240 3300049744 Ga0501083_0079794 Ga0501083_0079794_281_790 165
241 3300049744 Ga0501083_0387921 Ga0501083_0387921_30_527 165
242 3300049822 Ga0501035_0045483 Ga0501035_0045483_1261_1770 165
243 3300049822 Ga0501035_0591776 Ga0501035_0591776_88_585 165
244 3300049823 Ga0501044_0078755 Ga0501044_0078755_1585_2082 165
245 3300049824 Ga0501045_0011860 Ga0501045_0011860_2929_3438 165
246 3300050490 nmdc:mga03n38_67488_c1 nmdc:mga03n38_67488_c1_1032_1538 165
247 3300050492 nmdc:mga0yw44_14854_c1 nmdc:mga0yw44_14854_c1_2033_2530 165
248 3300050492 nmdc:mga0yw44_362859_c1 nmdc:mga0yw44_362859_c1_455_952 165
249 3300050511 nmdc:mga08y16_37267_c1 nmdc:mga08y16_37267_c1_3111_3608 165
250 3300054114 Ga0501084_0000803 Ga0501084_0000803_4425_4934 165
251 3300054114 Ga0501084_0093229 Ga0501084_0093229_2010_2507 165
252 3300060353 Ga0501082_0029736 Ga0501082_0029736_2564_3061 165
253 3300060353 Ga0501082_0046035 Ga0501082_0046035_185_694 165
254 3300060353 Ga0501082_0485323 Ga0501082_0485323_378_911 165
255 3300061719 Ga0466962_0576425 Ga0466962_0576425_49_546 165
256 3300061734 Ga0530510_0039573 Ga0530510_0039573_2554_3063 165
257 3300061734 Ga0530510_0065955 Ga0530510_0065955_527_1024 165
258 3300061734 Ga0530510_0198302 Ga0530510_0198302_804_1301 165
259 3300061734 Ga0530510_0800515 Ga0530510_0800515_203_703 165
260 iso_pu_bacteria 2739367898 2740169051 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

52

181

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.8703 2 165
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.8673 2 165
6y04-assembly1.cif.gz_B crystal structure of beta-carbonic anhydrase isoform i (tvaca1) from the trichomonas vaginalis protozoan. 0.8543 2 163
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.8534 1 163
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.8511 2 165
ID Description Score Start End Superfamily
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8593 6 163 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8534 1 163 3.40.1050.10
1g5cD00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8504 31 163 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8395 1 163 3.40.1050.10
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8337 2 165 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A0S9QBD2-F1-model_v4 Carbonic anhydrase 0.9937 10 165 GO:0004089
GO:0008270
AF-A0A7V9F6I8-F1-model_v4 Carbonic anhydrase 0.9882 1 165 GO:0004089
GO:0008270
AF-A0A838KN49-F1-model_v4 Carbonic anhydrase 0.9866 1 165 GO:0004089
GO:0008270
AF-A0A7V9F6I8-F1-model_v4 Carbonic anhydrase 0.9823 1 165 GO:0004089
GO:0008270
AF-A0A0S9QBD2-F1-model_v4 Carbonic anhydrase 0.9812 10 165 GO:0004089
GO:0008270

Feature Viewer

pLDDT pTM Quality
95.89 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map