F370229

General Info

Members Datasets Scaffolds Average Seq Length
261 186 261 138

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10340927|Ga0081455_103409272
Length 142
Sequence MANEVKDVVEGDGYAVANVDGLADGPGFRKVRRALGVTAFGVNAIELPAGYETGRHFHEEQEELYFLHRGKIEITLDDDTFLLGPGGLARVDAATVRKIKNVGDEPAVYLVTGGKDGYVGRDGRLPEGETSRVGETAGEQQQ

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
111 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
112 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 2.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 7.66
Rhizosphere 90.04
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1009188 3300000549 Bacteria 1193
2 JGI24743J22301_10086453 3300001991 Bacteria 665
3 JGI25407J50210_10004026 3300003373 Bacteria 3564
4 JGI25407J50210_10104477 3300003373 Bacteria 699
5 Ga0070683_100034927 3300005329 Bacteria 4595
6 Ga0070683_100062335 3300005329 Bacteria 3467
7 Ga0070683_100118607 3300005329 Bacteria 2499
8 Ga0070683_100122452 3300005329 Bacteria 2457
9 Ga0070683_100638485 3300005329 Unclassified 1019
10 Ga0070666_10120764 3300005335 Bacteria 1817
11 Ga0070682_100000171 3300005337 Bacteria 48470
12 Ga0070682_100628999 3300005337 Bacteria 851
13 Ga0068868_100003306 3300005338 Bacteria 11219
14 Ga0070661_100000035 3300005344 Bacteria 111363
15 Ga0070668_100106891 3300005347 Bacteria 2224
16 Ga0070668_100150615 3300005347 Bacteria 1881
17 Ga0070675_100000377 3300005354 Bacteria 30146
18 Ga0070673_100000474 3300005364 Bacteria 21373
19 Ga0070673_100998967 3300005364 Unclassified 779
20 Ga0070688_100000285 3300005365 Bacteria 26015
21 Ga0070659_100537339 3300005366 Bacteria 1000
22 Ga0070659_101621483 3300005366 Bacteria 578
23 Ga0070714_100192236 3300005435 Bacteria 1863
24 Ga0070714_100777686 3300005435 Bacteria 926
25 Ga0070713_100000380 3300005436 Bacteria 28361
26 Ga0070711_100073303 3300005439 Bacteria 2419
27 Ga0070678_100022681 3300005456 Bacteria 4166
28 Ga0070685_10000159 3300005466 Bacteria 43951
29 Ga0070684_100415345 3300005535 Bacteria 1242
30 Ga0070684_100711447 3300005535 Bacteria 937
31 Ga0070697_101317385 3300005536 Unclassified 644
32 Ga0068853_100401489 3300005539 Bacteria 1283
33 Ga0070672_100000006 3300005543 Bacteria 117060
34 Ga0070665_100169526 3300005548 Bacteria 2184
35 Ga0070664_100119123 3300005564 Bacteria 2310
36 Ga0068857_101040074 3300005577 Unclassified 789
37 Ga0068854_100024981 3300005578 Bacteria 4098
38 Ga0068854_100906776 3300005578 Unclassified 775
39 Ga0068856_100000925 3300005614 Bacteria 31449
40 Ga0068856_100077098 3300005614 Bacteria 3302
41 Ga0068856_100223944 3300005614 Bacteria 1896
42 Ga0068852_100006635 3300005616 Bacteria 8385
43 Ga0081455_10017592 3300005937 Bacteria 6843
44 Ga0081455_10340927 3300005937 Unclassified 1061
45 Ga0081538_10000691 3300005981 Bacteria 37035
46 Ga0081538_10000894 3300005981 Bacteria 32276
47 Ga0081538_10009157 3300005981 Bacteria 8304
48 Ga0081540_1042483 3300005983 Bacteria 2345
49 Ga0081540_1284191 3300005983 Bacteria 570
50 Ga0075365_10240920 3300006038 Bacteria 1270
51 Ga0075363_100520166 3300006048 Bacteria 708
52 Ga0070712_100012842 3300006175 Bacteria 5333
53 Ga0070712_101621756 3300006175 Unclassified 566
54 Ga0075367_10554581 3300006178 Bacteria 730
55 Ga0075433_10622216 3300006852 Bacteria 947
56 Ga0075434_100794369 3300006871 Bacteria 963
57 Ga0068865_100001059 3300006881 Bacteria 15817
58 Ga0105251_10117569 3300009011 Unclassified 1208
59 Ga0111539_10118468 3300009094 Bacteria 3103
60 Ga0105245_10020367 3300009098 Bacteria 5817
61 Ga0105247_10103375 3300009101 Bacteria 1824
62 Ga0105243_10053717 3300009148 Bacteria 3196
63 Ga0105241_10150816 3300009174 Bacteria 1902
64 Ga0105241_10308971 3300009174 Unclassified 1359
65 Ga0105248_10001622 3300009177 Bacteria 24979
66 Ga0105239_10110448 3300010375 Bacteria 3048
67 Ga0157370_10159693 3300013104 Bacteria 2098
68 Ga0157370_10272610 3300013104 Unclassified 1563
69 Ga0157378_10154364 3300013297 Bacteria 2141
70 Ga0157378_10211031 3300013297 Bacteria 1841
71 Ga0157375_10373080 3300013308 Bacteria 1593
72 Ga0157375_11613584 3300013308 Bacteria 767
73 Ga0163163_11796446 3300014325 Bacteria 673
74 Ga0157380_10000445 3300014326 Bacteria 25326
75 Ga0197907_10034932 3300020069 Unclassified 1116
76 Ga0206356_10258878 3300020070 Bacteria 3533
77 Ga0206356_10394249 3300020070 Bacteria 1120
78 Ga0206349_1670028 3300020075 Unclassified 1646
79 Ga0206352_11286604 3300020078 Unclassified 1551
80 Ga0206354_10669761 3300020081 Unclassified 1147
81 Ga0206353_10298658 3300020082 Unclassified 1117
82 Ga0207656_10001648 3300025321 Bacteria 7432
83 Ga0207710_10066194 3300025900 Bacteria 1648
84 Ga0207680_10151375 3300025903 Bacteria 1547
85 Ga0207654_10075293 3300025911 Bacteria 2017
86 Ga0207693_10019603 3300025915 Bacteria 5379
87 Ga0207693_11222066 3300025915 Unclassified 566
88 Ga0207663_10000487 3300025916 Bacteria 17285
89 Ga0207649_10000028 3300025920 Bacteria 161482
90 Ga0207650_10134382 3300025925 Bacteria 1939
91 Ga0207659_10000246 3300025926 Bacteria 32971
92 Ga0207687_10004445 3300025927 Bacteria 9352
93 Ga0207700_10000033 3300025928 Bacteria 123113
94 Ga0207664_10008515 3300025929 Bacteria 7161
95 Ga0207664_10237872 3300025929 Bacteria 1585
96 Ga0207690_11338343 3300025932 Bacteria 599
97 Ga0207709_10105514 3300025935 Bacteria 1872
98 Ga0207704_10000103 3300025938 Bacteria 47628
99 Ga0207691_10000025 3300025940 Bacteria 129424
100 Ga0207711_10000006 3300025941 Bacteria 792692
101 Ga0207661_10009459 3300025944 Bacteria 6990
102 Ga0207661_10023059 3300025944 Bacteria 4699
103 Ga0207661_10030514 3300025944 Bacteria 4154
104 Ga0207661_10546403 3300025944 Unclassified 1061
105 Ga0207679_10170227 3300025945 Bacteria 1792
106 Ga0207679_10622914 3300025945 Bacteria 974
107 Ga0207651_10000664 3300025960 Bacteria 14678
108 Ga0207668_10097771 3300025972 Bacteria 2173
109 Ga0207668_10448440 3300025972 Bacteria 1101
110 Ga0207640_10000551 3300025981 Bacteria 22450
111 Ga0207640_10365806 3300025981 Bacteria 1164
112 Ga0207677_10001888 3300026023 Bacteria 11062
113 Ga0207703_10000088 3300026035 Bacteria 106080
114 Ga0207639_10167634 3300026041 Bacteria 1857
115 Ga0207639_10250615 3300026041 Bacteria 1544
116 Ga0207702_10000242 3300026078 Bacteria 63808
117 Ga0207702_10022205 3300026078 Bacteria 5260
118 Ga0207702_10331452 3300026078 Bacteria 1452
119 Ga0207674_12020221 3300026116 Unclassified 541
120 Ga0207683_10031904 3300026121 Bacteria 4574
121 Ga0207698_10000414 3300026142 Bacteria 24644
122 Ga0207698_10021589 3300026142 Bacteria 4457
123 Ga0207428_10065837 3300027907 Bacteria 2857
124 Ga0268266_10001578 3300028379 Bacteria 26646
125 Ga0268266_10118622 3300028379 Bacteria 2352
126 Ga0268266_10776017 3300028379 Bacteria 925
127 Ga0265327_10034253 3300031251 Bacteria 2821
128 Ga0307408_100055850 3300031548 Bacteria 2861
129 Ga0307405_11717915 3300031731 Bacteria 556
130 Ga0307413_10001669 3300031824 Bacteria 8622
131 Ga0307413_11089487 3300031824 Unclassified 689
132 Ga0307410_10018720 3300031852 Bacteria 4191
133 Ga0307410_10057292 3300031852 Bacteria 2653
134 Ga0307406_10041822 3300031901 Bacteria 2858
135 Ga0307407_10180731 3300031903 Bacteria 1398
136 Ga0307412_10346637 3300031911 Unclassified 1191
137 Ga0307409_100038352 3300031995 Bacteria 3543
138 Ga0307409_100322874 3300031995 Bacteria 1446
139 Ga0307409_100468741 3300031995 Bacteria 1219
140 Ga0307409_100535452 3300031995 Unclassified 1147
141 Ga0307416_100003565 3300032002 Bacteria 9183
142 Ga0307416_100117860 3300032002 Bacteria 2358
143 Ga0307411_10340719 3300032005 Bacteria 1218
144 Ga0307415_100000715 3300032126 Bacteria 14842
145 Ga0307415_100003877 3300032126 Bacteria 7679
146 Ga0307415_100068677 3300032126 Bacteria 2481
147 Ga0307415_100129610 3300032126 Bacteria 1907
148 Ga0307415_100980965 3300032126 Bacteria 784
149 Ga0373959_0085333 3300034820 Bacteria 733
150 Ga0373932_0047254 3300035112 Bacteria 1265
151 Ga0373939_0043293 3300035114 Bacteria 1365
152 Ga0373953_0277012 3300035117 Bacteria 731
153 Ga0373960_0031242 3300035121 Bacteria 1488
154 Ga0373931_0335039 3300035691 Bacteria 943
155 Ga0373935_1500207 3300035692 Bacteria 505
156 Ga0373933_0250790 3300035724 Bacteria 1140
157 Ga0373937_0007200 3300036401 Bacteria 9627
158 Ga0373937_0762918 3300036401 Bacteria 915
159 Ga0451847_0360256 3300041503 Archaea 684
160 Ga0450888_006547 3300042126 Bacteria 1269
161 Ga0450900_065906 3300042136 Bacteria 570
162 Ga0439460_0054825 3300042461 Bacteria 1204
163 Ga0466957_0005836 3300044842 Bacteria 6932
164 Ga0466959_0188528 3300045049 Bacteria 1440
165 Ga0466958_0345772 3300045836 Unclassified 957
166 Ga0466958_0563766 3300045836 Bacteria 740
167 Ga0466967_0000017 3300045976 Bacteria 89904
168 Ga0495592_0374079 3300046454 Bacteria 908
169 Ga0495603_0000593 3300046455 Bacteria 20342
170 Ga0495629_0000999 3300046459 Bacteria 22693
171 Ga0495641_0030362 3300046461 Bacteria 2593
172 Ga0495651_0102313 3300046462 Bacteria 2131
173 Ga0495653_0787313 3300046463 Bacteria 572
174 Ga0495605_0347133 3300046474 Bacteria 623
175 Ga0495664_0000022 3300046477 Bacteria 134123
176 Ga0495664_0340220 3300046477 Bacteria 904
177 Ga0495584_0137369 3300046491 Bacteria 1241
178 Ga0495585_0269797 3300046492 Unclassified 844
179 Ga0495596_0083732 3300046500 Bacteria 1238
180 Ga0495606_0000108 3300046507 Bacteria 140473
181 Ga0495608_0000036 3300046511 Bacteria 129609
182 Ga0495608_0319078 3300046511 Bacteria 960
183 Ga0495616_0091455 3300046513 Bacteria 1440
184 Ga0495628_0034129 3300046516 Bacteria 4096
185 Ga0495630_0000012 3300046517 Bacteria 223330
186 Ga0495637_0363069 3300046520 Archaea 506
187 Ga0495644_0146190 3300046523 Bacteria 904
188 Ga0495652_0098666 3300046529 Bacteria 2374
189 Ga0495654_0264961 3300046530 Bacteria 711
190 Ga0495665_0271595 3300046531 Unclassified 871
191 Ga0495587_0250660 3300046536 Bacteria 995
192 Ga0495635_0439666 3300046663 Bacteria 863
193 Ga0495657_0000001 3300046675 Bacteria 445641
194 Ga0495647_0002790 3300046681 Bacteria 5537
195 Ga0495658_0032106 3300046683 Bacteria 2865
196 Ga0495658_0350455 3300046683 Bacteria 938
197 Ga0495589_0043419 3300046794 Bacteria 2238
198 Ga0495600_0003292 3300046809 Bacteria 9474
199 Ga0495604_0028724 3300047317 Bacteria 4425
200 Ga0495674_0511362 3300047319 Bacteria 960
201 Ga0495680_0811806 3300047322 Bacteria 610
202 Ga0495675_0000515 3300047444 Bacteria 25086
203 Ga0495684_0458962 3300047471 Unclassified 884
204 Ga0495684_0631185 3300047471 Bacteria 719
205 Ga0496102_0000040 3300048905 Bacteria 196737
206 Ga0496103_0000067 3300048906 Bacteria 125906
207 Ga0496104_0000070 3300048907 Bacteria 107129
208 Ga0496105_0203798 3300048908 Bacteria 1614
209 Ga0496108_0000355 3300048911 Bacteria 38685
210 Ga0496108_0017846 3300048911 Bacteria 5804
211 Ga0496108_1082198 3300048911 Archaea 682
212 Ga0496109_0000400 3300048912 Bacteria 39194
213 Ga0496109_0000903 3300048912 Bacteria 24701
214 Ga0496109_0172674 3300048912 Bacteria 2028
215 Ga0496110_0000011 3300048913 Bacteria 97293
216 Ga0496110_0000653 3300048913 Bacteria 23661
217 Ga0496110_0002236 3300048913 Bacteria 14470
218 Ga0496110_0030839 3300048913 Bacteria 4624
219 Ga0496110_1082366 3300048913 Bacteria 710
220 Ga0496111_0000444 3300048914 Bacteria 21023
221 Ga0496111_0004792 3300048914 Bacteria 8582
222 Ga0496111_0006159 3300048914 Bacteria 7765
223 Ga0496112_0268554 3300048915 Bacteria 1654
224 Ga0496113_0000283 3300048916 Bacteria 23978
225 Ga0501031_0665302 3300049568 Bacteria 669
226 Ga0501036_0433462 3300049572 Bacteria 1096
227 Ga0501036_0475512 3300049572 Bacteria 1040
228 Ga0501037_0467697 3300049573 Bacteria 859
229 Ga0501039_0510980 3300049575 Bacteria 943
230 Ga0501040_0143896 3300049576 Bacteria 1680
231 Ga0501046_0306477 3300049580 Bacteria 1159
232 Ga0501068_0217617 3300049584 Bacteria 1213
233 Ga0501069_0247426 3300049585 Bacteria 1040
234 Ga0501071_0530513 3300049587 Bacteria 903
235 Ga0501072_1047256 3300049588 Bacteria 635
236 Ga0501076_0403471 3300049592 Unclassified 1124
237 Ga0501076_1049230 3300049592 Bacteria 671
238 Ga0501045_0401405 3300049824 Bacteria 1020
239 nmdc:mga0yw44_356774_c1 3300050492 Bacteria 985
240 nmdc:mga06z11_445255_c1 3300050494 Bacteria 782
241 nmdc:mga0qj67_142777_c1 3300050509 Bacteria 1941
242 nmdc:mga06r32_135500_c1 3300050510 Bacteria 2437
243 nmdc:mga08y16_176756_c1 3300050511 Bacteria 2217
244 nmdc:mga0n895_104589_c1 3300050512 Bacteria 2843
245 Ga0495601_0014470 3300053077 Bacteria 4756
246 Ga0495601_0129450 3300053077 Bacteria 1643
247 Ga0495612_0001134 3300053078 Bacteria 10926
248 Ga0495655_0010223 3300053083 Bacteria 1845
249 Ga0495655_0055044 3300053083 Unclassified 1066
250 Ga0495595_0000002 3300053084 Bacteria 445641
251 Ga0495595_0320096 3300053084 Bacteria 781
252 Ga0495619_0000008 3300053085 Bacteria 305999
253 Ga0495619_0000277 3300053085 Bacteria 36725
254 Ga0495619_0000776 3300053085 Bacteria 20883
255 Ga0495619_0093316 3300053085 Bacteria 2040
256 Ga0495619_0289784 3300053085 Bacteria 1134
257 Ga0495619_0395873 3300053085 Bacteria 954
258 Ga0495619_1179115 3300053085 Unclassified 508
259 Ga0501084_0201401 3300054114 Bacteria 1680
260 Ga0501082_0713810 3300060353 Bacteria 877
261 Ga0530510_0098556 3300061734 Bacteria 2137

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0510980 Ga0501039_0510980_489_872 121
2 3300005329 Ga0070683_100638485 Ga0070683_1006384852 123
3 3300020069 Ga0197907_10034932 Ga0197907_100349322 123
4 3300020070 Ga0206356_10258878 Ga0206356_102588784 123
5 3300020078 Ga0206352_11286604 Ga0206352_112866042 123
6 3300020081 Ga0206354_10669761 Ga0206354_106697612 123
7 3300020082 Ga0206353_10298658 Ga0206353_102986582 123
8 3300025944 Ga0207661_10546403 Ga0207661_105464032 123
9 3300031852 Ga0307410_10057292 Ga0307410_100572922 123
10 3300031903 Ga0307407_10180731 Ga0307407_101807312 123
11 3300031911 Ga0307412_10346637 Ga0307412_103466372 123
12 3300031995 Ga0307409_100468741 Ga0307409_1004687412 123
13 3300032002 Ga0307416_100117860 Ga0307416_1001178602 123
14 3300032126 Ga0307415_100129610 Ga0307415_1001296102 123
15 3300005365 Ga0070688_100000285 Ga0070688_10000028515 124
16 3300005466 Ga0070685_10000159 Ga0070685_1000015910 124
17 3300005578 Ga0068854_100906776 Ga0068854_1009067762 125
18 3300006852 Ga0075433_10622216 Ga0075433_106222162 125
19 3300006871 Ga0075434_100794369 Ga0075434_1007943691 125
20 3300025981 Ga0207640_10365806 Ga0207640_103658062 125
21 3300027907 Ga0207428_10065837 Ga0207428_100658372 125
22 3300035112 Ga0373932_0047254 Ga0373932_0047254_848_1252 125
23 3300005536 Ga0070697_101317385 Ga0070697_1013173851 126
24 3300005614 Ga0068856_100223944 Ga0068856_1002239442 126
25 3300006038 Ga0075365_10240920 Ga0075365_102409202 126
26 3300026078 Ga0207702_10331452 Ga0207702_103314522 126
27 3300047322 Ga0495680_0811806 Ga0495680_0811806_49_438 126
28 3300049584 Ga0501068_0217617 Ga0501068_0217617_506_907 126
29 3300050492 nmdc:mga0yw44_356774_c1 nmdc:mga0yw44_356774_c1_11_415 126
30 3300001991 JGI24743J22301_10086453 JGI24743J22301_100864532 127
31 3300005329 Ga0070683_100034927 Ga0070683_1000349272 127
32 3300005329 Ga0070683_100118607 Ga0070683_1001186072 127
33 3300005329 Ga0070683_100122452 Ga0070683_1001224523 127
34 3300005335 Ga0070666_10120764 Ga0070666_101207642 127
35 3300005337 Ga0070682_100000171 Ga0070682_10000017110 127
36 3300005338 Ga0068868_100003306 Ga0068868_1000033067 127
37 3300005344 Ga0070661_100000035 Ga0070661_10000003524 127
38 3300005347 Ga0070668_100106891 Ga0070668_1001068912 127
39 3300005347 Ga0070668_100150615 Ga0070668_1001506151 127
40 3300005354 Ga0070675_100000377 Ga0070675_1000003778 127
41 3300005364 Ga0070673_100998967 Ga0070673_1009989672 127
42 3300005436 Ga0070713_100000380 Ga0070713_1000003809 127
43 3300005456 Ga0070678_100022681 Ga0070678_1000226813 127
44 3300005535 Ga0070684_100415345 Ga0070684_1004153452 127
45 3300005539 Ga0068853_100401489 Ga0068853_1004014892 127
46 3300005543 Ga0070672_100000006 Ga0070672_100000006101 127
47 3300005548 Ga0070665_100169526 Ga0070665_1001695262 127
48 3300005564 Ga0070664_100119123 Ga0070664_1001191232 127
49 3300005577 Ga0068857_101040074 Ga0068857_1010400742 127
50 3300005578 Ga0068854_100024981 Ga0068854_1000249811 127
51 3300005614 Ga0068856_100000925 Ga0068856_10000092527 127
52 3300005614 Ga0068856_100077098 Ga0068856_1000770983 127
53 3300005616 Ga0068852_100006635 Ga0068852_1000066359 127
54 3300005937 Ga0081455_10340927 Ga0081455_103409272 127
55 3300005983 Ga0081540_1284191 Ga0081540_12841912 127
56 3300006175 Ga0070712_100012842 Ga0070712_1000128425 127
57 3300006881 Ga0068865_100001059 Ga0068865_1000010597 127
58 3300009011 Ga0105251_10117569 Ga0105251_101175691 127
59 3300009098 Ga0105245_10020367 Ga0105245_100203671 127
60 3300009101 Ga0105247_10103375 Ga0105247_101033753 127
61 3300009148 Ga0105243_10053717 Ga0105243_100537174 127
62 3300009174 Ga0105241_10150816 Ga0105241_101508162 127
63 3300009174 Ga0105241_10308971 Ga0105241_103089711 127
64 3300009177 Ga0105248_10001622 Ga0105248_100016222 127
65 3300010375 Ga0105239_10110448 Ga0105239_101104482 127
66 3300013104 Ga0157370_10159693 Ga0157370_101596933 127
67 3300013104 Ga0157370_10272610 Ga0157370_102726102 127
68 3300013297 Ga0157378_10154364 Ga0157378_101543642 127
69 3300013297 Ga0157378_10211031 Ga0157378_102110313 127
70 3300013308 Ga0157375_10373080 Ga0157375_103730803 127
71 3300014326 Ga0157380_10000445 Ga0157380_1000044524 127
72 3300025321 Ga0207656_10001648 Ga0207656_100016486 127
73 3300025900 Ga0207710_10066194 Ga0207710_100661943 127
74 3300025903 Ga0207680_10151375 Ga0207680_101513753 127
75 3300025911 Ga0207654_10075293 Ga0207654_100752932 127
76 3300025915 Ga0207693_10019603 Ga0207693_100196035 127
77 3300025920 Ga0207649_10000028 Ga0207649_10000028137 127
78 3300025925 Ga0207650_10134382 Ga0207650_101343822 127
79 3300025926 Ga0207659_10000246 Ga0207659_1000024622 127
80 3300025927 Ga0207687_10004445 Ga0207687_100044458 127
81 3300025928 Ga0207700_10000033 Ga0207700_1000003321 127
82 3300025929 Ga0207664_10008515 Ga0207664_100085152 127
83 3300025935 Ga0207709_10105514 Ga0207709_101055142 127
84 3300025938 Ga0207704_10000103 Ga0207704_1000010321 127
85 3300025940 Ga0207691_10000025 Ga0207691_1000002523 127
86 3300025941 Ga0207711_10000006 Ga0207711_10000006397 127
87 3300025944 Ga0207661_10009459 Ga0207661_100094594 127
88 3300025944 Ga0207661_10023059 Ga0207661_100230593 127
89 3300025945 Ga0207679_10170227 Ga0207679_101702272 127
90 3300025972 Ga0207668_10097771 Ga0207668_100977712 127
91 3300025981 Ga0207640_10000551 Ga0207640_1000055118 127
92 3300026023 Ga0207677_10001888 Ga0207677_100018887 127
93 3300026041 Ga0207639_10167634 Ga0207639_101676343 127
94 3300026041 Ga0207639_10250615 Ga0207639_102506152 127
95 3300026078 Ga0207702_10000242 Ga0207702_1000024237 127
96 3300026078 Ga0207702_10022205 Ga0207702_100222054 127
97 3300026116 Ga0207674_12020221 Ga0207674_120202211 127
98 3300026121 Ga0207683_10031904 Ga0207683_100319043 127
99 3300026142 Ga0207698_10000414 Ga0207698_1000041423 127
100 3300026142 Ga0207698_10021589 Ga0207698_100215892 127
101 3300028379 Ga0268266_10001578 Ga0268266_1000157823 127
102 3300028379 Ga0268266_10118622 Ga0268266_101186222 127
103 3300028379 Ga0268266_10776017 Ga0268266_107760172 127
104 3300031548 Ga0307408_100055850 Ga0307408_1000558502 127
105 3300031731 Ga0307405_11717915 Ga0307405_117179152 127
106 3300031824 Ga0307413_10001669 Ga0307413_100016698 127
107 3300031824 Ga0307413_11089487 Ga0307413_110894871 127
108 3300031852 Ga0307410_10018720 Ga0307410_100187202 127
109 3300031901 Ga0307406_10041822 Ga0307406_100418222 127
110 3300031995 Ga0307409_100038352 Ga0307409_1000383522 127
111 3300031995 Ga0307409_100535452 Ga0307409_1005354522 127
112 3300032002 Ga0307416_100003565 Ga0307416_1000035652 127
113 3300032005 Ga0307411_10340719 Ga0307411_103407191 127
114 3300032126 Ga0307415_100000715 Ga0307415_1000007158 127
115 3300032126 Ga0307415_100003877 Ga0307415_1000038779 127
116 3300032126 Ga0307415_100980965 Ga0307415_1009809652 127
117 3300035692 Ga0373935_1500207 Ga0373935_1500207_69_491 127
118 3300041503 Ga0451847_0360256 Ga0451847_0360256_35_454 127
119 3300044842 Ga0466957_0005836 Ga0466957_0005836_4681_5088 127
120 3300045976 Ga0466967_0000017 Ga0466967_0000017_8048_8464 127
121 3300046459 Ga0495629_0000999 Ga0495629_0000999_60_467 127
122 3300046461 Ga0495641_0030362 Ga0495641_0030362_358_768 127
123 3300046492 Ga0495585_0269797 Ga0495585_0269797_10_420 127
124 3300046507 Ga0495606_0000108 Ga0495606_0000108_131564_131971 127
125 3300046511 Ga0495608_0000036 Ga0495608_0000036_104663_105082 127
126 3300046517 Ga0495630_0000012 Ga0495630_0000012_216990_217400 127
127 3300046520 Ga0495637_0363069 Ga0495637_0363069_58_468 127
128 3300046675 Ga0495657_0000001 Ga0495657_0000001_104663_105082 127
129 3300046681 Ga0495647_0002790 Ga0495647_0002790_2336_2746 127
130 3300046683 Ga0495658_0032106 Ga0495658_0032106_628_1044 127
131 3300046794 Ga0495589_0043419 Ga0495589_0043419_1539_1961 127
132 3300046809 Ga0495600_0003292 Ga0495600_0003292_208_627 127
133 3300047444 Ga0495675_0000515 Ga0495675_0000515_24551_24970 127
134 3300048911 Ga0496108_0000355 Ga0496108_0000355_23743_24150 127
135 3300048911 Ga0496108_0017846 Ga0496108_0017846_5284_5691 127
136 3300048911 Ga0496108_1082198 Ga0496108_1082198_68_487 127
137 3300048912 Ga0496109_0000400 Ga0496109_0000400_15012_15419 127
138 3300048912 Ga0496109_0000903 Ga0496109_0000903_23623_24030 127
139 3300048913 Ga0496110_0000011 Ga0496110_0000011_23376_23798 127
140 3300048913 Ga0496110_1082366 Ga0496110_1082366_99_506 127
141 3300048914 Ga0496111_0006159 Ga0496111_0006159_70_492 127
142 3300048915 Ga0496112_0268554 Ga0496112_0268554_104_532 127
143 3300048916 Ga0496113_0000283 Ga0496113_0000283_361_789 127
144 3300049568 Ga0501031_0665302 Ga0501031_0665302_180_593 127
145 3300049572 Ga0501036_0433462 Ga0501036_0433462_521_934 127
146 3300049573 Ga0501037_0467697 Ga0501037_0467697_50_448 127
147 3300049576 Ga0501040_0143896 Ga0501040_0143896_278_691 127
148 3300049580 Ga0501046_0306477 Ga0501046_0306477_265_678 127
149 3300049587 Ga0501071_0530513 Ga0501071_0530513_271_684 127
150 3300049588 Ga0501072_1047256 Ga0501072_1047256_147_560 127
151 3300049592 Ga0501076_1049230 Ga0501076_1049230_204_617 127
152 3300049824 Ga0501045_0401405 Ga0501045_0401405_204_617 127
153 3300053083 Ga0495655_0010223 Ga0495655_0010223_1232_1657 127
154 3300053083 Ga0495655_0055044 Ga0495655_0055044_281_703 127
155 3300053084 Ga0495595_0000002 Ga0495595_0000002_340560_340979 127
156 3300053085 Ga0495619_0000277 Ga0495619_0000277_25009_25422 127
157 3300053085 Ga0495619_0000776 Ga0495619_0000776_8762_9181 127
158 3300054114 Ga0501084_0201401 Ga0501084_0201401_410_823 127
159 3300060353 Ga0501082_0713810 Ga0501082_0713810_423_836 127
160 3300061734 Ga0530510_0098556 Ga0530510_0098556_723_1136 127
161 3300003373 JGI25407J50210_10004026 JGI25407J50210_100040263 128
162 3300003373 JGI25407J50210_10104477 JGI25407J50210_101044771 128
163 3300005329 Ga0070683_100062335 Ga0070683_1000623352 128
164 3300005337 Ga0070682_100628999 Ga0070682_1006289991 128
165 3300005364 Ga0070673_100000474 Ga0070673_1000004746 128
166 3300005366 Ga0070659_100537339 Ga0070659_1005373392 128
167 3300005366 Ga0070659_101621483 Ga0070659_1016214831 128
168 3300005535 Ga0070684_100711447 Ga0070684_1007114472 128
169 3300005937 Ga0081455_10017592 Ga0081455_100175929 128
170 3300005981 Ga0081538_10000691 Ga0081538_100006914 128
171 3300005981 Ga0081538_10000894 Ga0081538_1000089411 128
172 3300005981 Ga0081538_10009157 Ga0081538_1000915711 128
173 3300005983 Ga0081540_1042483 Ga0081540_10424833 128
174 3300006048 Ga0075363_100520166 Ga0075363_1005201661 128
175 3300006175 Ga0070712_101621756 Ga0070712_1016217561 128
176 3300006178 Ga0075367_10554581 Ga0075367_105545811 128
177 3300009094 Ga0111539_10118468 Ga0111539_101184684 128
178 3300014325 Ga0163163_11796446 Ga0163163_117964462 128
179 3300020070 Ga0206356_10394249 Ga0206356_103942492 128
180 3300020075 Ga0206349_1670028 Ga0206349_16700284 128
181 3300025915 Ga0207693_11222066 Ga0207693_112220661 128
182 3300025932 Ga0207690_11338343 Ga0207690_113383431 128
183 3300025944 Ga0207661_10030514 Ga0207661_100305144 128
184 3300025945 Ga0207679_10622914 Ga0207679_106229142 128
185 3300025960 Ga0207651_10000664 Ga0207651_100006646 128
186 3300031251 Ga0265327_10034253 Ga0265327_100342533 128
187 3300032126 Ga0307415_100068677 Ga0307415_1000686773 128
188 3300034820 Ga0373959_0085333 Ga0373959_0085333_30_455 128
189 3300035114 Ga0373939_0043293 Ga0373939_0043293_96_521 128
190 3300035117 Ga0373953_0277012 Ga0373953_0277012_268_675 128
191 3300035121 Ga0373960_0031242 Ga0373960_0031242_223_648 128
192 3300035691 Ga0373931_0335039 Ga0373931_0335039_361_786 128
193 3300035724 Ga0373933_0250790 Ga0373933_0250790_306_713 128
194 3300036401 Ga0373937_0007200 Ga0373937_0007200_4604_5011 128
195 3300042126 Ga0450888_006547 Ga0450888_006547_105_521 128
196 3300042136 Ga0450900_065906 Ga0450900_065906_83_499 128
197 3300042461 Ga0439460_0054825 Ga0439460_0054825_109_525 128
198 3300046454 Ga0495592_0374079 Ga0495592_0374079_325_753 128
199 3300046455 Ga0495603_0000593 Ga0495603_0000593_3556_3963 128
200 3300046463 Ga0495653_0787313 Ga0495653_0787313_108_515 128
201 3300046474 Ga0495605_0347133 Ga0495605_0347133_47_475 128
202 3300046477 Ga0495664_0000022 Ga0495664_0000022_23678_24106 128
203 3300046491 Ga0495584_0137369 Ga0495584_0137369_504_920 128
204 3300046500 Ga0495596_0083732 Ga0495596_0083732_106_522 128
205 3300046513 Ga0495616_0091455 Ga0495616_0091455_25_450 128
206 3300046523 Ga0495644_0146190 Ga0495644_0146190_350_781 128
207 3300046529 Ga0495652_0098666 Ga0495652_0098666_829_1257 128
208 3300046530 Ga0495654_0264961 Ga0495654_0264961_150_566 128
209 3300046531 Ga0495665_0271595 Ga0495665_0271595_400_825 128
210 3300046536 Ga0495587_0250660 Ga0495587_0250660_237_644 128
211 3300047317 Ga0495604_0028724 Ga0495604_0028724_3315_3722 128
212 3300047319 Ga0495674_0511362 Ga0495674_0511362_331_738 128
213 3300047471 Ga0495684_0458962 Ga0495684_0458962_86_490 128
214 3300047471 Ga0495684_0631185 Ga0495684_0631185_208_636 128
215 3300048905 Ga0496102_0000040 Ga0496102_0000040_150478_150906 128
216 3300048906 Ga0496103_0000067 Ga0496103_0000067_104368_104796 128
217 3300048907 Ga0496104_0000070 Ga0496104_0000070_18738_19169 128
218 3300048908 Ga0496105_0203798 Ga0496105_0203798_168_599 128
219 3300048912 Ga0496109_0172674 Ga0496109_0172674_306_713 128
220 3300048913 Ga0496110_0000653 Ga0496110_0000653_19517_19948 128
221 3300048913 Ga0496110_0002236 Ga0496110_0002236_6205_6612 128
222 3300048914 Ga0496111_0000444 Ga0496111_0000444_960_1391 128
223 3300048914 Ga0496111_0004792 Ga0496111_0004792_853_1260 128
224 3300049572 Ga0501036_0475512 Ga0501036_0475512_512_916 128
225 3300049585 Ga0501069_0247426 Ga0501069_0247426_332_754 128
226 3300049592 Ga0501076_0403471 Ga0501076_0403471_159_554 128
227 3300050494 nmdc:mga06z11_445255_c1 nmdc:mga06z11_445255_c1_217_639 128
228 3300050509 nmdc:mga0qj67_142777_c1 nmdc:mga0qj67_142777_c1_1282_1695 128
229 3300050511 nmdc:mga08y16_176756_c1 nmdc:mga08y16_176756_c1_1240_1665 128
230 3300050512 nmdc:mga0n895_104589_c1 nmdc:mga0n895_104589_c1_2395_2820 128
231 3300053077 Ga0495601_0014470 Ga0495601_0014470_1003_1431 128
232 3300031995 Ga0307409_100322874 Ga0307409_1003228742 129
233 3300046462 Ga0495651_0102313 Ga0495651_0102313_980_1411 129
234 3300046477 Ga0495664_0340220 Ga0495664_0340220_386_817 129
235 3300046511 Ga0495608_0319078 Ga0495608_0319078_462_893 129
236 3300046516 Ga0495628_0034129 Ga0495628_0034129_1599_2030 129
237 3300046663 Ga0495635_0439666 Ga0495635_0439666_389_820 129
238 3300046683 Ga0495658_0350455 Ga0495658_0350455_350_790 129
239 3300053077 Ga0495601_0129450 Ga0495601_0129450_399_830 129
240 3300053078 Ga0495612_0001134 Ga0495612_0001134_7966_8397 129
241 3300053085 Ga0495619_0289784 Ga0495619_0289784_68_508 129
242 3300053085 Ga0495619_0395873 Ga0495619_0395873_421_852 129
243 3300013308 Ga0157375_11613584 Ga0157375_116135842 130
244 3300025972 Ga0207668_10448440 Ga0207668_104484402 130
245 3300026035 Ga0207703_10000088 Ga0207703_1000008876 130
246 3300048913 Ga0496110_0030839 Ga0496110_0030839_199_633 130
247 3300050510 nmdc:mga06r32_135500_c1 nmdc:mga06r32_135500_c1_14_448 130
248 3300053085 Ga0495619_0000008 Ga0495619_0000008_282440_282874 130
249 3300000549 LJQas_1009188 LJQas_10091882 134
250 3300005435 Ga0070714_100192236 Ga0070714_1001922363 134
251 3300005435 Ga0070714_100777686 Ga0070714_1007776862 134
252 3300005439 Ga0070711_100073303 Ga0070711_1000733033 134
253 3300025916 Ga0207663_10000487 Ga0207663_1000048716 134
254 3300025929 Ga0207664_10237872 Ga0207664_102378722 134
255 3300036401 Ga0373937_0762918 Ga0373937_0762918_22_498 134
256 3300045049 Ga0466959_0188528 Ga0466959_0188528_764_1192 134
257 3300045836 Ga0466958_0345772 Ga0466958_0345772_237_683 134
258 3300045836 Ga0466958_0563766 Ga0466958_0563766_84_527 134
259 3300053084 Ga0495595_0320096 Ga0495595_0320096_256_714 134
260 3300053085 Ga0495619_0093316 Ga0495619_0093316_1144_1602 134
261 3300053085 Ga0495619_1179115 Ga0495619_1179115_51_497 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

43

113

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9548 35 109
1o4t-assembly1.cif.gz_B crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution 0.9536 38 111
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.9446 35 111
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.9383 38 110
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9298 34 110
ID Description Score Start End Superfamily
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9585 35 111 2.60.120.10
1o4tB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9536 38 111 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9503 35 112 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.95 35 112 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9437 35 112 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A522LBI6-F1-model_v4 Cupin domain-containing protein 0.9753 38 111
AF-A0A3A4JPZ0-F1-model_v4 Cupin domain-containing protein 0.975 38 111
AF-A0A150SF67-F1-model_v4 Cupin type-2 domain-containing protein 0.9639 36 111
AF-A0A6A6K265-F1-model_v4 Mif2/CENP-C cupin domain-containing protein 0.9637 36 111 GO:0000776
GO:0005634
GO:0019237
GO:0051315
GO:0051382
GO:0051455
AF-A0A7V1H515-F1-model_v4 Cupin domain-containing protein 0.9623 35 111

Feature Viewer

pLDDT pTM Quality
90.51 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map