F370229
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 261 | 186 | 261 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10340927|Ga0081455_103409272 |
| Length | 142 |
| Sequence | MANEVKDVVEGDGYAVANVDGLADGPGFRKVRRALGVTAFGVNAIELPAGYETGRHFHEEQEELYFLHRGKIEITLDDDTFLLGPGGLARVDAATVRKIKNVGDEPAVYLVTGGKDGYVGRDGRLPEGETSRVGETAGEQQQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 92 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 93 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 94 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 95 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 98 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 99 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 100 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 101 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 102 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 104 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 105 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 109 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 111 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 112 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 113 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 114 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 117 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 118 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 152 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 153 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 154 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 159 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 160 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 161 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 174 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.32 |
| Metatranscriptomes | 2.68 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.92 |
| Nodule | 0 |
| Rhizoplane | 7.66 |
| Rhizosphere | 90.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1009188 | 3300000549 | Bacteria | 1193 |
| 2 | JGI24743J22301_10086453 | 3300001991 | Bacteria | 665 |
| 3 | JGI25407J50210_10004026 | 3300003373 | Bacteria | 3564 |
| 4 | JGI25407J50210_10104477 | 3300003373 | Bacteria | 699 |
| 5 | Ga0070683_100034927 | 3300005329 | Bacteria | 4595 |
| 6 | Ga0070683_100062335 | 3300005329 | Bacteria | 3467 |
| 7 | Ga0070683_100118607 | 3300005329 | Bacteria | 2499 |
| 8 | Ga0070683_100122452 | 3300005329 | Bacteria | 2457 |
| 9 | Ga0070683_100638485 | 3300005329 | Unclassified | 1019 |
| 10 | Ga0070666_10120764 | 3300005335 | Bacteria | 1817 |
| 11 | Ga0070682_100000171 | 3300005337 | Bacteria | 48470 |
| 12 | Ga0070682_100628999 | 3300005337 | Bacteria | 851 |
| 13 | Ga0068868_100003306 | 3300005338 | Bacteria | 11219 |
| 14 | Ga0070661_100000035 | 3300005344 | Bacteria | 111363 |
| 15 | Ga0070668_100106891 | 3300005347 | Bacteria | 2224 |
| 16 | Ga0070668_100150615 | 3300005347 | Bacteria | 1881 |
| 17 | Ga0070675_100000377 | 3300005354 | Bacteria | 30146 |
| 18 | Ga0070673_100000474 | 3300005364 | Bacteria | 21373 |
| 19 | Ga0070673_100998967 | 3300005364 | Unclassified | 779 |
| 20 | Ga0070688_100000285 | 3300005365 | Bacteria | 26015 |
| 21 | Ga0070659_100537339 | 3300005366 | Bacteria | 1000 |
| 22 | Ga0070659_101621483 | 3300005366 | Bacteria | 578 |
| 23 | Ga0070714_100192236 | 3300005435 | Bacteria | 1863 |
| 24 | Ga0070714_100777686 | 3300005435 | Bacteria | 926 |
| 25 | Ga0070713_100000380 | 3300005436 | Bacteria | 28361 |
| 26 | Ga0070711_100073303 | 3300005439 | Bacteria | 2419 |
| 27 | Ga0070678_100022681 | 3300005456 | Bacteria | 4166 |
| 28 | Ga0070685_10000159 | 3300005466 | Bacteria | 43951 |
| 29 | Ga0070684_100415345 | 3300005535 | Bacteria | 1242 |
| 30 | Ga0070684_100711447 | 3300005535 | Bacteria | 937 |
| 31 | Ga0070697_101317385 | 3300005536 | Unclassified | 644 |
| 32 | Ga0068853_100401489 | 3300005539 | Bacteria | 1283 |
| 33 | Ga0070672_100000006 | 3300005543 | Bacteria | 117060 |
| 34 | Ga0070665_100169526 | 3300005548 | Bacteria | 2184 |
| 35 | Ga0070664_100119123 | 3300005564 | Bacteria | 2310 |
| 36 | Ga0068857_101040074 | 3300005577 | Unclassified | 789 |
| 37 | Ga0068854_100024981 | 3300005578 | Bacteria | 4098 |
| 38 | Ga0068854_100906776 | 3300005578 | Unclassified | 775 |
| 39 | Ga0068856_100000925 | 3300005614 | Bacteria | 31449 |
| 40 | Ga0068856_100077098 | 3300005614 | Bacteria | 3302 |
| 41 | Ga0068856_100223944 | 3300005614 | Bacteria | 1896 |
| 42 | Ga0068852_100006635 | 3300005616 | Bacteria | 8385 |
| 43 | Ga0081455_10017592 | 3300005937 | Bacteria | 6843 |
| 44 | Ga0081455_10340927 | 3300005937 | Unclassified | 1061 |
| 45 | Ga0081538_10000691 | 3300005981 | Bacteria | 37035 |
| 46 | Ga0081538_10000894 | 3300005981 | Bacteria | 32276 |
| 47 | Ga0081538_10009157 | 3300005981 | Bacteria | 8304 |
| 48 | Ga0081540_1042483 | 3300005983 | Bacteria | 2345 |
| 49 | Ga0081540_1284191 | 3300005983 | Bacteria | 570 |
| 50 | Ga0075365_10240920 | 3300006038 | Bacteria | 1270 |
| 51 | Ga0075363_100520166 | 3300006048 | Bacteria | 708 |
| 52 | Ga0070712_100012842 | 3300006175 | Bacteria | 5333 |
| 53 | Ga0070712_101621756 | 3300006175 | Unclassified | 566 |
| 54 | Ga0075367_10554581 | 3300006178 | Bacteria | 730 |
| 55 | Ga0075433_10622216 | 3300006852 | Bacteria | 947 |
| 56 | Ga0075434_100794369 | 3300006871 | Bacteria | 963 |
| 57 | Ga0068865_100001059 | 3300006881 | Bacteria | 15817 |
| 58 | Ga0105251_10117569 | 3300009011 | Unclassified | 1208 |
| 59 | Ga0111539_10118468 | 3300009094 | Bacteria | 3103 |
| 60 | Ga0105245_10020367 | 3300009098 | Bacteria | 5817 |
| 61 | Ga0105247_10103375 | 3300009101 | Bacteria | 1824 |
| 62 | Ga0105243_10053717 | 3300009148 | Bacteria | 3196 |
| 63 | Ga0105241_10150816 | 3300009174 | Bacteria | 1902 |
| 64 | Ga0105241_10308971 | 3300009174 | Unclassified | 1359 |
| 65 | Ga0105248_10001622 | 3300009177 | Bacteria | 24979 |
| 66 | Ga0105239_10110448 | 3300010375 | Bacteria | 3048 |
| 67 | Ga0157370_10159693 | 3300013104 | Bacteria | 2098 |
| 68 | Ga0157370_10272610 | 3300013104 | Unclassified | 1563 |
| 69 | Ga0157378_10154364 | 3300013297 | Bacteria | 2141 |
| 70 | Ga0157378_10211031 | 3300013297 | Bacteria | 1841 |
| 71 | Ga0157375_10373080 | 3300013308 | Bacteria | 1593 |
| 72 | Ga0157375_11613584 | 3300013308 | Bacteria | 767 |
| 73 | Ga0163163_11796446 | 3300014325 | Bacteria | 673 |
| 74 | Ga0157380_10000445 | 3300014326 | Bacteria | 25326 |
| 75 | Ga0197907_10034932 | 3300020069 | Unclassified | 1116 |
| 76 | Ga0206356_10258878 | 3300020070 | Bacteria | 3533 |
| 77 | Ga0206356_10394249 | 3300020070 | Bacteria | 1120 |
| 78 | Ga0206349_1670028 | 3300020075 | Unclassified | 1646 |
| 79 | Ga0206352_11286604 | 3300020078 | Unclassified | 1551 |
| 80 | Ga0206354_10669761 | 3300020081 | Unclassified | 1147 |
| 81 | Ga0206353_10298658 | 3300020082 | Unclassified | 1117 |
| 82 | Ga0207656_10001648 | 3300025321 | Bacteria | 7432 |
| 83 | Ga0207710_10066194 | 3300025900 | Bacteria | 1648 |
| 84 | Ga0207680_10151375 | 3300025903 | Bacteria | 1547 |
| 85 | Ga0207654_10075293 | 3300025911 | Bacteria | 2017 |
| 86 | Ga0207693_10019603 | 3300025915 | Bacteria | 5379 |
| 87 | Ga0207693_11222066 | 3300025915 | Unclassified | 566 |
| 88 | Ga0207663_10000487 | 3300025916 | Bacteria | 17285 |
| 89 | Ga0207649_10000028 | 3300025920 | Bacteria | 161482 |
| 90 | Ga0207650_10134382 | 3300025925 | Bacteria | 1939 |
| 91 | Ga0207659_10000246 | 3300025926 | Bacteria | 32971 |
| 92 | Ga0207687_10004445 | 3300025927 | Bacteria | 9352 |
| 93 | Ga0207700_10000033 | 3300025928 | Bacteria | 123113 |
| 94 | Ga0207664_10008515 | 3300025929 | Bacteria | 7161 |
| 95 | Ga0207664_10237872 | 3300025929 | Bacteria | 1585 |
| 96 | Ga0207690_11338343 | 3300025932 | Bacteria | 599 |
| 97 | Ga0207709_10105514 | 3300025935 | Bacteria | 1872 |
| 98 | Ga0207704_10000103 | 3300025938 | Bacteria | 47628 |
| 99 | Ga0207691_10000025 | 3300025940 | Bacteria | 129424 |
| 100 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 101 | Ga0207661_10009459 | 3300025944 | Bacteria | 6990 |
| 102 | Ga0207661_10023059 | 3300025944 | Bacteria | 4699 |
| 103 | Ga0207661_10030514 | 3300025944 | Bacteria | 4154 |
| 104 | Ga0207661_10546403 | 3300025944 | Unclassified | 1061 |
| 105 | Ga0207679_10170227 | 3300025945 | Bacteria | 1792 |
| 106 | Ga0207679_10622914 | 3300025945 | Bacteria | 974 |
| 107 | Ga0207651_10000664 | 3300025960 | Bacteria | 14678 |
| 108 | Ga0207668_10097771 | 3300025972 | Bacteria | 2173 |
| 109 | Ga0207668_10448440 | 3300025972 | Bacteria | 1101 |
| 110 | Ga0207640_10000551 | 3300025981 | Bacteria | 22450 |
| 111 | Ga0207640_10365806 | 3300025981 | Bacteria | 1164 |
| 112 | Ga0207677_10001888 | 3300026023 | Bacteria | 11062 |
| 113 | Ga0207703_10000088 | 3300026035 | Bacteria | 106080 |
| 114 | Ga0207639_10167634 | 3300026041 | Bacteria | 1857 |
| 115 | Ga0207639_10250615 | 3300026041 | Bacteria | 1544 |
| 116 | Ga0207702_10000242 | 3300026078 | Bacteria | 63808 |
| 117 | Ga0207702_10022205 | 3300026078 | Bacteria | 5260 |
| 118 | Ga0207702_10331452 | 3300026078 | Bacteria | 1452 |
| 119 | Ga0207674_12020221 | 3300026116 | Unclassified | 541 |
| 120 | Ga0207683_10031904 | 3300026121 | Bacteria | 4574 |
| 121 | Ga0207698_10000414 | 3300026142 | Bacteria | 24644 |
| 122 | Ga0207698_10021589 | 3300026142 | Bacteria | 4457 |
| 123 | Ga0207428_10065837 | 3300027907 | Bacteria | 2857 |
| 124 | Ga0268266_10001578 | 3300028379 | Bacteria | 26646 |
| 125 | Ga0268266_10118622 | 3300028379 | Bacteria | 2352 |
| 126 | Ga0268266_10776017 | 3300028379 | Bacteria | 925 |
| 127 | Ga0265327_10034253 | 3300031251 | Bacteria | 2821 |
| 128 | Ga0307408_100055850 | 3300031548 | Bacteria | 2861 |
| 129 | Ga0307405_11717915 | 3300031731 | Bacteria | 556 |
| 130 | Ga0307413_10001669 | 3300031824 | Bacteria | 8622 |
| 131 | Ga0307413_11089487 | 3300031824 | Unclassified | 689 |
| 132 | Ga0307410_10018720 | 3300031852 | Bacteria | 4191 |
| 133 | Ga0307410_10057292 | 3300031852 | Bacteria | 2653 |
| 134 | Ga0307406_10041822 | 3300031901 | Bacteria | 2858 |
| 135 | Ga0307407_10180731 | 3300031903 | Bacteria | 1398 |
| 136 | Ga0307412_10346637 | 3300031911 | Unclassified | 1191 |
| 137 | Ga0307409_100038352 | 3300031995 | Bacteria | 3543 |
| 138 | Ga0307409_100322874 | 3300031995 | Bacteria | 1446 |
| 139 | Ga0307409_100468741 | 3300031995 | Bacteria | 1219 |
| 140 | Ga0307409_100535452 | 3300031995 | Unclassified | 1147 |
| 141 | Ga0307416_100003565 | 3300032002 | Bacteria | 9183 |
| 142 | Ga0307416_100117860 | 3300032002 | Bacteria | 2358 |
| 143 | Ga0307411_10340719 | 3300032005 | Bacteria | 1218 |
| 144 | Ga0307415_100000715 | 3300032126 | Bacteria | 14842 |
| 145 | Ga0307415_100003877 | 3300032126 | Bacteria | 7679 |
| 146 | Ga0307415_100068677 | 3300032126 | Bacteria | 2481 |
| 147 | Ga0307415_100129610 | 3300032126 | Bacteria | 1907 |
| 148 | Ga0307415_100980965 | 3300032126 | Bacteria | 784 |
| 149 | Ga0373959_0085333 | 3300034820 | Bacteria | 733 |
| 150 | Ga0373932_0047254 | 3300035112 | Bacteria | 1265 |
| 151 | Ga0373939_0043293 | 3300035114 | Bacteria | 1365 |
| 152 | Ga0373953_0277012 | 3300035117 | Bacteria | 731 |
| 153 | Ga0373960_0031242 | 3300035121 | Bacteria | 1488 |
| 154 | Ga0373931_0335039 | 3300035691 | Bacteria | 943 |
| 155 | Ga0373935_1500207 | 3300035692 | Bacteria | 505 |
| 156 | Ga0373933_0250790 | 3300035724 | Bacteria | 1140 |
| 157 | Ga0373937_0007200 | 3300036401 | Bacteria | 9627 |
| 158 | Ga0373937_0762918 | 3300036401 | Bacteria | 915 |
| 159 | Ga0451847_0360256 | 3300041503 | Archaea | 684 |
| 160 | Ga0450888_006547 | 3300042126 | Bacteria | 1269 |
| 161 | Ga0450900_065906 | 3300042136 | Bacteria | 570 |
| 162 | Ga0439460_0054825 | 3300042461 | Bacteria | 1204 |
| 163 | Ga0466957_0005836 | 3300044842 | Bacteria | 6932 |
| 164 | Ga0466959_0188528 | 3300045049 | Bacteria | 1440 |
| 165 | Ga0466958_0345772 | 3300045836 | Unclassified | 957 |
| 166 | Ga0466958_0563766 | 3300045836 | Bacteria | 740 |
| 167 | Ga0466967_0000017 | 3300045976 | Bacteria | 89904 |
| 168 | Ga0495592_0374079 | 3300046454 | Bacteria | 908 |
| 169 | Ga0495603_0000593 | 3300046455 | Bacteria | 20342 |
| 170 | Ga0495629_0000999 | 3300046459 | Bacteria | 22693 |
| 171 | Ga0495641_0030362 | 3300046461 | Bacteria | 2593 |
| 172 | Ga0495651_0102313 | 3300046462 | Bacteria | 2131 |
| 173 | Ga0495653_0787313 | 3300046463 | Bacteria | 572 |
| 174 | Ga0495605_0347133 | 3300046474 | Bacteria | 623 |
| 175 | Ga0495664_0000022 | 3300046477 | Bacteria | 134123 |
| 176 | Ga0495664_0340220 | 3300046477 | Bacteria | 904 |
| 177 | Ga0495584_0137369 | 3300046491 | Bacteria | 1241 |
| 178 | Ga0495585_0269797 | 3300046492 | Unclassified | 844 |
| 179 | Ga0495596_0083732 | 3300046500 | Bacteria | 1238 |
| 180 | Ga0495606_0000108 | 3300046507 | Bacteria | 140473 |
| 181 | Ga0495608_0000036 | 3300046511 | Bacteria | 129609 |
| 182 | Ga0495608_0319078 | 3300046511 | Bacteria | 960 |
| 183 | Ga0495616_0091455 | 3300046513 | Bacteria | 1440 |
| 184 | Ga0495628_0034129 | 3300046516 | Bacteria | 4096 |
| 185 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 186 | Ga0495637_0363069 | 3300046520 | Archaea | 506 |
| 187 | Ga0495644_0146190 | 3300046523 | Bacteria | 904 |
| 188 | Ga0495652_0098666 | 3300046529 | Bacteria | 2374 |
| 189 | Ga0495654_0264961 | 3300046530 | Bacteria | 711 |
| 190 | Ga0495665_0271595 | 3300046531 | Unclassified | 871 |
| 191 | Ga0495587_0250660 | 3300046536 | Bacteria | 995 |
| 192 | Ga0495635_0439666 | 3300046663 | Bacteria | 863 |
| 193 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 194 | Ga0495647_0002790 | 3300046681 | Bacteria | 5537 |
| 195 | Ga0495658_0032106 | 3300046683 | Bacteria | 2865 |
| 196 | Ga0495658_0350455 | 3300046683 | Bacteria | 938 |
| 197 | Ga0495589_0043419 | 3300046794 | Bacteria | 2238 |
| 198 | Ga0495600_0003292 | 3300046809 | Bacteria | 9474 |
| 199 | Ga0495604_0028724 | 3300047317 | Bacteria | 4425 |
| 200 | Ga0495674_0511362 | 3300047319 | Bacteria | 960 |
| 201 | Ga0495680_0811806 | 3300047322 | Bacteria | 610 |
| 202 | Ga0495675_0000515 | 3300047444 | Bacteria | 25086 |
| 203 | Ga0495684_0458962 | 3300047471 | Unclassified | 884 |
| 204 | Ga0495684_0631185 | 3300047471 | Bacteria | 719 |
| 205 | Ga0496102_0000040 | 3300048905 | Bacteria | 196737 |
| 206 | Ga0496103_0000067 | 3300048906 | Bacteria | 125906 |
| 207 | Ga0496104_0000070 | 3300048907 | Bacteria | 107129 |
| 208 | Ga0496105_0203798 | 3300048908 | Bacteria | 1614 |
| 209 | Ga0496108_0000355 | 3300048911 | Bacteria | 38685 |
| 210 | Ga0496108_0017846 | 3300048911 | Bacteria | 5804 |
| 211 | Ga0496108_1082198 | 3300048911 | Archaea | 682 |
| 212 | Ga0496109_0000400 | 3300048912 | Bacteria | 39194 |
| 213 | Ga0496109_0000903 | 3300048912 | Bacteria | 24701 |
| 214 | Ga0496109_0172674 | 3300048912 | Bacteria | 2028 |
| 215 | Ga0496110_0000011 | 3300048913 | Bacteria | 97293 |
| 216 | Ga0496110_0000653 | 3300048913 | Bacteria | 23661 |
| 217 | Ga0496110_0002236 | 3300048913 | Bacteria | 14470 |
| 218 | Ga0496110_0030839 | 3300048913 | Bacteria | 4624 |
| 219 | Ga0496110_1082366 | 3300048913 | Bacteria | 710 |
| 220 | Ga0496111_0000444 | 3300048914 | Bacteria | 21023 |
| 221 | Ga0496111_0004792 | 3300048914 | Bacteria | 8582 |
| 222 | Ga0496111_0006159 | 3300048914 | Bacteria | 7765 |
| 223 | Ga0496112_0268554 | 3300048915 | Bacteria | 1654 |
| 224 | Ga0496113_0000283 | 3300048916 | Bacteria | 23978 |
| 225 | Ga0501031_0665302 | 3300049568 | Bacteria | 669 |
| 226 | Ga0501036_0433462 | 3300049572 | Bacteria | 1096 |
| 227 | Ga0501036_0475512 | 3300049572 | Bacteria | 1040 |
| 228 | Ga0501037_0467697 | 3300049573 | Bacteria | 859 |
| 229 | Ga0501039_0510980 | 3300049575 | Bacteria | 943 |
| 230 | Ga0501040_0143896 | 3300049576 | Bacteria | 1680 |
| 231 | Ga0501046_0306477 | 3300049580 | Bacteria | 1159 |
| 232 | Ga0501068_0217617 | 3300049584 | Bacteria | 1213 |
| 233 | Ga0501069_0247426 | 3300049585 | Bacteria | 1040 |
| 234 | Ga0501071_0530513 | 3300049587 | Bacteria | 903 |
| 235 | Ga0501072_1047256 | 3300049588 | Bacteria | 635 |
| 236 | Ga0501076_0403471 | 3300049592 | Unclassified | 1124 |
| 237 | Ga0501076_1049230 | 3300049592 | Bacteria | 671 |
| 238 | Ga0501045_0401405 | 3300049824 | Bacteria | 1020 |
| 239 | nmdc:mga0yw44_356774_c1 | 3300050492 | Bacteria | 985 |
| 240 | nmdc:mga06z11_445255_c1 | 3300050494 | Bacteria | 782 |
| 241 | nmdc:mga0qj67_142777_c1 | 3300050509 | Bacteria | 1941 |
| 242 | nmdc:mga06r32_135500_c1 | 3300050510 | Bacteria | 2437 |
| 243 | nmdc:mga08y16_176756_c1 | 3300050511 | Bacteria | 2217 |
| 244 | nmdc:mga0n895_104589_c1 | 3300050512 | Bacteria | 2843 |
| 245 | Ga0495601_0014470 | 3300053077 | Bacteria | 4756 |
| 246 | Ga0495601_0129450 | 3300053077 | Bacteria | 1643 |
| 247 | Ga0495612_0001134 | 3300053078 | Bacteria | 10926 |
| 248 | Ga0495655_0010223 | 3300053083 | Bacteria | 1845 |
| 249 | Ga0495655_0055044 | 3300053083 | Unclassified | 1066 |
| 250 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 251 | Ga0495595_0320096 | 3300053084 | Bacteria | 781 |
| 252 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 253 | Ga0495619_0000277 | 3300053085 | Bacteria | 36725 |
| 254 | Ga0495619_0000776 | 3300053085 | Bacteria | 20883 |
| 255 | Ga0495619_0093316 | 3300053085 | Bacteria | 2040 |
| 256 | Ga0495619_0289784 | 3300053085 | Bacteria | 1134 |
| 257 | Ga0495619_0395873 | 3300053085 | Bacteria | 954 |
| 258 | Ga0495619_1179115 | 3300053085 | Unclassified | 508 |
| 259 | Ga0501084_0201401 | 3300054114 | Bacteria | 1680 |
| 260 | Ga0501082_0713810 | 3300060353 | Bacteria | 877 |
| 261 | Ga0530510_0098556 | 3300061734 | Bacteria | 2137 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0510980 | Ga0501039_0510980_489_872 | 121 |
| 2 | 3300005329 | Ga0070683_100638485 | Ga0070683_1006384852 | 123 |
| 3 | 3300020069 | Ga0197907_10034932 | Ga0197907_100349322 | 123 |
| 4 | 3300020070 | Ga0206356_10258878 | Ga0206356_102588784 | 123 |
| 5 | 3300020078 | Ga0206352_11286604 | Ga0206352_112866042 | 123 |
| 6 | 3300020081 | Ga0206354_10669761 | Ga0206354_106697612 | 123 |
| 7 | 3300020082 | Ga0206353_10298658 | Ga0206353_102986582 | 123 |
| 8 | 3300025944 | Ga0207661_10546403 | Ga0207661_105464032 | 123 |
| 9 | 3300031852 | Ga0307410_10057292 | Ga0307410_100572922 | 123 |
| 10 | 3300031903 | Ga0307407_10180731 | Ga0307407_101807312 | 123 |
| 11 | 3300031911 | Ga0307412_10346637 | Ga0307412_103466372 | 123 |
| 12 | 3300031995 | Ga0307409_100468741 | Ga0307409_1004687412 | 123 |
| 13 | 3300032002 | Ga0307416_100117860 | Ga0307416_1001178602 | 123 |
| 14 | 3300032126 | Ga0307415_100129610 | Ga0307415_1001296102 | 123 |
| 15 | 3300005365 | Ga0070688_100000285 | Ga0070688_10000028515 | 124 |
| 16 | 3300005466 | Ga0070685_10000159 | Ga0070685_1000015910 | 124 |
| 17 | 3300005578 | Ga0068854_100906776 | Ga0068854_1009067762 | 125 |
| 18 | 3300006852 | Ga0075433_10622216 | Ga0075433_106222162 | 125 |
| 19 | 3300006871 | Ga0075434_100794369 | Ga0075434_1007943691 | 125 |
| 20 | 3300025981 | Ga0207640_10365806 | Ga0207640_103658062 | 125 |
| 21 | 3300027907 | Ga0207428_10065837 | Ga0207428_100658372 | 125 |
| 22 | 3300035112 | Ga0373932_0047254 | Ga0373932_0047254_848_1252 | 125 |
| 23 | 3300005536 | Ga0070697_101317385 | Ga0070697_1013173851 | 126 |
| 24 | 3300005614 | Ga0068856_100223944 | Ga0068856_1002239442 | 126 |
| 25 | 3300006038 | Ga0075365_10240920 | Ga0075365_102409202 | 126 |
| 26 | 3300026078 | Ga0207702_10331452 | Ga0207702_103314522 | 126 |
| 27 | 3300047322 | Ga0495680_0811806 | Ga0495680_0811806_49_438 | 126 |
| 28 | 3300049584 | Ga0501068_0217617 | Ga0501068_0217617_506_907 | 126 |
| 29 | 3300050492 | nmdc:mga0yw44_356774_c1 | nmdc:mga0yw44_356774_c1_11_415 | 126 |
| 30 | 3300001991 | JGI24743J22301_10086453 | JGI24743J22301_100864532 | 127 |
| 31 | 3300005329 | Ga0070683_100034927 | Ga0070683_1000349272 | 127 |
| 32 | 3300005329 | Ga0070683_100118607 | Ga0070683_1001186072 | 127 |
| 33 | 3300005329 | Ga0070683_100122452 | Ga0070683_1001224523 | 127 |
| 34 | 3300005335 | Ga0070666_10120764 | Ga0070666_101207642 | 127 |
| 35 | 3300005337 | Ga0070682_100000171 | Ga0070682_10000017110 | 127 |
| 36 | 3300005338 | Ga0068868_100003306 | Ga0068868_1000033067 | 127 |
| 37 | 3300005344 | Ga0070661_100000035 | Ga0070661_10000003524 | 127 |
| 38 | 3300005347 | Ga0070668_100106891 | Ga0070668_1001068912 | 127 |
| 39 | 3300005347 | Ga0070668_100150615 | Ga0070668_1001506151 | 127 |
| 40 | 3300005354 | Ga0070675_100000377 | Ga0070675_1000003778 | 127 |
| 41 | 3300005364 | Ga0070673_100998967 | Ga0070673_1009989672 | 127 |
| 42 | 3300005436 | Ga0070713_100000380 | Ga0070713_1000003809 | 127 |
| 43 | 3300005456 | Ga0070678_100022681 | Ga0070678_1000226813 | 127 |
| 44 | 3300005535 | Ga0070684_100415345 | Ga0070684_1004153452 | 127 |
| 45 | 3300005539 | Ga0068853_100401489 | Ga0068853_1004014892 | 127 |
| 46 | 3300005543 | Ga0070672_100000006 | Ga0070672_100000006101 | 127 |
| 47 | 3300005548 | Ga0070665_100169526 | Ga0070665_1001695262 | 127 |
| 48 | 3300005564 | Ga0070664_100119123 | Ga0070664_1001191232 | 127 |
| 49 | 3300005577 | Ga0068857_101040074 | Ga0068857_1010400742 | 127 |
| 50 | 3300005578 | Ga0068854_100024981 | Ga0068854_1000249811 | 127 |
| 51 | 3300005614 | Ga0068856_100000925 | Ga0068856_10000092527 | 127 |
| 52 | 3300005614 | Ga0068856_100077098 | Ga0068856_1000770983 | 127 |
| 53 | 3300005616 | Ga0068852_100006635 | Ga0068852_1000066359 | 127 |
| 54 | 3300005937 | Ga0081455_10340927 | Ga0081455_103409272 | 127 |
| 55 | 3300005983 | Ga0081540_1284191 | Ga0081540_12841912 | 127 |
| 56 | 3300006175 | Ga0070712_100012842 | Ga0070712_1000128425 | 127 |
| 57 | 3300006881 | Ga0068865_100001059 | Ga0068865_1000010597 | 127 |
| 58 | 3300009011 | Ga0105251_10117569 | Ga0105251_101175691 | 127 |
| 59 | 3300009098 | Ga0105245_10020367 | Ga0105245_100203671 | 127 |
| 60 | 3300009101 | Ga0105247_10103375 | Ga0105247_101033753 | 127 |
| 61 | 3300009148 | Ga0105243_10053717 | Ga0105243_100537174 | 127 |
| 62 | 3300009174 | Ga0105241_10150816 | Ga0105241_101508162 | 127 |
| 63 | 3300009174 | Ga0105241_10308971 | Ga0105241_103089711 | 127 |
| 64 | 3300009177 | Ga0105248_10001622 | Ga0105248_100016222 | 127 |
| 65 | 3300010375 | Ga0105239_10110448 | Ga0105239_101104482 | 127 |
| 66 | 3300013104 | Ga0157370_10159693 | Ga0157370_101596933 | 127 |
| 67 | 3300013104 | Ga0157370_10272610 | Ga0157370_102726102 | 127 |
| 68 | 3300013297 | Ga0157378_10154364 | Ga0157378_101543642 | 127 |
| 69 | 3300013297 | Ga0157378_10211031 | Ga0157378_102110313 | 127 |
| 70 | 3300013308 | Ga0157375_10373080 | Ga0157375_103730803 | 127 |
| 71 | 3300014326 | Ga0157380_10000445 | Ga0157380_1000044524 | 127 |
| 72 | 3300025321 | Ga0207656_10001648 | Ga0207656_100016486 | 127 |
| 73 | 3300025900 | Ga0207710_10066194 | Ga0207710_100661943 | 127 |
| 74 | 3300025903 | Ga0207680_10151375 | Ga0207680_101513753 | 127 |
| 75 | 3300025911 | Ga0207654_10075293 | Ga0207654_100752932 | 127 |
| 76 | 3300025915 | Ga0207693_10019603 | Ga0207693_100196035 | 127 |
| 77 | 3300025920 | Ga0207649_10000028 | Ga0207649_10000028137 | 127 |
| 78 | 3300025925 | Ga0207650_10134382 | Ga0207650_101343822 | 127 |
| 79 | 3300025926 | Ga0207659_10000246 | Ga0207659_1000024622 | 127 |
| 80 | 3300025927 | Ga0207687_10004445 | Ga0207687_100044458 | 127 |
| 81 | 3300025928 | Ga0207700_10000033 | Ga0207700_1000003321 | 127 |
| 82 | 3300025929 | Ga0207664_10008515 | Ga0207664_100085152 | 127 |
| 83 | 3300025935 | Ga0207709_10105514 | Ga0207709_101055142 | 127 |
| 84 | 3300025938 | Ga0207704_10000103 | Ga0207704_1000010321 | 127 |
| 85 | 3300025940 | Ga0207691_10000025 | Ga0207691_1000002523 | 127 |
| 86 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006397 | 127 |
| 87 | 3300025944 | Ga0207661_10009459 | Ga0207661_100094594 | 127 |
| 88 | 3300025944 | Ga0207661_10023059 | Ga0207661_100230593 | 127 |
| 89 | 3300025945 | Ga0207679_10170227 | Ga0207679_101702272 | 127 |
| 90 | 3300025972 | Ga0207668_10097771 | Ga0207668_100977712 | 127 |
| 91 | 3300025981 | Ga0207640_10000551 | Ga0207640_1000055118 | 127 |
| 92 | 3300026023 | Ga0207677_10001888 | Ga0207677_100018887 | 127 |
| 93 | 3300026041 | Ga0207639_10167634 | Ga0207639_101676343 | 127 |
| 94 | 3300026041 | Ga0207639_10250615 | Ga0207639_102506152 | 127 |
| 95 | 3300026078 | Ga0207702_10000242 | Ga0207702_1000024237 | 127 |
| 96 | 3300026078 | Ga0207702_10022205 | Ga0207702_100222054 | 127 |
| 97 | 3300026116 | Ga0207674_12020221 | Ga0207674_120202211 | 127 |
| 98 | 3300026121 | Ga0207683_10031904 | Ga0207683_100319043 | 127 |
| 99 | 3300026142 | Ga0207698_10000414 | Ga0207698_1000041423 | 127 |
| 100 | 3300026142 | Ga0207698_10021589 | Ga0207698_100215892 | 127 |
| 101 | 3300028379 | Ga0268266_10001578 | Ga0268266_1000157823 | 127 |
| 102 | 3300028379 | Ga0268266_10118622 | Ga0268266_101186222 | 127 |
| 103 | 3300028379 | Ga0268266_10776017 | Ga0268266_107760172 | 127 |
| 104 | 3300031548 | Ga0307408_100055850 | Ga0307408_1000558502 | 127 |
| 105 | 3300031731 | Ga0307405_11717915 | Ga0307405_117179152 | 127 |
| 106 | 3300031824 | Ga0307413_10001669 | Ga0307413_100016698 | 127 |
| 107 | 3300031824 | Ga0307413_11089487 | Ga0307413_110894871 | 127 |
| 108 | 3300031852 | Ga0307410_10018720 | Ga0307410_100187202 | 127 |
| 109 | 3300031901 | Ga0307406_10041822 | Ga0307406_100418222 | 127 |
| 110 | 3300031995 | Ga0307409_100038352 | Ga0307409_1000383522 | 127 |
| 111 | 3300031995 | Ga0307409_100535452 | Ga0307409_1005354522 | 127 |
| 112 | 3300032002 | Ga0307416_100003565 | Ga0307416_1000035652 | 127 |
| 113 | 3300032005 | Ga0307411_10340719 | Ga0307411_103407191 | 127 |
| 114 | 3300032126 | Ga0307415_100000715 | Ga0307415_1000007158 | 127 |
| 115 | 3300032126 | Ga0307415_100003877 | Ga0307415_1000038779 | 127 |
| 116 | 3300032126 | Ga0307415_100980965 | Ga0307415_1009809652 | 127 |
| 117 | 3300035692 | Ga0373935_1500207 | Ga0373935_1500207_69_491 | 127 |
| 118 | 3300041503 | Ga0451847_0360256 | Ga0451847_0360256_35_454 | 127 |
| 119 | 3300044842 | Ga0466957_0005836 | Ga0466957_0005836_4681_5088 | 127 |
| 120 | 3300045976 | Ga0466967_0000017 | Ga0466967_0000017_8048_8464 | 127 |
| 121 | 3300046459 | Ga0495629_0000999 | Ga0495629_0000999_60_467 | 127 |
| 122 | 3300046461 | Ga0495641_0030362 | Ga0495641_0030362_358_768 | 127 |
| 123 | 3300046492 | Ga0495585_0269797 | Ga0495585_0269797_10_420 | 127 |
| 124 | 3300046507 | Ga0495606_0000108 | Ga0495606_0000108_131564_131971 | 127 |
| 125 | 3300046511 | Ga0495608_0000036 | Ga0495608_0000036_104663_105082 | 127 |
| 126 | 3300046517 | Ga0495630_0000012 | Ga0495630_0000012_216990_217400 | 127 |
| 127 | 3300046520 | Ga0495637_0363069 | Ga0495637_0363069_58_468 | 127 |
| 128 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_104663_105082 | 127 |
| 129 | 3300046681 | Ga0495647_0002790 | Ga0495647_0002790_2336_2746 | 127 |
| 130 | 3300046683 | Ga0495658_0032106 | Ga0495658_0032106_628_1044 | 127 |
| 131 | 3300046794 | Ga0495589_0043419 | Ga0495589_0043419_1539_1961 | 127 |
| 132 | 3300046809 | Ga0495600_0003292 | Ga0495600_0003292_208_627 | 127 |
| 133 | 3300047444 | Ga0495675_0000515 | Ga0495675_0000515_24551_24970 | 127 |
| 134 | 3300048911 | Ga0496108_0000355 | Ga0496108_0000355_23743_24150 | 127 |
| 135 | 3300048911 | Ga0496108_0017846 | Ga0496108_0017846_5284_5691 | 127 |
| 136 | 3300048911 | Ga0496108_1082198 | Ga0496108_1082198_68_487 | 127 |
| 137 | 3300048912 | Ga0496109_0000400 | Ga0496109_0000400_15012_15419 | 127 |
| 138 | 3300048912 | Ga0496109_0000903 | Ga0496109_0000903_23623_24030 | 127 |
| 139 | 3300048913 | Ga0496110_0000011 | Ga0496110_0000011_23376_23798 | 127 |
| 140 | 3300048913 | Ga0496110_1082366 | Ga0496110_1082366_99_506 | 127 |
| 141 | 3300048914 | Ga0496111_0006159 | Ga0496111_0006159_70_492 | 127 |
| 142 | 3300048915 | Ga0496112_0268554 | Ga0496112_0268554_104_532 | 127 |
| 143 | 3300048916 | Ga0496113_0000283 | Ga0496113_0000283_361_789 | 127 |
| 144 | 3300049568 | Ga0501031_0665302 | Ga0501031_0665302_180_593 | 127 |
| 145 | 3300049572 | Ga0501036_0433462 | Ga0501036_0433462_521_934 | 127 |
| 146 | 3300049573 | Ga0501037_0467697 | Ga0501037_0467697_50_448 | 127 |
| 147 | 3300049576 | Ga0501040_0143896 | Ga0501040_0143896_278_691 | 127 |
| 148 | 3300049580 | Ga0501046_0306477 | Ga0501046_0306477_265_678 | 127 |
| 149 | 3300049587 | Ga0501071_0530513 | Ga0501071_0530513_271_684 | 127 |
| 150 | 3300049588 | Ga0501072_1047256 | Ga0501072_1047256_147_560 | 127 |
| 151 | 3300049592 | Ga0501076_1049230 | Ga0501076_1049230_204_617 | 127 |
| 152 | 3300049824 | Ga0501045_0401405 | Ga0501045_0401405_204_617 | 127 |
| 153 | 3300053083 | Ga0495655_0010223 | Ga0495655_0010223_1232_1657 | 127 |
| 154 | 3300053083 | Ga0495655_0055044 | Ga0495655_0055044_281_703 | 127 |
| 155 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_340560_340979 | 127 |
| 156 | 3300053085 | Ga0495619_0000277 | Ga0495619_0000277_25009_25422 | 127 |
| 157 | 3300053085 | Ga0495619_0000776 | Ga0495619_0000776_8762_9181 | 127 |
| 158 | 3300054114 | Ga0501084_0201401 | Ga0501084_0201401_410_823 | 127 |
| 159 | 3300060353 | Ga0501082_0713810 | Ga0501082_0713810_423_836 | 127 |
| 160 | 3300061734 | Ga0530510_0098556 | Ga0530510_0098556_723_1136 | 127 |
| 161 | 3300003373 | JGI25407J50210_10004026 | JGI25407J50210_100040263 | 128 |
| 162 | 3300003373 | JGI25407J50210_10104477 | JGI25407J50210_101044771 | 128 |
| 163 | 3300005329 | Ga0070683_100062335 | Ga0070683_1000623352 | 128 |
| 164 | 3300005337 | Ga0070682_100628999 | Ga0070682_1006289991 | 128 |
| 165 | 3300005364 | Ga0070673_100000474 | Ga0070673_1000004746 | 128 |
| 166 | 3300005366 | Ga0070659_100537339 | Ga0070659_1005373392 | 128 |
| 167 | 3300005366 | Ga0070659_101621483 | Ga0070659_1016214831 | 128 |
| 168 | 3300005535 | Ga0070684_100711447 | Ga0070684_1007114472 | 128 |
| 169 | 3300005937 | Ga0081455_10017592 | Ga0081455_100175929 | 128 |
| 170 | 3300005981 | Ga0081538_10000691 | Ga0081538_100006914 | 128 |
| 171 | 3300005981 | Ga0081538_10000894 | Ga0081538_1000089411 | 128 |
| 172 | 3300005981 | Ga0081538_10009157 | Ga0081538_1000915711 | 128 |
| 173 | 3300005983 | Ga0081540_1042483 | Ga0081540_10424833 | 128 |
| 174 | 3300006048 | Ga0075363_100520166 | Ga0075363_1005201661 | 128 |
| 175 | 3300006175 | Ga0070712_101621756 | Ga0070712_1016217561 | 128 |
| 176 | 3300006178 | Ga0075367_10554581 | Ga0075367_105545811 | 128 |
| 177 | 3300009094 | Ga0111539_10118468 | Ga0111539_101184684 | 128 |
| 178 | 3300014325 | Ga0163163_11796446 | Ga0163163_117964462 | 128 |
| 179 | 3300020070 | Ga0206356_10394249 | Ga0206356_103942492 | 128 |
| 180 | 3300020075 | Ga0206349_1670028 | Ga0206349_16700284 | 128 |
| 181 | 3300025915 | Ga0207693_11222066 | Ga0207693_112220661 | 128 |
| 182 | 3300025932 | Ga0207690_11338343 | Ga0207690_113383431 | 128 |
| 183 | 3300025944 | Ga0207661_10030514 | Ga0207661_100305144 | 128 |
| 184 | 3300025945 | Ga0207679_10622914 | Ga0207679_106229142 | 128 |
| 185 | 3300025960 | Ga0207651_10000664 | Ga0207651_100006646 | 128 |
| 186 | 3300031251 | Ga0265327_10034253 | Ga0265327_100342533 | 128 |
| 187 | 3300032126 | Ga0307415_100068677 | Ga0307415_1000686773 | 128 |
| 188 | 3300034820 | Ga0373959_0085333 | Ga0373959_0085333_30_455 | 128 |
| 189 | 3300035114 | Ga0373939_0043293 | Ga0373939_0043293_96_521 | 128 |
| 190 | 3300035117 | Ga0373953_0277012 | Ga0373953_0277012_268_675 | 128 |
| 191 | 3300035121 | Ga0373960_0031242 | Ga0373960_0031242_223_648 | 128 |
| 192 | 3300035691 | Ga0373931_0335039 | Ga0373931_0335039_361_786 | 128 |
| 193 | 3300035724 | Ga0373933_0250790 | Ga0373933_0250790_306_713 | 128 |
| 194 | 3300036401 | Ga0373937_0007200 | Ga0373937_0007200_4604_5011 | 128 |
| 195 | 3300042126 | Ga0450888_006547 | Ga0450888_006547_105_521 | 128 |
| 196 | 3300042136 | Ga0450900_065906 | Ga0450900_065906_83_499 | 128 |
| 197 | 3300042461 | Ga0439460_0054825 | Ga0439460_0054825_109_525 | 128 |
| 198 | 3300046454 | Ga0495592_0374079 | Ga0495592_0374079_325_753 | 128 |
| 199 | 3300046455 | Ga0495603_0000593 | Ga0495603_0000593_3556_3963 | 128 |
| 200 | 3300046463 | Ga0495653_0787313 | Ga0495653_0787313_108_515 | 128 |
| 201 | 3300046474 | Ga0495605_0347133 | Ga0495605_0347133_47_475 | 128 |
| 202 | 3300046477 | Ga0495664_0000022 | Ga0495664_0000022_23678_24106 | 128 |
| 203 | 3300046491 | Ga0495584_0137369 | Ga0495584_0137369_504_920 | 128 |
| 204 | 3300046500 | Ga0495596_0083732 | Ga0495596_0083732_106_522 | 128 |
| 205 | 3300046513 | Ga0495616_0091455 | Ga0495616_0091455_25_450 | 128 |
| 206 | 3300046523 | Ga0495644_0146190 | Ga0495644_0146190_350_781 | 128 |
| 207 | 3300046529 | Ga0495652_0098666 | Ga0495652_0098666_829_1257 | 128 |
| 208 | 3300046530 | Ga0495654_0264961 | Ga0495654_0264961_150_566 | 128 |
| 209 | 3300046531 | Ga0495665_0271595 | Ga0495665_0271595_400_825 | 128 |
| 210 | 3300046536 | Ga0495587_0250660 | Ga0495587_0250660_237_644 | 128 |
| 211 | 3300047317 | Ga0495604_0028724 | Ga0495604_0028724_3315_3722 | 128 |
| 212 | 3300047319 | Ga0495674_0511362 | Ga0495674_0511362_331_738 | 128 |
| 213 | 3300047471 | Ga0495684_0458962 | Ga0495684_0458962_86_490 | 128 |
| 214 | 3300047471 | Ga0495684_0631185 | Ga0495684_0631185_208_636 | 128 |
| 215 | 3300048905 | Ga0496102_0000040 | Ga0496102_0000040_150478_150906 | 128 |
| 216 | 3300048906 | Ga0496103_0000067 | Ga0496103_0000067_104368_104796 | 128 |
| 217 | 3300048907 | Ga0496104_0000070 | Ga0496104_0000070_18738_19169 | 128 |
| 218 | 3300048908 | Ga0496105_0203798 | Ga0496105_0203798_168_599 | 128 |
| 219 | 3300048912 | Ga0496109_0172674 | Ga0496109_0172674_306_713 | 128 |
| 220 | 3300048913 | Ga0496110_0000653 | Ga0496110_0000653_19517_19948 | 128 |
| 221 | 3300048913 | Ga0496110_0002236 | Ga0496110_0002236_6205_6612 | 128 |
| 222 | 3300048914 | Ga0496111_0000444 | Ga0496111_0000444_960_1391 | 128 |
| 223 | 3300048914 | Ga0496111_0004792 | Ga0496111_0004792_853_1260 | 128 |
| 224 | 3300049572 | Ga0501036_0475512 | Ga0501036_0475512_512_916 | 128 |
| 225 | 3300049585 | Ga0501069_0247426 | Ga0501069_0247426_332_754 | 128 |
| 226 | 3300049592 | Ga0501076_0403471 | Ga0501076_0403471_159_554 | 128 |
| 227 | 3300050494 | nmdc:mga06z11_445255_c1 | nmdc:mga06z11_445255_c1_217_639 | 128 |
| 228 | 3300050509 | nmdc:mga0qj67_142777_c1 | nmdc:mga0qj67_142777_c1_1282_1695 | 128 |
| 229 | 3300050511 | nmdc:mga08y16_176756_c1 | nmdc:mga08y16_176756_c1_1240_1665 | 128 |
| 230 | 3300050512 | nmdc:mga0n895_104589_c1 | nmdc:mga0n895_104589_c1_2395_2820 | 128 |
| 231 | 3300053077 | Ga0495601_0014470 | Ga0495601_0014470_1003_1431 | 128 |
| 232 | 3300031995 | Ga0307409_100322874 | Ga0307409_1003228742 | 129 |
| 233 | 3300046462 | Ga0495651_0102313 | Ga0495651_0102313_980_1411 | 129 |
| 234 | 3300046477 | Ga0495664_0340220 | Ga0495664_0340220_386_817 | 129 |
| 235 | 3300046511 | Ga0495608_0319078 | Ga0495608_0319078_462_893 | 129 |
| 236 | 3300046516 | Ga0495628_0034129 | Ga0495628_0034129_1599_2030 | 129 |
| 237 | 3300046663 | Ga0495635_0439666 | Ga0495635_0439666_389_820 | 129 |
| 238 | 3300046683 | Ga0495658_0350455 | Ga0495658_0350455_350_790 | 129 |
| 239 | 3300053077 | Ga0495601_0129450 | Ga0495601_0129450_399_830 | 129 |
| 240 | 3300053078 | Ga0495612_0001134 | Ga0495612_0001134_7966_8397 | 129 |
| 241 | 3300053085 | Ga0495619_0289784 | Ga0495619_0289784_68_508 | 129 |
| 242 | 3300053085 | Ga0495619_0395873 | Ga0495619_0395873_421_852 | 129 |
| 243 | 3300013308 | Ga0157375_11613584 | Ga0157375_116135842 | 130 |
| 244 | 3300025972 | Ga0207668_10448440 | Ga0207668_104484402 | 130 |
| 245 | 3300026035 | Ga0207703_10000088 | Ga0207703_1000008876 | 130 |
| 246 | 3300048913 | Ga0496110_0030839 | Ga0496110_0030839_199_633 | 130 |
| 247 | 3300050510 | nmdc:mga06r32_135500_c1 | nmdc:mga06r32_135500_c1_14_448 | 130 |
| 248 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_282440_282874 | 130 |
| 249 | 3300000549 | LJQas_1009188 | LJQas_10091882 | 134 |
| 250 | 3300005435 | Ga0070714_100192236 | Ga0070714_1001922363 | 134 |
| 251 | 3300005435 | Ga0070714_100777686 | Ga0070714_1007776862 | 134 |
| 252 | 3300005439 | Ga0070711_100073303 | Ga0070711_1000733033 | 134 |
| 253 | 3300025916 | Ga0207663_10000487 | Ga0207663_1000048716 | 134 |
| 254 | 3300025929 | Ga0207664_10237872 | Ga0207664_102378722 | 134 |
| 255 | 3300036401 | Ga0373937_0762918 | Ga0373937_0762918_22_498 | 134 |
| 256 | 3300045049 | Ga0466959_0188528 | Ga0466959_0188528_764_1192 | 134 |
| 257 | 3300045836 | Ga0466958_0345772 | Ga0466958_0345772_237_683 | 134 |
| 258 | 3300045836 | Ga0466958_0563766 | Ga0466958_0563766_84_527 | 134 |
| 259 | 3300053084 | Ga0495595_0320096 | Ga0495595_0320096_256_714 | 134 |
| 260 | 3300053085 | Ga0495619_0093316 | Ga0495619_0093316_1144_1602 | 134 |
| 261 | 3300053085 | Ga0495619_1179115 | Ga0495619_1179115_51_497 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ozj-assembly2.cif.gz_B-3 | crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution | 0.9548 | 35 | 109 |
| 1o4t-assembly1.cif.gz_B | crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution | 0.9536 | 38 | 111 |
| 6o2d-assembly1.cif.gz_B | schizosaccharomyces pombe cnp3 cupin domain | 0.9446 | 35 | 111 |
| 8ch4-assembly1.cif.gz_C | crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. | 0.9383 | 38 | 110 |
| 7zyb-assembly1.cif.gz_A | bekdgf with ca | 0.9298 | 34 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PPZ7_421_512_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9585 | 35 | 111 | 2.60.120.10 |
| 1o4tB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9536 | 38 | 111 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9503 | 35 | 112 | 2.60.120.10 |
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.95 | 35 | 112 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9437 | 35 | 112 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522LBI6-F1-model_v4 | Cupin domain-containing protein | 0.9753 | 38 | 111 |
|
| AF-A0A3A4JPZ0-F1-model_v4 | Cupin domain-containing protein | 0.975 | 38 | 111 |
|
| AF-A0A150SF67-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9639 | 36 | 111 |
|
| AF-A0A6A6K265-F1-model_v4 | Mif2/CENP-C cupin domain-containing protein | 0.9637 | 36 | 111 |
GO:0000776
GO:0005634 GO:0019237 GO:0051315 GO:0051382 GO:0051455 |
| AF-A0A7V1H515-F1-model_v4 | Cupin domain-containing protein | 0.9623 | 35 | 111 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar