F369909

General Info

Members Datasets Scaffolds Average Seq Length
260 154 256 142

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0299940|Ga0501044_0299940_662_1096
Length 144
Sequence MAKKIEGYIKLQVKAGQANPSPPIGPALGQRGLNIMEFCKAFNAATQKMEPGMPIPVVITAFSDRSFTFKMKTPPATYFLKKAANITSGSKTPGKPGSIAGSVTLKQCRDIAETKMEDLNATDLDQATKIIAGSARSMGLQVVE

Samples

Sample ID Description Type Environment
1 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
2 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
3 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
4 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
44 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
82 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
83 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
103 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.31
Metatranscriptomes 16.15
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.92
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 5.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_10001805 3300004798 Bacteria 3863
2 Ga0058860_11661736 3300004801 Bacteria 1225
3 Ga0070687_100036828 3300005343 Bacteria 2441
4 Ga0070714_100047039 3300005435 Bacteria 3663
5 Ga0070700_100526638 3300005441 Bacteria 914
6 Ga0070694_100002272 3300005444 Bacteria 11361
7 Ga0070685_10272198 3300005466 Bacteria 1130
8 Ga0070707_100256978 3300005468 Bacteria 1700
9 Ga0070707_101859211 3300005468 Bacteria 569
10 Ga0070698_100026208 3300005471 Bacteria 6069
11 Ga0070699_100063102 3300005518 Bacteria 3212
12 Ga0070693_100675042 3300005547 Bacteria 754
13 Ga0070704_100008067 3300005549 Bacteria 6290
14 Ga0068857_100326431 3300005577 Bacteria 1418
15 Ga0068861_100171103 3300005719 Bacteria 1800
16 Ga0068851_10980586 3300005834 Bacteria 532
17 Ga0075432_10006997 3300006058 Bacteria 3843
18 Ga0070716_100330861 3300006173 Bacteria 1071
19 Ga0075428_100438216 3300006844 Bacteria 1400
20 Ga0075430_100005862 3300006846 Bacteria 10370
21 Ga0075431_100465523 3300006847 Bacteria 1258
22 Ga0075433_10166084 3300006852 Bacteria 1964
23 Ga0075433_10767898 3300006852 Bacteria 843
24 Ga0075434_100007190 3300006871 Bacteria 10295
25 Ga0105244_10155003 3300009036 Bacteria 1096
26 Ga0111539_10532946 3300009094 Bacteria 1368
27 Ga0105245_12723972 3300009098 Bacteria 547
28 Ga0105247_10784881 3300009101 Unclassified 725
29 Ga0105243_10109132 3300009148 Bacteria 2311
30 Ga0105238_10000058 3300009551 Bacteria 130734
31 Ga0105238_10000130 3300009551 Bacteria 82894
32 Ga0105249_10017354 3300009553 Bacteria 6391
33 Ga0105246_12352574 3300011119 Bacteria 522
34 Ga0157369_12098066 3300013105 Bacteria 573
35 Ga0157374_12223908 3300013296 Bacteria 575
36 Ga0157375_11537270 3300013308 Bacteria 786
37 Ga0157375_12727082 3300013308 Bacteria 591
38 Ga0182008_10759861 3300014497 Bacteria 559
39 Ga0157377_10020106 3300014745 Bacteria 3493
40 Ga0157376_10815752 3300014969 Bacteria 946
41 Ga0197907_10238229 3300020069 Bacteria 2432
42 Ga0197907_11146780 3300020069 Bacteria 600
43 Ga0206356_11638095 3300020070 Bacteria 933
44 Ga0206355_1254761 3300020076 Bacteria 699
45 Ga0206351_10545646 3300020077 Bacteria 5226
46 Ga0206351_10818235 3300020077 Bacteria 855
47 Ga0206352_10172446 3300020078 Bacteria 820
48 Ga0206352_10482108 3300020078 Bacteria 932
49 Ga0206350_11192080 3300020080 Bacteria 591
50 Ga0206353_10151330 3300020082 Bacteria 616
51 Ga0213872_10014466 3300021361 Bacteria 3681
52 Ga0224712_10000417 3300022467 Bacteria 8406
53 Ga0207647_10021595 3300025904 Bacteria 4296
54 Ga0207662_10004293 3300025918 Bacteria 7478
55 Ga0207646_10894982 3300025922 Bacteria 788
56 Ga0207694_10000007 3300025924 Bacteria 595422
57 Ga0207694_10000799 3300025924 Bacteria 28255
58 Ga0207659_10364042 3300025926 Bacteria 1202
59 Ga0207664_10081713 3300025929 Bacteria 2630
60 Ga0207644_11167283 3300025931 Bacteria 647
61 Ga0207709_10015359 3300025935 Bacteria 4245
62 Ga0207665_10496078 3300025939 Bacteria 943
63 Ga0207691_10382655 3300025940 Bacteria 1201
64 Ga0207712_10118851 3300025961 Bacteria 1996
65 Ga0207674_10123527 3300026116 Bacteria 2555
66 Ga0207675_100005308 3300026118 Bacteria 12384
67 Ga0207428_10000755 3300027907 Bacteria 36919
68 Ga0268265_12229626 3300028380 Bacteria 555
69 Ga0268264_11490709 3300028381 Bacteria 687
70 Ga0265338_10093522 3300028800 Bacteria 2477
71 Ga0265338_10929763 3300028800 Unclassified 591
72 Ga0265327_10021045 3300031251 Bacteria 3950
73 Ga0265316_10070150 3300031344 Bacteria 2703
74 Ga0307408_100083093 3300031548 Bacteria 2399
75 Ga0316579_10019813 3300031691 Bacteria 2977
76 Ga0316579_10312833 3300031691 Unclassified 759
77 Ga0316579_10375468 3300031691 Bacteria 687
78 Ga0316576_10010423 3300031727 Bacteria 6037
79 Ga0316576_10013514 3300031727 Bacteria 5430
80 Ga0316576_10105538 3300031727 Bacteria 2109
81 Ga0316576_10126009 3300031727 Bacteria 1924
82 Ga0316576_10666094 3300031727 Bacteria 756
83 Ga0316578_10027559 3300031728 Bacteria 3212
84 Ga0316578_10075409 3300031728 Bacteria 2001
85 Ga0316578_10097965 3300031728 Bacteria 1757
86 Ga0316578_10311064 3300031728 Bacteria 941
87 Ga0307405_10610976 3300031731 Bacteria 891
88 Ga0316577_10005372 3300031733 Bacteria 6715
89 Ga0316577_10057962 3300031733 Bacteria 2162
90 Ga0316577_10166791 3300031733 Bacteria 1242
91 Ga0316577_10361056 3300031733 Bacteria 825
92 Ga0316577_10514469 3300031733 Unclassified 680
93 Ga0307410_10075145 3300031852 Bacteria 2355
94 Ga0307407_10086767 3300031903 Bacteria 1907
95 Ga0307409_100329760 3300031995 Bacteria 1432
96 Ga0307414_10978982 3300032004 Bacteria 778
97 Ga0307411_10096161 3300032005 Bacteria 2081
98 Ga0307415_100122244 3300032126 Bacteria 1954
99 Ga0307415_100281026 3300032126 Bacteria 1369
100 Ga0307415_100412563 3300032126 Bacteria 1156
101 Ga0316585_10294601 3300032137 Bacteria 539
102 Ga0316580_10020660 3300032139 Bacteria 2029
103 Ga0316580_10250550 3300032139 Bacteria 547
104 Ga0316593_10001156 3300032168 Bacteria 5608
105 Ga0316593_10002067 3300032168 Bacteria 4650
106 Ga0316593_10032856 3300032168 Bacteria 1697
107 Ga0316593_10033034 3300032168 Bacteria 1692
108 Ga0316593_10222034 3300032168 Unclassified 702
109 Ga0316592_1013422 3300033524 Bacteria 1688
110 Ga0316592_1015135 3300033524 Bacteria 1604
111 Ga0316588_1020800 3300033528 Bacteria 1489
112 Ga0316588_1036581 3300033528 Bacteria 1166
113 Ga0316588_1137713 3300033528 Bacteria 623
114 Ga0316587_1082200 3300033529 Bacteria 610
115 Ga0316596_1002971 3300033541 Bacteria 3681
116 Ga0316596_1014057 3300033541 Bacteria 1981
117 Ga0316596_1016242 3300033541 Bacteria 1863
118 Ga0316596_1073252 3300033541 Bacteria 918
119 Ga0316596_1092859 3300033541 Bacteria 814
120 Ga0316574_0011777 3300035398 Bacteria 4981
121 Ga0316574_0041874 3300035398 Bacteria 2824
122 Ga0316574_0176613 3300035398 Bacteria 1374
123 Ga0316574_0209957 3300035398 Bacteria 1249
124 Ga0316574_0589502 3300035398 Bacteria 688
125 Ga0373937_1084289 3300036401 Bacteria 750
126 Ga0316582_0014111 3300036647 Bacteria 4523
127 Ga0316582_0031327 3300036647 Bacteria 3249
128 Ga0316582_0036821 3300036647 Bacteria 3030
129 Ga0316582_0083966 3300036647 Bacteria 2085
130 Ga0316582_0090292 3300036647 Bacteria 2016
131 Ga0316582_0117988 3300036647 Bacteria 1773
132 Ga0316582_0189256 3300036647 Unclassified 1402
133 Ga0316582_0569560 3300036647 Bacteria 780
134 Ga0316582_0694201 3300036647 Bacteria 699
135 Ga0316582_0764979 3300036647 Bacteria 662
136 Ga0316582_0980138 3300036647 Unclassified 577
137 Ga0316582_0983826 3300036647 Bacteria 576
138 Ga0316584_0017588 3300036712 Bacteria 5145
139 Ga0316584_0033377 3300036712 Bacteria 3812
140 Ga0316584_0105484 3300036712 Bacteria 2109
141 Ga0316584_0313323 3300036712 Bacteria 1134
142 Ga0316584_0560931 3300036712 Bacteria 796
143 Ga0316584_0922144 3300036712 Bacteria 587
144 Ga0395900_0148375 3300037418 Bacteria 2397
145 Ga0395900_1355578 3300037418 Bacteria 625
146 Ga0395898_0522851 3300037466 Bacteria 1128
147 Ga0316581_0039195 3300037588 Bacteria 1442
148 Ga0316581_0054855 3300037588 Bacteria 1222
149 Ga0436364_0040531 3300037853 Bacteria 974
150 Ga0436364_0234498 3300037853 Bacteria 658
151 Ga0436364_0552661 3300037853 Bacteria 595
152 Ga0436364_0559184 3300037853 Bacteria 655
153 Ga0395901_0282530 3300038443 Bacteria 1724
154 Ga0436365_0053534 3300039437 Bacteria 1132
155 Ga0436365_1180952 3300039437 Bacteria 649
156 Ga0436360_0253966 3300039438 Bacteria 630
157 Ga0436360_0629914 3300039438 Bacteria 599
158 Ga0436360_0666240 3300039438 Bacteria 564
159 Ga0436360_0832493 3300039438 Bacteria 545
160 Ga0436360_1130923 3300039438 Bacteria 524
161 Ga0436360_1227641 3300039438 Bacteria 644
162 Ga0436361_0150908 3300039447 Bacteria 1255
163 Ga0436361_0195222 3300039447 Bacteria 9839
164 Ga0436361_0462799 3300039447 Bacteria 725
165 Ga0436361_0500836 3300039447 Bacteria 1497
166 Ga0436363_0227492 3300039450 Bacteria 571
167 Ga0436363_0739975 3300039450 Bacteria 749
168 Ga0436363_0860487 3300039450 Bacteria 536
169 Ga0436363_0912971 3300039450 Bacteria 598
170 Ga0436363_1658260 3300039450 Bacteria 580
171 Ga0436362_0523085 3300039453 Bacteria 9299
172 Ga0436362_0823898 3300039453 Bacteria 571
173 Ga0451843_0894202 3300041509 Bacteria 904
174 Ga0439455_0080016 3300042012 Bacteria 887
175 Ga0439434_0150278 3300042435 Bacteria 771
176 Ga0451577_0000006 3300042876 Bacteria 709265
177 Ga0451577_0065473 3300042876 Bacteria 3241
178 Ga0451577_0099821 3300042876 Bacteria 2593
179 Ga0451577_0475696 3300042876 Bacteria 1134
180 Ga0451577_1197039 3300042876 Bacteria 678
181 Ga0466972_0108186 3300044658 Bacteria 1314
182 Ga0453683_0000086 3300044673 Bacteria 139689
183 Ga0453683_0000088 3300044673 Bacteria 138620
184 Ga0453683_0055576 3300044673 Bacteria 2478
185 Ga0453683_0143391 3300044673 Bacteria 1508
186 Ga0453683_0325849 3300044673 Bacteria 985
187 Ga0453683_0787130 3300044673 Bacteria 626
188 Ga0453684_0000037 3300044712 Bacteria 709327
189 Ga0453684_0003980 3300044712 Bacteria 32269
190 Ga0453684_0006653 3300044712 Bacteria 21828
191 Ga0453684_0141118 3300044712 Bacteria 2877
192 Ga0453684_0142608 3300044712 Bacteria 2858
193 Ga0453684_0508716 3300044712 Bacteria 1332
194 Ga0453684_0544218 3300044712 Unclassified 1280
195 Ga0453684_0798964 3300044712 Bacteria 1017
196 Ga0453684_0933354 3300044712 Bacteria 927
197 Ga0466957_0575713 3300044842 Bacteria 787
198 Ga0451576_0064678 3300045051 Bacteria 3809
199 Ga0451576_0132882 3300045051 Bacteria 2594
200 Ga0451576_1354062 3300045051 Bacteria 741
201 Ga0451576_1357767 3300045051 Bacteria 740
202 Ga0495630_0081609 3300046517 Bacteria 2440
203 Ga0495613_0138670 3300046689 Bacteria 1739
204 Ga0495636_0057934 3300047318 Bacteria 1633
205 Ga0496102_0086130 3300048905 Bacteria 2901
206 Ga0496103_1012378 3300048906 Bacteria 517
207 Ga0496106_0534982 3300048909 Bacteria 941
208 Ga0496114_0354619 3300048917 Bacteria 1298
209 Ga0496114_0835167 3300048917 Bacteria 801
210 Ga0501316_043755 3300049532 Bacteria 630
211 Ga0501323_059302 3300049539 Bacteria 595
212 Ga0501031_0348242 3300049568 Bacteria 959
213 Ga0501034_0488943 3300049571 Bacteria 1145
214 Ga0501034_1128247 3300049571 Bacteria 664
215 Ga0501036_0049905 3300049572 Bacteria 3545
216 Ga0501037_0715070 3300049573 Bacteria 666
217 Ga0501038_0157353 3300049574 Bacteria 1849
218 Ga0501043_0113541 3300049579 Bacteria 2127
219 Ga0501046_0001481 3300049580 Bacteria 22486
220 Ga0501046_0144264 3300049580 Bacteria 1799
221 Ga0501047_1005151 3300049581 Bacteria 647
222 Ga0501070_0826388 3300049586 Bacteria 726
223 Ga0501071_1249664 3300049587 Bacteria 574
224 Ga0501072_1070041 3300049588 Bacteria 628
225 Ga0501075_0138668 3300049591 Bacteria 1853
226 Ga0501076_0360815 3300049592 Bacteria 1194
227 Ga0501249_079170 3300049679 Bacteria 772
228 Ga0501035_0057170 3300049822 Bacteria 3478
229 Ga0501035_0286567 3300049822 Bacteria 1391
230 Ga0501035_0446625 3300049822 Bacteria 1070
231 Ga0501044_0073452 3300049823 Bacteria 3476
232 Ga0501044_0128463 3300049823 Bacteria 2530
233 Ga0501044_0299940 3300049823 Bacteria 1536
234 Ga0501044_0774943 3300049823 Bacteria 840
235 nmdc:mga05p37_11186_c1 3300050507 Bacteria 10667
236 nmdc:mga0qj67_7799_c1 3300050509 Bacteria 7913
237 nmdc:mga06r32_30997_c1 3300050510 Bacteria 5020
238 nmdc:mga08y16_45863_c1 3300050511 Bacteria 4579
239 nmdc:mga0n895_204352_c1 3300050512 Bacteria 2006
240 nmdc:mga0n895_6845_c1 3300050512 Bacteria 9736
241 nmdc:mga0a205_17465_c1 3300050515 Bacteria 6728
242 Ga0501084_0030431 3300054114 Bacteria 4514
243 Ga0501084_1871670 3300054114 Bacteria 501
244 Ga0587066_118330 3300059490 Bacteria 623
245 Ga0587070_138044 3300059491 Bacteria 600
246 Ga0587073_0164531 3300059492 Bacteria 639
247 Ga0587080_031000 3300059503 Bacteria 931
248 Ga0587083_0210241 3300059505 Bacteria 560
249 Ga0587086_096286 3300059507 Bacteria 540
250 Ga0587094_063008 3300059513 Bacteria 653
251 Ga0587075_123056 3300059644 Bacteria 539
252 Ga0587079_077971 3300059647 Bacteria 752
253 Ga0587079_104966 3300059647 Bacteria 679
254 Ga0587119_063119 3300059658 Bacteria 575
255 Ga0501082_0029571 3300060353 Bacteria 4720
256 Ga0530510_1146819 3300061734 Bacteria 596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033541 Ga0316596_1002971 Ga0316596_10029711 133
2 3300044673 Ga0453683_0787130 Ga0453683_0787130_214_615 133
3 3300047318 Ga0495636_0057934 Ga0495636_0057934_1186_1587 133
4 3300028800 Ga0265338_10093522 Ga0265338_100935225 134
5 3300035398 Ga0316574_0011777 Ga0316574_0011777_1781_2191 136
6 3300036647 Ga0316582_0117988 Ga0316582_0117988_100_510 136
7 3300036712 Ga0316584_0033377 Ga0316584_0033377_871_1281 136
8 iso_pu_bacteria 2687453257 2688066214 137
9 iso_pu_bacteria 2889415604 2889421727 137
10 iso_pu_bacteria 2920107658 2920111246 137
11 iso_pu_bacteria 2728369276 2729906692 139
12 3300005468 Ga0070707_101859211 Ga0070707_1018592111 140
13 3300006844 Ga0075428_100438216 Ga0075428_1004382162 140
14 3300009551 Ga0105238_10000058 Ga0105238_10000058106 140
15 3300025924 Ga0207694_10000799 Ga0207694_1000079916 140
16 3300028800 Ga0265338_10929763 Ga0265338_109297631 140
17 3300031728 Ga0316578_10075409 Ga0316578_100754092 140
18 3300031733 Ga0316577_10514469 Ga0316577_105144691 140
19 3300033528 Ga0316588_1036581 Ga0316588_10365812 140
20 3300033528 Ga0316588_1137713 Ga0316588_11377132 140
21 3300036647 Ga0316582_0980138 Ga0316582_0980138_132_554 140
22 3300039447 Ga0436361_0462799 Ga0436361_0462799_251_673 140
23 3300059507 Ga0587086_096286 Ga0587086_096286_84_512 140
24 3300059513 Ga0587094_063008 Ga0587094_063008_180_608 140
25 3300004798 Ga0058859_10001805 Ga0058859_100018055 141
26 3300004801 Ga0058860_11661736 Ga0058860_116617362 141
27 3300005343 Ga0070687_100036828 Ga0070687_1000368282 141
28 3300005435 Ga0070714_100047039 Ga0070714_1000470391 141
29 3300005441 Ga0070700_100526638 Ga0070700_1005266381 141
30 3300005444 Ga0070694_100002272 Ga0070694_1000022727 141
31 3300005466 Ga0070685_10272198 Ga0070685_102721983 141
32 3300005468 Ga0070707_100256978 Ga0070707_1002569782 141
33 3300005471 Ga0070698_100026208 Ga0070698_1000262082 141
34 3300005518 Ga0070699_100063102 Ga0070699_1000631022 141
35 3300005547 Ga0070693_100675042 Ga0070693_1006750421 141
36 3300005549 Ga0070704_100008067 Ga0070704_1000080673 141
37 3300005577 Ga0068857_100326431 Ga0068857_1003264312 141
38 3300005719 Ga0068861_100171103 Ga0068861_1001711033 141
39 3300005834 Ga0068851_10980586 Ga0068851_109805861 141
40 3300006058 Ga0075432_10006997 Ga0075432_100069973 141
41 3300006173 Ga0070716_100330861 Ga0070716_1003308612 141
42 3300006846 Ga0075430_100005862 Ga0075430_10000586213 141
43 3300006847 Ga0075431_100465523 Ga0075431_1004655232 141
44 3300006852 Ga0075433_10166084 Ga0075433_101660842 141
45 3300006852 Ga0075433_10767898 Ga0075433_107678981 141
46 3300006871 Ga0075434_100007190 Ga0075434_10000719011 141
47 3300009036 Ga0105244_10155003 Ga0105244_101550031 141
48 3300009094 Ga0111539_10532946 Ga0111539_105329462 141
49 3300009098 Ga0105245_12723972 Ga0105245_127239721 141
50 3300009101 Ga0105247_10784881 Ga0105247_107848811 141
51 3300009148 Ga0105243_10109132 Ga0105243_101091323 141
52 3300009551 Ga0105238_10000130 Ga0105238_100001305 141
53 3300009553 Ga0105249_10017354 Ga0105249_100173547 141
54 3300011119 Ga0105246_12352574 Ga0105246_123525742 141
55 3300013105 Ga0157369_12098066 Ga0157369_120980661 141
56 3300013296 Ga0157374_12223908 Ga0157374_122239081 141
57 3300013308 Ga0157375_11537270 Ga0157375_115372701 141
58 3300013308 Ga0157375_12727082 Ga0157375_127270821 141
59 3300014497 Ga0182008_10759861 Ga0182008_107598611 141
60 3300014745 Ga0157377_10020106 Ga0157377_100201062 141
61 3300014969 Ga0157376_10815752 Ga0157376_108157522 141
62 3300020069 Ga0197907_10238229 Ga0197907_102382294 141
63 3300020069 Ga0197907_11146780 Ga0197907_111467801 141
64 3300020070 Ga0206356_11638095 Ga0206356_116380952 141
65 3300020076 Ga0206355_1254761 Ga0206355_12547611 141
66 3300020077 Ga0206351_10545646 Ga0206351_105456468 141
67 3300020077 Ga0206351_10818235 Ga0206351_108182351 141
68 3300020078 Ga0206352_10172446 Ga0206352_101724461 141
69 3300020078 Ga0206352_10482108 Ga0206352_104821082 141
70 3300020080 Ga0206350_11192080 Ga0206350_111920801 141
71 3300020082 Ga0206353_10151330 Ga0206353_101513301 141
72 3300021361 Ga0213872_10014466 Ga0213872_100144663 141
73 3300022467 Ga0224712_10000417 Ga0224712_1000041711 141
74 3300025904 Ga0207647_10021595 Ga0207647_100215954 141
75 3300025918 Ga0207662_10004293 Ga0207662_100042935 141
76 3300025922 Ga0207646_10894982 Ga0207646_108949822 141
77 3300025924 Ga0207694_10000007 Ga0207694_10000007552 141
78 3300025926 Ga0207659_10364042 Ga0207659_103640422 141
79 3300025929 Ga0207664_10081713 Ga0207664_100817131 141
80 3300025931 Ga0207644_11167283 Ga0207644_111672831 141
81 3300025935 Ga0207709_10015359 Ga0207709_100153593 141
82 3300025939 Ga0207665_10496078 Ga0207665_104960782 141
83 3300025940 Ga0207691_10382655 Ga0207691_103826551 141
84 3300025961 Ga0207712_10118851 Ga0207712_101188513 141
85 3300026116 Ga0207674_10123527 Ga0207674_101235273 141
86 3300026118 Ga0207675_100005308 Ga0207675_1000053087 141
87 3300027907 Ga0207428_10000755 Ga0207428_1000075540 141
88 3300028380 Ga0268265_12229626 Ga0268265_122296261 141
89 3300028381 Ga0268264_11490709 Ga0268264_114907092 141
90 3300031251 Ga0265327_10021045 Ga0265327_100210452 141
91 3300031344 Ga0265316_10070150 Ga0265316_100701502 141
92 3300031548 Ga0307408_100083093 Ga0307408_1000830932 141
93 3300031691 Ga0316579_10019813 Ga0316579_100198133 141
94 3300031691 Ga0316579_10312833 Ga0316579_103128332 141
95 3300031691 Ga0316579_10375468 Ga0316579_103754681 141
96 3300031727 Ga0316576_10010423 Ga0316576_100104232 141
97 3300031727 Ga0316576_10013514 Ga0316576_100135144 141
98 3300031727 Ga0316576_10105538 Ga0316576_101055382 141
99 3300031727 Ga0316576_10126009 Ga0316576_101260094 141
100 3300031727 Ga0316576_10666094 Ga0316576_106660942 141
101 3300031728 Ga0316578_10027559 Ga0316578_100275592 141
102 3300031728 Ga0316578_10097965 Ga0316578_100979652 141
103 3300031728 Ga0316578_10311064 Ga0316578_103110641 141
104 3300031731 Ga0307405_10610976 Ga0307405_106109762 141
105 3300031733 Ga0316577_10005372 Ga0316577_100053725 141
106 3300031733 Ga0316577_10057962 Ga0316577_100579622 141
107 3300031733 Ga0316577_10166791 Ga0316577_101667912 141
108 3300031733 Ga0316577_10361056 Ga0316577_103610561 141
109 3300031852 Ga0307410_10075145 Ga0307410_100751452 141
110 3300031903 Ga0307407_10086767 Ga0307407_100867671 141
111 3300031995 Ga0307409_100329760 Ga0307409_1003297602 141
112 3300032004 Ga0307414_10978982 Ga0307414_109789822 141
113 3300032005 Ga0307411_10096161 Ga0307411_100961611 141
114 3300032126 Ga0307415_100122244 Ga0307415_1001222444 141
115 3300032126 Ga0307415_100281026 Ga0307415_1002810263 141
116 3300032126 Ga0307415_100412563 Ga0307415_1004125632 141
117 3300032137 Ga0316585_10294601 Ga0316585_102946011 141
118 3300032139 Ga0316580_10020660 Ga0316580_100206601 141
119 3300032139 Ga0316580_10250550 Ga0316580_102505502 141
120 3300032168 Ga0316593_10001156 Ga0316593_100011566 141
121 3300032168 Ga0316593_10002067 Ga0316593_100020674 141
122 3300032168 Ga0316593_10032856 Ga0316593_100328564 141
123 3300032168 Ga0316593_10033034 Ga0316593_100330342 141
124 3300032168 Ga0316593_10222034 Ga0316593_102220341 141
125 3300033524 Ga0316592_1013422 Ga0316592_10134222 141
126 3300033524 Ga0316592_1015135 Ga0316592_10151352 141
127 3300033528 Ga0316588_1020800 Ga0316588_10208002 141
128 3300033529 Ga0316587_1082200 Ga0316587_10822001 141
129 3300033541 Ga0316596_1014057 Ga0316596_10140572 141
130 3300033541 Ga0316596_1016242 Ga0316596_10162424 141
131 3300033541 Ga0316596_1073252 Ga0316596_10732521 141
132 3300033541 Ga0316596_1092859 Ga0316596_10928592 141
133 3300035398 Ga0316574_0041874 Ga0316574_0041874_331_756 141
134 3300035398 Ga0316574_0176613 Ga0316574_0176613_363_791 141
135 3300035398 Ga0316574_0209957 Ga0316574_0209957_70_495 141
136 3300035398 Ga0316574_0589502 Ga0316574_0589502_29_457 141
137 3300036401 Ga0373937_1084289 Ga0373937_1084289_67_492 141
138 3300036647 Ga0316582_0014111 Ga0316582_0014111_25_453 141
139 3300036647 Ga0316582_0031327 Ga0316582_0031327_1136_1564 141
140 3300036647 Ga0316582_0036821 Ga0316582_0036821_1365_1793 141
141 3300036647 Ga0316582_0083966 Ga0316582_0083966_1390_1827 141
142 3300036647 Ga0316582_0090292 Ga0316582_0090292_1096_1521 141
143 3300036647 Ga0316582_0189256 Ga0316582_0189256_499_924 141
144 3300036647 Ga0316582_0569560 Ga0316582_0569560_56_481 141
145 3300036647 Ga0316582_0694201 Ga0316582_0694201_51_476 141
146 3300036647 Ga0316582_0764979 Ga0316582_0764979_146_574 141
147 3300036647 Ga0316582_0983826 Ga0316582_0983826_104_532 141
148 3300036712 Ga0316584_0017588 Ga0316584_0017588_1447_1875 141
149 3300036712 Ga0316584_0105484 Ga0316584_0105484_219_644 141
150 3300036712 Ga0316584_0313323 Ga0316584_0313323_539_964 141
151 3300036712 Ga0316584_0560931 Ga0316584_0560931_33_479 141
152 3300036712 Ga0316584_0922144 Ga0316584_0922144_12_437 141
153 3300037418 Ga0395900_0148375 Ga0395900_0148375_178_609 141
154 3300037418 Ga0395900_1355578 Ga0395900_1355578_78_503 141
155 3300037466 Ga0395898_0522851 Ga0395898_0522851_85_516 141
156 3300037588 Ga0316581_0039195 Ga0316581_0039195_605_1033 141
157 3300037588 Ga0316581_0054855 Ga0316581_0054855_198_623 141
158 3300037853 Ga0436364_0040531 Ga0436364_0040531_376_801 141
159 3300037853 Ga0436364_0234498 Ga0436364_0234498_160_585 141
160 3300037853 Ga0436364_0552661 Ga0436364_0552661_120_545 141
161 3300037853 Ga0436364_0559184 Ga0436364_0559184_45_470 141
162 3300038443 Ga0395901_0282530 Ga0395901_0282530_242_673 141
163 3300039437 Ga0436365_0053534 Ga0436365_0053534_653_1078 141
164 3300039437 Ga0436365_1180952 Ga0436365_1180952_159_590 141
165 3300039438 Ga0436360_0253966 Ga0436360_0253966_77_502 141
166 3300039438 Ga0436360_0629914 Ga0436360_0629914_51_476 141
167 3300039438 Ga0436360_0666240 Ga0436360_0666240_64_489 141
168 3300039438 Ga0436360_0832493 Ga0436360_0832493_48_473 141
169 3300039438 Ga0436360_1130923 Ga0436360_1130923_61_486 141
170 3300039438 Ga0436360_1227641 Ga0436360_1227641_49_474 141
171 3300039447 Ga0436361_0150908 Ga0436361_0150908_108_533 141
172 3300039447 Ga0436361_0195222 Ga0436361_0195222_2910_3335 141
173 3300039447 Ga0436361_0500836 Ga0436361_0500836_947_1372 141
174 3300039450 Ga0436363_0227492 Ga0436363_0227492_118_543 141
175 3300039450 Ga0436363_0739975 Ga0436363_0739975_287_712 141
176 3300039450 Ga0436363_0860487 Ga0436363_0860487_49_474 141
177 3300039450 Ga0436363_0912971 Ga0436363_0912971_147_572 141
178 3300039450 Ga0436363_1658260 Ga0436363_1658260_56_481 141
179 3300039453 Ga0436362_0523085 Ga0436362_0523085_6993_7418 141
180 3300039453 Ga0436362_0823898 Ga0436362_0823898_52_477 141
181 3300041509 Ga0451843_0894202 Ga0451843_0894202_415_840 141
182 3300042012 Ga0439455_0080016 Ga0439455_0080016_187_618 141
183 3300042435 Ga0439434_0150278 Ga0439434_0150278_187_621 141
184 3300042876 Ga0451577_0000006 Ga0451577_0000006_445030_445455 141
185 3300042876 Ga0451577_0065473 Ga0451577_0065473_185_610 141
186 3300042876 Ga0451577_0099821 Ga0451577_0099821_1064_1489 141
187 3300042876 Ga0451577_0475696 Ga0451577_0475696_551_976 141
188 3300042876 Ga0451577_1197039 Ga0451577_1197039_51_476 141
189 3300044658 Ga0466972_0108186 Ga0466972_0108186_676_1101 141
190 3300044673 Ga0453683_0000086 Ga0453683_0000086_52331_52756 141
191 3300044673 Ga0453683_0000088 Ga0453683_0000088_111652_112077 141
192 3300044673 Ga0453683_0055576 Ga0453683_0055576_1921_2346 141
193 3300044673 Ga0453683_0143391 Ga0453683_0143391_83_565 141
194 3300044673 Ga0453683_0325849 Ga0453683_0325849_288_713 141
195 3300044712 Ga0453684_0000037 Ga0453684_0000037_445025_445450 141
196 3300044712 Ga0453684_0003980 Ga0453684_0003980_31153_31578 141
197 3300044712 Ga0453684_0006653 Ga0453684_0006653_4045_4470 141
198 3300044712 Ga0453684_0141118 Ga0453684_0141118_570_995 141
199 3300044712 Ga0453684_0142608 Ga0453684_0142608_1814_2239 141
200 3300044712 Ga0453684_0508716 Ga0453684_0508716_466_891 141
201 3300044712 Ga0453684_0544218 Ga0453684_0544218_578_1003 141
202 3300044712 Ga0453684_0798964 Ga0453684_0798964_185_610 141
203 3300044712 Ga0453684_0933354 Ga0453684_0933354_384_812 141
204 3300044842 Ga0466957_0575713 Ga0466957_0575713_43_468 141
205 3300045051 Ga0451576_0064678 Ga0451576_0064678_2193_2618 141
206 3300045051 Ga0451576_0132882 Ga0451576_0132882_669_1094 141
207 3300045051 Ga0451576_1354062 Ga0451576_1354062_302_727 141
208 3300045051 Ga0451576_1357767 Ga0451576_1357767_52_480 141
209 3300046517 Ga0495630_0081609 Ga0495630_0081609_970_1401 141
210 3300046689 Ga0495613_0138670 Ga0495613_0138670_1116_1547 141
211 3300048905 Ga0496102_0086130 Ga0496102_0086130_1531_1956 141
212 3300048906 Ga0496103_1012378 Ga0496103_1012378_49_474 141
213 3300048909 Ga0496106_0534982 Ga0496106_0534982_476_901 141
214 3300048917 Ga0496114_0354619 Ga0496114_0354619_229_654 141
215 3300048917 Ga0496114_0835167 Ga0496114_0835167_322_747 141
216 3300049532 Ga0501316_043755 Ga0501316_043755_113_538 141
217 3300049539 Ga0501323_059302 Ga0501323_059302_25_450 141
218 3300049568 Ga0501031_0348242 Ga0501031_0348242_245_670 141
219 3300049571 Ga0501034_0488943 Ga0501034_0488943_538_972 141
220 3300049571 Ga0501034_1128247 Ga0501034_1128247_61_486 141
221 3300049572 Ga0501036_0049905 Ga0501036_0049905_329_754 141
222 3300049573 Ga0501037_0715070 Ga0501037_0715070_218_643 141
223 3300049574 Ga0501038_0157353 Ga0501038_0157353_407_838 141
224 3300049579 Ga0501043_0113541 Ga0501043_0113541_101_526 141
225 3300049580 Ga0501046_0001481 Ga0501046_0001481_20064_20489 141
226 3300049580 Ga0501046_0144264 Ga0501046_0144264_27_452 141
227 3300049581 Ga0501047_1005151 Ga0501047_1005151_18_443 141
228 3300049586 Ga0501070_0826388 Ga0501070_0826388_10_435 141
229 3300049587 Ga0501071_1249664 Ga0501071_1249664_100_525 141
230 3300049588 Ga0501072_1070041 Ga0501072_1070041_184_612 141
231 3300049591 Ga0501075_0138668 Ga0501075_0138668_219_644 141
232 3300049592 Ga0501076_0360815 Ga0501076_0360815_722_1147 141
233 3300049679 Ga0501249_079170 Ga0501249_079170_189_614 141
234 3300049822 Ga0501035_0057170 Ga0501035_0057170_1127_1552 141
235 3300049822 Ga0501035_0286567 Ga0501035_0286567_269_694 141
236 3300049822 Ga0501035_0446625 Ga0501035_0446625_375_809 141
237 3300049823 Ga0501044_0073452 Ga0501044_0073452_1101_1526 141
238 3300049823 Ga0501044_0128463 Ga0501044_0128463_1911_2336 141
239 3300049823 Ga0501044_0299940 Ga0501044_0299940_662_1096 141
240 3300049823 Ga0501044_0774943 Ga0501044_0774943_55_480 141
241 3300050507 nmdc:mga05p37_11186_c1 nmdc:mga05p37_11186_c1_7302_7733 141
242 3300050509 nmdc:mga0qj67_7799_c1 nmdc:mga0qj67_7799_c1_6580_7011 141
243 3300050510 nmdc:mga06r32_30997_c1 nmdc:mga06r32_30997_c1_276_707 141
244 3300050511 nmdc:mga08y16_45863_c1 nmdc:mga08y16_45863_c1_3182_3613 141
245 3300050512 nmdc:mga0n895_204352_c1 nmdc:mga0n895_204352_c1_1130_1555 141
246 3300050512 nmdc:mga0n895_6845_c1 nmdc:mga0n895_6845_c1_6008_6439 141
247 3300050515 nmdc:mga0a205_17465_c1 nmdc:mga0a205_17465_c1_780_1211 141
248 3300054114 Ga0501084_0030431 Ga0501084_0030431_1454_1885 141
249 3300054114 Ga0501084_1871670 Ga0501084_1871670_14_439 141
250 3300059490 Ga0587066_118330 Ga0587066_118330_51_476 141
251 3300059491 Ga0587070_138044 Ga0587070_138044_126_551 141
252 3300059492 Ga0587073_0164531 Ga0587073_0164531_100_525 141
253 3300059503 Ga0587080_031000 Ga0587080_031000_428_859 141
254 3300059505 Ga0587083_0210241 Ga0587083_0210241_60_485 141
255 3300059644 Ga0587075_123056 Ga0587075_123056_93_518 141
256 3300059647 Ga0587079_077971 Ga0587079_077971_256_681 141
257 3300059647 Ga0587079_104966 Ga0587079_104966_141_566 141
258 3300059658 Ga0587119_063119 Ga0587119_063119_121_546 141
259 3300060353 Ga0501082_0029571 Ga0501082_0029571_1596_2021 141
260 3300061734 Ga0530510_1146819 Ga0530510_1146819_45_470 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

9

67

0.99

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

72

142

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.9906 71 141
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9877 71 140
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9865 71 140
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9764 3 72
5gae-assembly1.cif.gz_J rnc in complex with a translocating secyeg 0.9748 71 140
ID Description Score Start End Superfamily
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9943 72 139 1.10.10.250
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9837 3 67 3.30.1550.10
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9713 73 140 1.10.10.250
1hc8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9634 67 140 1.10.10.250
2qa4I02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9614 72 133 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A496M9P7-F1-model_v4 deleted 1.002 71 141
AF-A0A2S7TEL3-F1-model_v4 deleted 1.001 73 141
AF-A0A7C3NAE7-F1-model_v4 50S ribosomal protein L11 1.001 76 141 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7J4E0X6-F1-model_v4 deleted 1 1 69
AF-D6SXA2-F1-model_v4 deleted 0.9985 79 141

Feature Viewer

pLDDT pTM Quality
89.06 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map