F370179

General Info

Members Datasets Scaffolds Average Seq Length
261 190 522 460

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100012645|Ga0070706_1000126452
Length 507
Sequence MATFTGESANSPCYPRRMSASPAPRSETPFEGLLIGGERREGSSGEQRLLVNPADGEPLARVAQATVEDVDRAARLAEECYRTDWRRRMPRERAAILFRVAELIRQHGDELALIESRNVGKPLGAAKSEILSGADCFEYYAGAVTKFGGETIPVSARGACVTFREPIGVCAAIVPWNFPFAITTWKVAPALAMGNTVLVKPAGDTPLSALRLGDLALEAGVPPGALQVLPGPGGSIGAALVAHPAVRKVSFTGSTEAGREVMRLAADGIKRVSLELGGKSACIVFEDTDLEACLSSALWSVFDNAGQDCCARSRFLIQRSIYDRFVADLAARTEAIRVGDPAAPGTEMGPLITRAHRDKVVGYVELGGHEGAERLCGGAPPSDPTLSRGNFLKPAVFARVRNDMRIAQEEIFGPVVVAIPFDSEEEAIAIANASSYGLSGSLWTRDLGRALRVARSVETGVLSVNSSRSVFVEAPFGGVKQSGLGRELGMAALEAYSELKSVFFSEE

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 9.58
Rhizosphere 88.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100012645 3300005467 Bacteria 7812
2 JGI24751J29686_10000601 3300002459 Bacteria 9533
3 JGI25406J46586_10005983 3300003203 Bacteria 5626
4 Ga0065707_10082572 3300005295 Bacteria 13633
5 Ga0070676_10000705 3300005328 Bacteria 16330
6 Ga0070683_100043310 3300005329 Bacteria 4148
7 Ga0070683_100096175 3300005329 Bacteria 2785
8 Ga0070670_100020287 3300005331 Bacteria 5711
9 Ga0070670_100022781 3300005331 Bacteria 5390
10 Ga0068869_100002678 3300005334 Bacteria 10767
11 Ga0070666_10033473 3300005335 Bacteria 3400
12 Ga0070660_100031498 3300005339 Bacteria 3983
13 Ga0070689_100152180 3300005340 Bacteria 1866
14 Ga0070661_100033646 3300005344 Bacteria 3714
15 Ga0070668_100011743 3300005347 Bacteria 6521
16 Ga0070669_100021581 3300005353 Bacteria 4601
17 Ga0070675_100069160 3300005354 Bacteria 2925
18 Ga0070674_100000944 3300005356 Bacteria 15149
19 Ga0070674_100056195 3300005356 Bacteria 2729
20 Ga0070714_100037129 3300005435 Bacteria 4092
21 Ga0070714_100057048 3300005435 Bacteria 3341
22 Ga0070705_100001747 3300005440 Bacteria 11291
23 Ga0070705_100016982 3300005440 Bacteria 3792
24 Ga0070700_100018253 3300005441 Bacteria 4030
25 Ga0070700_100102435 3300005441 Bacteria 1888
26 Ga0070694_100134599 3300005444 Bacteria 1789
27 Ga0070708_100029725 3300005445 Bacteria 4716
28 Ga0070663_100087332 3300005455 Bacteria 2305
29 Ga0070662_100000716 3300005457 Bacteria 20329
30 Ga0068867_100000452 3300005459 Bacteria 27232
31 Ga0070698_100000024 3300005471 Bacteria 102551
32 Ga0070699_100151469 3300005518 Bacteria 2051
33 Ga0070684_100020376 3300005535 Bacteria 5502
34 Ga0070697_100011475 3300005536 Bacteria 6927
35 Ga0070695_100011852 3300005545 Bacteria 5218
36 Ga0070696_100008675 3300005546 Bacteria 6802
37 Ga0070665_100109432 3300005548 Bacteria 2765
38 Ga0070704_100053243 3300005549 Bacteria 2860
39 Ga0070664_100024533 3300005564 Bacteria 4988
40 Ga0068854_100000578 3300005578 Bacteria 21866
41 Ga0068854_100001415 3300005578 Bacteria 14496
42 Ga0068859_100000008 3300005617 Bacteria 383750
43 Ga0068859_100146292 3300005617 Bacteria 2438
44 Ga0068864_100015971 3300005618 Bacteria 6247
45 Ga0068866_10001253 3300005718 Bacteria 10983
46 Ga0068861_100011250 3300005719 Bacteria 6213
47 Ga0068861_100046021 3300005719 Bacteria 3288
48 Ga0068851_10000335 3300005834 Bacteria 21279
49 Ga0068870_10000377 3300005840 Bacteria 16745
50 Ga0068863_100041461 3300005841 Bacteria 4378
51 Ga0068863_100156029 3300005841 Bacteria 2185
52 Ga0068860_100006097 3300005843 Bacteria 12129
53 Ga0081455_10000753 3300005937 Bacteria 42080
54 Ga0081455_10003881 3300005937 Bacteria 17022
55 Ga0081455_10003894 3300005937 Bacteria 16994
56 Ga0081455_10034355 3300005937 Bacteria 4544
57 Ga0081538_10002405 3300005981 Bacteria 18375
58 Ga0081538_10004508 3300005981 Bacteria 12819
59 Ga0081538_10013029 3300005981 Bacteria 6615
60 Ga0081539_10001351 3300005985 Bacteria 42700
61 Ga0070717_10120372 3300006028 Bacteria 2248
62 Ga0075365_10033914 3300006038 Bacteria 3293
63 Ga0075363_100065410 3300006048 Bacteria 1966
64 Ga0075428_100056590 3300006844 Bacteria 4295
65 Ga0075428_100172503 3300006844 Bacteria 2344
66 Ga0075430_100006033 3300006846 Bacteria 10218
67 Ga0075431_100033779 3300006847 Bacteria 5270
68 Ga0075431_100036665 3300006847 Bacteria 5051
69 Ga0075433_10001410 3300006852 Bacteria 17709
70 Ga0075433_10002714 3300006852 Bacteria 13517
71 Ga0075433_10006422 3300006852 Bacteria 9297
72 Ga0075434_100036653 3300006871 Bacteria 4852
73 Ga0075429_100025648 3300006880 Bacteria 5118
74 Ga0068865_100002180 3300006881 Bacteria 11534
75 Ga0097620_100000008 3300006931 Bacteria 383750
76 Ga0097620_100146281 3300006931 Bacteria 2438
77 Ga0075435_100001980 3300007076 Bacteria 13369
78 Ga0105251_10039963 3300009011 Bacteria 2289
79 Ga0105240_10131891 3300009093 Bacteria 2997
80 Ga0105240_10139200 3300009093 Bacteria 2904
81 Ga0111539_10006222 3300009094 Bacteria 15407
82 Ga0111539_10170415 3300009094 Bacteria 2543
83 Ga0111539_10319303 3300009094 Bacteria 1807
84 Ga0111539_10356614 3300009094 Bacteria 1702
85 Ga0105245_10001251 3300009098 Bacteria 22959
86 Ga0105245_10054127 3300009098 Bacteria 3604
87 Ga0105247_10045812 3300009101 Bacteria 2684
88 Ga0114129_10033900 3300009147 Bacteria 7212
89 Ga0105243_10005408 3300009148 Bacteria 9965
90 Ga0105242_10001503 3300009176 Bacteria 18341
91 Ga0105242_10140476 3300009176 Bacteria 2095
92 Ga0105249_10156820 3300009553 Bacteria 2196
93 Ga0105239_10007604 3300010375 Bacteria 12417
94 Ga0105246_10014792 3300011119 Bacteria 4914
95 Ga0157370_10149477 3300013104 Bacteria 2174
96 Ga0157369_10006848 3300013105 Bacteria 13151
97 Ga0157378_10002245 3300013297 Bacteria 17146
98 Ga0163162_10013006 3300013306 Bacteria 8122
99 Ga0157372_10000064 3300013307 Bacteria 114648
100 Ga0163163_10004521 3300014325 Bacteria 11868
101 Ga0157380_10025734 3300014326 Bacteria 4465
102 Ga0157380_10049808 3300014326 Bacteria 3305
103 Ga0157380_10126440 3300014326 Bacteria 2173
104 Ga0157376_10015863 3300014969 Bacteria 5703
105 Ga0157376_10070073 3300014969 Bacteria 2975
106 Ga0207642_10001382 3300025899 Bacteria 7522
107 Ga0207645_10001389 3300025907 Bacteria 19868
108 Ga0207643_10000076 3300025908 Bacteria 64527
109 Ga0207684_10015313 3300025910 Bacteria 6602
110 Ga0207695_10097618 3300025913 Bacteria 2939
111 Ga0207649_10084100 3300025920 Bacteria 2067
112 Ga0207650_10000679 3300025925 Bacteria 26730
113 Ga0207650_10131127 3300025925 Bacteria 1961
114 Ga0207659_10056348 3300025926 Bacteria 2815
115 Ga0207687_10000023 3300025927 Bacteria 217098
116 Ga0207687_10002173 3300025927 Bacteria 13388
117 Ga0207706_10000939 3300025933 Bacteria 29795
118 Ga0207686_10001382 3300025934 Bacteria 13775
119 Ga0207686_10056461 3300025934 Bacteria 2468
120 Ga0207709_10003373 3300025935 Bacteria 9539
121 Ga0207669_10000664 3300025937 Bacteria 14836
122 Ga0207704_10000982 3300025938 Bacteria 12654
123 Ga0207691_10082372 3300025940 Bacteria 2890
124 Ga0207689_10005270 3300025942 Bacteria 11588
125 Ga0207679_10018663 3300025945 Bacteria 4651
126 Ga0207679_10124754 3300025945 Bacteria 2056
127 Ga0207668_10029811 3300025972 Bacteria 3580
128 Ga0207640_10007708 3300025981 Bacteria 5951
129 Ga0207640_10008962 3300025981 Bacteria 5575
130 Ga0207703_10046075 3300026035 Bacteria 3510
131 Ga0207678_10005346 3300026067 Bacteria 11499
132 Ga0207708_10016308 3300026075 Bacteria 5584
133 Ga0207708_10079523 3300026075 Bacteria 2518
134 Ga0207641_10156236 3300026088 Bacteria 2069
135 Ga0207648_10000794 3300026089 Bacteria 35568
136 Ga0207676_10000747 3300026095 Bacteria 25485
137 Ga0207676_10041389 3300026095 Bacteria 3536
138 Ga0207674_10000959 3300026116 Bacteria 37695
139 Ga0207674_10006453 3300026116 Bacteria 13790
140 Ga0207675_100047960 3300026118 Bacteria 3987
141 Ga0207698_10069720 3300026142 Bacteria 2782
142 Ga0207428_10007125 3300027907 Bacteria 10227
143 Ga0268264_10019482 3300028381 Bacteria 5544
144 Ga0265337_1000069 3300028556 Bacteria 47825
145 Ga0265326_10000012 3300028558 Bacteria 175352
146 Ga0265322_10000003 3300028654 Bacteria 468671
147 Ga0265338_10014728 3300028800 Bacteria 8663
148 Ga0265324_10000732 3300029957 Bacteria 21883
149 Ga0265328_10023830 3300031239 Bacteria 2318
150 Ga0265320_10000001 3300031240 Bacteria 847191
151 Ga0265329_10003170 3300031242 Bacteria 7230
152 Ga0265339_10033181 3300031249 Bacteria 2908
153 Ga0265331_10002679 3300031250 Bacteria 11877
154 Ga0265327_10000003 3300031251 Bacteria 852750
155 Ga0265327_10018654 3300031251 Bacteria 4292
156 Ga0265316_10014534 3300031344 Bacteria 6920
157 Ga0265314_10000044 3300031711 Bacteria 207337
158 Ga0373923_0050537 3300035111 Bacteria 1742
159 Ga0373946_0016197 3300035171 Bacteria 2837
160 Ga0373935_0061565 3300035692 Bacteria 2403
161 Ga0395899_0119306 3300037312 Bacteria 1891
162 Ga0395900_0000653 3300037418 Bacteria 46381
163 Ga0395900_0022999 3300037418 Bacteria 6379
164 Ga0395898_0000885 3300037466 Bacteria 48863
165 Ga0395898_0001039 3300037466 Bacteria 43298
166 Ga0395905_0001855 3300037471 Bacteria 24345
167 Ga0395905_0007993 3300037471 Bacteria 10453
168 Ga0395905_0008146 3300037471 Bacteria 10350
169 Ga0395901_0000625 3300038443 Bacteria 41072
170 Ga0395901_0001420 3300038443 Bacteria 24995
171 Ga0436365_0693376 3300039437 Bacteria 1743
172 Ga0439448_0021907 3300042005 Bacteria 1982
173 Ga0466966_0014121 3300044684 Bacteria 5286
174 Ga0466966_0027447 3300044684 Bacteria 3712
175 Ga0466961_0009586 3300044693 Bacteria 6164
176 Ga0466961_0034640 3300044693 Bacteria 3241
177 Ga0466961_0040025 3300044693 Bacteria 3004
178 Ga0466961_0130308 3300044693 Bacteria 1576
179 Ga0466963_0012867 3300044694 Bacteria 5125
180 Ga0466968_0003942 3300044735 Bacteria 5513
181 Ga0466968_0009184 3300044735 Bacteria 3802
182 Ga0466959_0037777 3300045049 Bacteria 3568
183 Ga0451576_0002085 3300045051 Bacteria 31228
184 Ga0466958_0010244 3300045836 Bacteria 5245
185 Ga0466967_0000004 3300045976 Bacteria 155664
186 Ga0495617_030730 3300046452 Bacteria 1805
187 Ga0495603_0019716 3300046455 Bacteria 4083
188 Ga0495603_0028821 3300046455 Bacteria 3350
189 Ga0495629_0015032 3300046459 Bacteria 5563
190 Ga0495629_0101221 3300046459 Bacteria 2011
191 Ga0495638_0040458 3300046460 Bacteria 2954
192 Ga0495641_0009575 3300046461 Bacteria 5742
193 Ga0495653_0014291 3300046463 Bacteria 6474
194 Ga0495582_0003486 3300046473 Bacteria 8859
195 Ga0495639_0002024 3300046475 Bacteria 8974
196 Ga0495662_0017323 3300046476 Bacteria 3486
197 Ga0495664_0016799 3300046477 Bacteria 4176
198 Ga0495608_0099575 3300046511 Bacteria 1875
199 Ga0495618_0016995 3300046514 Bacteria 4458
200 Ga0495630_0033943 3300046517 Bacteria 3806
201 Ga0495666_0001834 3300046526 Bacteria 10496
202 Ga0495654_0063875 3300046530 Bacteria 1762
203 Ga0495665_0003058 3300046531 Bacteria 9043
204 Ga0495640_0089669 3300046533 Bacteria 2030
205 Ga0495634_0000437 3300046642 Bacteria 41521
206 Ga0495635_0003097 3300046663 Bacteria 11440
207 Ga0495635_0034509 3300046663 Bacteria 3508
208 Ga0495647_0001801 3300046681 Bacteria 6625
209 Ga0495658_0010660 3300046683 Bacteria 4601
210 Ga0495658_0129716 3300046683 Bacteria 1533
211 Ga0495624_0007745 3300046690 Bacteria 7533
212 Ga0495581_0029175 3300047315 Bacteria 3197
213 Ga0495676_0019610 3300047321 Bacteria 5947
214 Ga0495676_0136264 3300047321 Bacteria 1765
215 Ga0495680_0021869 3300047322 Bacteria 5344
216 Ga0495684_0053002 3300047471 Bacteria 3095
217 Ga0495593_0027244 3300047673 Bacteria 3147
218 Ga0495614_0000877 3300048089 Bacteria 12748
219 Ga0496102_0091632 3300048905 Bacteria 2814
220 Ga0496104_0010310 3300048907 Bacteria 8343
221 Ga0496104_0149037 3300048907 Bacteria 2246
222 Ga0496105_0164130 3300048908 Bacteria 1823
223 Ga0496106_0046078 3300048909 Bacteria 3277
224 Ga0496106_0124155 3300048909 Bacteria 2020
225 Ga0496108_0013862 3300048911 Bacteria 6575
226 Ga0496108_0054207 3300048911 Bacteria 3365
227 Ga0496108_0144992 3300048911 Bacteria 2047
228 Ga0496109_0114917 3300048912 Bacteria 2504
229 Ga0496110_0001665 3300048913 Bacteria 16288
230 Ga0496110_0087815 3300048913 Bacteria 2777
231 Ga0496110_0154109 3300048913 Bacteria 2081
232 Ga0496110_0168938 3300048913 Bacteria 1984
233 Ga0496111_0001993 3300048914 Bacteria 12146
234 Ga0496111_0163729 3300048914 Bacteria 1652
235 Ga0496112_0001473 3300048915 Bacteria 18072
236 Ga0496112_0024762 3300048915 Bacteria 5755
237 Ga0496113_0007026 3300048916 Bacteria 7202
238 Ga0496113_0011605 3300048916 Bacteria 5888
239 Ga0496113_0081484 3300048916 Bacteria 2481
240 Ga0496113_0227490 3300048916 Bacteria 1487
241 Ga0496114_0048515 3300048917 Bacteria 3532
242 Ga0496114_0180910 3300048917 Bacteria 1841
243 Ga0496115_0084098 3300048918 Bacteria 2594
244 Ga0496119_0002959 3300048922 Bacteria 18049
245 Ga0496120_0000168 3300048923 Bacteria 110705
246 Ga0501034_0007635 3300049571 Bacteria 11505
247 Ga0501047_0350731 3300049581 Bacteria 1312
248 nmdc:mga05p37_26372_c1 3300050507 Bacteria 7068
249 nmdc:mga0qj67_168500_c1 3300050509 Bacteria 1778
250 nmdc:mga0qj67_6197_c1 3300050509 Bacteria 8775
251 nmdc:mga06r32_279981_c1 3300050510 Bacteria 1655
252 nmdc:mga06r32_8897_c1 3300050510 Bacteria 9051
253 nmdc:mga08y16_140570_c1 3300050511 Bacteria 2510
254 nmdc:mga08y16_173923_c1 3300050511 Bacteria 2236
255 nmdc:mga08y16_37477_c1 3300050511 Bacteria 5092
256 nmdc:mga0n895_40308_c1 3300050512 Bacteria 3863
257 nmdc:mga0rr50_117252_c1 3300050513 Bacteria 2114
258 nmdc:mga0a205_3327_c1 3300050515 Bacteria 14313
259 nmdc:mga0a205_52218_c1 3300050515 Bacteria 3946
260 Ga0495612_0007262 3300053078 Bacteria 4534
261 Ga0495619_0001021 3300053085 Bacteria 18351
262 Ga0070706_100012645
263 JGI24751J29686_10000601
264 JGI25406J46586_10005983
265 Ga0065707_10082572
266 Ga0070676_10000705
267 Ga0070683_100043310
268 Ga0070683_100096175
269 Ga0070670_100020287
270 Ga0070670_100022781
271 Ga0068869_100002678
272 Ga0070666_10033473
273 Ga0070660_100031498
274 Ga0070689_100152180
275 Ga0070661_100033646
276 Ga0070668_100011743
277 Ga0070669_100021581
278 Ga0070675_100069160
279 Ga0070674_100000944
280 Ga0070674_100056195
281 Ga0070714_100037129
282 Ga0070714_100057048
283 Ga0070705_100001747
284 Ga0070705_100016982
285 Ga0070700_100018253
286 Ga0070700_100102435
287 Ga0070694_100134599
288 Ga0070708_100029725
289 Ga0070663_100087332
290 Ga0070662_100000716
291 Ga0068867_100000452
292 Ga0070698_100000024
293 Ga0070699_100151469
294 Ga0070684_100020376
295 Ga0070697_100011475
296 Ga0070695_100011852
297 Ga0070696_100008675
298 Ga0070665_100109432
299 Ga0070704_100053243
300 Ga0070664_100024533
301 Ga0068854_100000578
302 Ga0068854_100001415
303 Ga0068859_100000008
304 Ga0068859_100146292
305 Ga0068864_100015971
306 Ga0068866_10001253
307 Ga0068861_100011250
308 Ga0068861_100046021
309 Ga0068851_10000335
310 Ga0068870_10000377
311 Ga0068863_100041461
312 Ga0068863_100156029
313 Ga0068860_100006097
314 Ga0081455_10000753
315 Ga0081455_10003881
316 Ga0081455_10003894
317 Ga0081455_10034355
318 Ga0081538_10002405
319 Ga0081538_10004508
320 Ga0081538_10013029
321 Ga0081539_10001351
322 Ga0070717_10120372
323 Ga0075365_10033914
324 Ga0075363_100065410
325 Ga0075428_100056590
326 Ga0075428_100172503
327 Ga0075430_100006033
328 Ga0075431_100033779
329 Ga0075431_100036665
330 Ga0075433_10001410
331 Ga0075433_10002714
332 Ga0075433_10006422
333 Ga0075434_100036653
334 Ga0075429_100025648
335 Ga0068865_100002180
336 Ga0097620_100000008
337 Ga0097620_100146281
338 Ga0075435_100001980
339 Ga0105251_10039963
340 Ga0105240_10131891
341 Ga0105240_10139200
342 Ga0111539_10006222
343 Ga0111539_10170415
344 Ga0111539_10319303
345 Ga0111539_10356614
346 Ga0105245_10001251
347 Ga0105245_10054127
348 Ga0105247_10045812
349 Ga0114129_10033900
350 Ga0105243_10005408
351 Ga0105242_10001503
352 Ga0105242_10140476
353 Ga0105249_10156820
354 Ga0105239_10007604
355 Ga0105246_10014792
356 Ga0157370_10149477
357 Ga0157369_10006848
358 Ga0157378_10002245
359 Ga0163162_10013006
360 Ga0157372_10000064
361 Ga0163163_10004521
362 Ga0157380_10025734
363 Ga0157380_10049808
364 Ga0157380_10126440
365 Ga0157376_10015863
366 Ga0157376_10070073
367 Ga0207642_10001382
368 Ga0207645_10001389
369 Ga0207643_10000076
370 Ga0207684_10015313
371 Ga0207695_10097618
372 Ga0207649_10084100
373 Ga0207650_10000679
374 Ga0207650_10131127
375 Ga0207659_10056348
376 Ga0207687_10000023
377 Ga0207687_10002173
378 Ga0207706_10000939
379 Ga0207686_10001382
380 Ga0207686_10056461
381 Ga0207709_10003373
382 Ga0207669_10000664
383 Ga0207704_10000982
384 Ga0207691_10082372
385 Ga0207689_10005270
386 Ga0207679_10018663
387 Ga0207679_10124754
388 Ga0207668_10029811
389 Ga0207640_10007708
390 Ga0207640_10008962
391 Ga0207703_10046075
392 Ga0207678_10005346
393 Ga0207708_10016308
394 Ga0207708_10079523
395 Ga0207641_10156236
396 Ga0207648_10000794
397 Ga0207676_10000747
398 Ga0207676_10041389
399 Ga0207674_10000959
400 Ga0207674_10006453
401 Ga0207675_100047960
402 Ga0207698_10069720
403 Ga0207428_10007125
404 Ga0268264_10019482
405 Ga0265337_1000069
406 Ga0265326_10000012
407 Ga0265322_10000003
408 Ga0265338_10014728
409 Ga0265324_10000732
410 Ga0265328_10023830
411 Ga0265320_10000001
412 Ga0265329_10003170
413 Ga0265339_10033181
414 Ga0265331_10002679
415 Ga0265327_10000003
416 Ga0265327_10018654
417 Ga0265316_10014534
418 Ga0265314_10000044
419 Ga0373923_0050537
420 Ga0373946_0016197
421 Ga0373935_0061565
422 Ga0395899_0119306
423 Ga0395900_0000653
424 Ga0395900_0022999
425 Ga0395898_0000885
426 Ga0395898_0001039
427 Ga0395905_0001855
428 Ga0395905_0007993
429 Ga0395905_0008146
430 Ga0395901_0000625
431 Ga0395901_0001420
432 Ga0436365_0693376
433 Ga0439448_0021907
434 Ga0466966_0014121
435 Ga0466966_0027447
436 Ga0466961_0009586
437 Ga0466961_0034640
438 Ga0466961_0040025
439 Ga0466961_0130308
440 Ga0466963_0012867
441 Ga0466968_0003942
442 Ga0466968_0009184
443 Ga0466959_0037777
444 Ga0451576_0002085
445 Ga0466958_0010244
446 Ga0466967_0000004
447 Ga0495617_030730
448 Ga0495603_0019716
449 Ga0495603_0028821
450 Ga0495629_0015032
451 Ga0495629_0101221
452 Ga0495638_0040458
453 Ga0495641_0009575
454 Ga0495653_0014291
455 Ga0495582_0003486
456 Ga0495639_0002024
457 Ga0495662_0017323
458 Ga0495664_0016799
459 Ga0495608_0099575
460 Ga0495618_0016995
461 Ga0495630_0033943
462 Ga0495666_0001834
463 Ga0495654_0063875
464 Ga0495665_0003058
465 Ga0495640_0089669
466 Ga0495634_0000437
467 Ga0495635_0003097
468 Ga0495635_0034509
469 Ga0495647_0001801
470 Ga0495658_0010660
471 Ga0495658_0129716
472 Ga0495624_0007745
473 Ga0495581_0029175
474 Ga0495676_0019610
475 Ga0495676_0136264
476 Ga0495680_0021869
477 Ga0495684_0053002
478 Ga0495593_0027244
479 Ga0495614_0000877
480 Ga0496102_0091632
481 Ga0496104_0010310
482 Ga0496104_0149037
483 Ga0496105_0164130
484 Ga0496106_0046078
485 Ga0496106_0124155
486 Ga0496108_0013862
487 Ga0496108_0054207
488 Ga0496108_0144992
489 Ga0496109_0114917
490 Ga0496110_0001665
491 Ga0496110_0087815
492 Ga0496110_0154109
493 Ga0496110_0168938
494 Ga0496111_0001993
495 Ga0496111_0163729
496 Ga0496112_0001473
497 Ga0496112_0024762
498 Ga0496113_0007026
499 Ga0496113_0011605
500 Ga0496113_0081484
501 Ga0496113_0227490
502 Ga0496114_0048515
503 Ga0496114_0180910
504 Ga0496115_0084098
505 Ga0496119_0002959
506 Ga0496120_0000168
507 Ga0501034_0007635
508 Ga0501047_0350731
509 nmdc:mga05p37_26372_c1
510 nmdc:mga0qj67_168500_c1
511 nmdc:mga0qj67_6197_c1
512 nmdc:mga06r32_279981_c1
513 nmdc:mga06r32_8897_c1
514 nmdc:mga08y16_140570_c1
515 nmdc:mga08y16_173923_c1
516 nmdc:mga08y16_37477_c1
517 nmdc:mga0n895_40308_c1
518 nmdc:mga0rr50_117252_c1
519 nmdc:mga0a205_3327_c1
520 nmdc:mga0a205_52218_c1
521 Ga0495612_0007262
522 Ga0495619_0001021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

40

502

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b4r-assembly1.cif.gz_D the crystal structure of the aldehyde dehydrogenase kaub from pseudomonas aeruginosa 0.9828 4 477
7jso-assembly1.cif.gz_A p. syringae alda indole-3-acetaldehyde dehydrogenase c302a mutant in complex with nad+ and iaa 0.9826 4 477
4pz2-assembly1.cif.gz_B structure of zm aldh2-6 (rf2f) in complex with nad 0.9825 4 477
5iuv-assembly1.cif.gz_A crystal structure of indole-3-acetaldehyde dehydrogenase in complexed with nad+ 0.9824 4 477
4o6r-assembly1.cif.gz_D crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia 0.9823 4 477
ID Description Score Start End Superfamily
af_P40047_292_478_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9871 253 438 3.40.309.10
af_P54115_18_274_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9857 4 251 3.40.605.10
af_Q2FV10_3_257_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9848 5 251 3.40.605.10
af_Q54QC5_257_458_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9843 254 438 3.40.309.10
af_A0A1D6MRK0_1_96_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9838 157 251 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A6J6T9G3-F1-model_v4 Unannotated protein 0.989 4 479 GO:0016620
AF-A0A838R7A0-F1-model_v4 Aldehyde dehydrogenase family protein 0.9864 7 479 GO:0016620
AF-A0A7J9WU64-F1-model_v4 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase 0.9858 2 479 GO:0018480
GO:1901023
AF-A0A3C1Z299-F1-model_v4 Carnitine dehydratase 0.9858 175 297 GO:0016620
AF-A0A502NGL9-F1-model_v4 deleted 0.9847 4 479

Map