F370346

General Info

Members Datasets Scaffolds Average Seq Length
261 149 261 314

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10094512|Ga0157375_100945123
Length 344
Sequence MTSAAKLKMESEALGTLDFRERDEAIQEIASRLNVSAERGRRFAELTSLRVGGAIDWVIAPETEEQAAAVVQAMDQARVAWRALGSGSNVLADDQDHHYVVLSLKELKGEPVFDGERVSVSAGYSLPRLCIDAARRGLAGIVGGALWMNAGAYDHEIGTVTESVRVARDGQVVAVPGREIKWDYRHTSFREGELLLGATLRLRPDEVEKIQERMEKAKTQRLATQPHGARSAGCFFKNPPNSTTGTGKMIDDLGMKGSRRGGAVVSPKHANFIVTEGDNAQAADALALAEEIRERVKREHGIDLEYEVELWRSQPLTGPGEVSTAGDSGRVVPAIDPQEGDKRA

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
136 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
137 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
138 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
139 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
140 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
141 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
142 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
143 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.77
Rhizosphere 98.47
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000011 3300002074 Bacteria 157004
2 JGI24034J26672_10000037 3300002239 Bacteria 76023
3 JGI25406J46586_10016881 3300003203 Bacteria 3031
4 Ga0065707_10005614 3300005295 Bacteria 4314
5 Ga0065707_10008949 3300005295 Bacteria 3792
6 Ga0065707_10154291 3300005295 Bacteria 1624
7 Ga0065707_10173941 3300005295 Unclassified 1464
8 Ga0070690_100057867 3300005330 Bacteria 2488
9 Ga0068869_100041800 3300005334 Bacteria 3283
10 Ga0068869_100258607 3300005334 Bacteria 1393
11 Ga0070680_100087726 3300005336 Bacteria 2573
12 Ga0070682_100000056 3300005337 Bacteria 108991
13 Ga0070682_100015152 3300005337 Bacteria 4463
14 Ga0068868_100013310 3300005338 Bacteria 6029
15 Ga0070689_100097338 3300005340 Bacteria 2326
16 Ga0070687_100145189 3300005343 Unclassified 1386
17 Ga0070661_100023106 3300005344 Bacteria 4456
18 Ga0070692_10006514 3300005345 Bacteria 5076
19 Ga0070668_100003549 3300005347 Bacteria 11506
20 Ga0070671_100007734 3300005355 Bacteria 8586
21 Ga0070673_100041517 3300005364 Bacteria 3539
22 Ga0070659_100002005 3300005366 Bacteria 14544
23 Ga0070659_100183085 3300005366 Bacteria 1720
24 Ga0070667_100074618 3300005367 Bacteria 2894
25 Ga0070703_10000148 3300005406 Bacteria 36116
26 Ga0070705_100040838 3300005440 Bacteria 2641
27 Ga0070705_100100701 3300005440 Bacteria 1824
28 Ga0070705_100103131 3300005440 Bacteria 1806
29 Ga0070700_100000244 3300005441 Bacteria 29748
30 Ga0070694_100001163 3300005444 Bacteria 15147
31 Ga0070694_100015247 3300005444 Bacteria 4822
32 Ga0070694_100067559 3300005444 Bacteria 2454
33 Ga0070708_100000828 3300005445 Bacteria 23303
34 Ga0070708_100208872 3300005445 Bacteria 1829
35 Ga0070662_100108426 3300005457 Bacteria 2112
36 Ga0070681_10004597 3300005458 Bacteria 13180
37 Ga0068867_100035581 3300005459 Bacteria 3613
38 Ga0068867_100167555 3300005459 Bacteria 1737
39 Ga0070706_100001569 3300005467 Bacteria 23870
40 Ga0070706_100030921 3300005467 Unclassified 4936
41 Ga0070706_100145049 3300005467 Bacteria 2217
42 Ga0070707_100000659 3300005468 Bacteria 34403
43 Ga0070707_100012709 3300005468 Bacteria 7861
44 Ga0070707_100030833 3300005468 Bacteria 5107
45 Ga0070707_100109711 3300005468 Bacteria 2676
46 Ga0070698_100000852 3300005471 Bacteria 33433
47 Ga0070698_100026096 3300005471 Bacteria 6084
48 Ga0070698_100043528 3300005471 Bacteria 4602
49 Ga0070698_100079647 3300005471 Bacteria 3272
50 Ga0070698_100138112 3300005471 Bacteria 2390
51 Ga0070699_100066882 3300005518 Unclassified 3121
52 Ga0070699_100097311 3300005518 Bacteria 2578
53 Ga0070699_100143253 3300005518 Bacteria 2111
54 Ga0070679_100005246 3300005530 Bacteria 11992
55 Ga0070684_100272562 3300005535 Bacteria 1549
56 Ga0070697_100005288 3300005536 Bacteria 9911
57 Ga0070697_100021012 3300005536 Bacteria 5168
58 Ga0070697_100050587 3300005536 Bacteria 3374
59 Ga0070697_100073383 3300005536 Bacteria 2809
60 Ga0068853_100004734 3300005539 Bacteria 10568
61 Ga0070686_100024548 3300005544 Unclassified 3615
62 Ga0070686_100097896 3300005544 Bacteria 1976
63 Ga0070696_100058241 3300005546 Bacteria 2698
64 Ga0070696_100116957 3300005546 Unclassified 1926
65 Ga0070696_100119502 3300005546 Unclassified 1906
66 Ga0070696_100222264 3300005546 Bacteria 1417
67 Ga0070693_100029190 3300005547 Unclassified 3006
68 Ga0070704_100000663 3300005549 Bacteria 16621
69 Ga0070704_100022292 3300005549 Bacteria 4120
70 Ga0070704_100305641 3300005549 Unclassified 1327
71 Ga0070664_100000648 3300005564 Bacteria 26692
72 Ga0070664_100052265 3300005564 Bacteria 3460
73 Ga0068857_100002248 3300005577 Bacteria 15713
74 Ga0068854_100203103 3300005578 Bacteria 1559
75 Ga0070702_100029195 3300005615 Bacteria 2996
76 Ga0068852_100042378 3300005616 Bacteria 3854
77 Ga0068859_100028567 3300005617 Bacteria 5592
78 Ga0068859_100035321 3300005617 Bacteria 5016
79 Ga0068859_100141191 3300005617 Bacteria 2482
80 Ga0068864_100003312 3300005618 Bacteria 13309
81 Ga0068864_100006867 3300005618 Bacteria 9324
82 Ga0068864_100031323 3300005618 Bacteria 4512
83 Ga0068864_100181159 3300005618 Bacteria 1926
84 Ga0068861_100003664 3300005719 Bacteria 10247
85 Ga0068861_100068044 3300005719 Bacteria 2750
86 Ga0068858_100000052 3300005842 Bacteria 119935
87 Ga0068858_100028815 3300005842 Bacteria 5156
88 Ga0068858_100186660 3300005842 Bacteria 1958
89 Ga0068860_100085547 3300005843 Bacteria 3001
90 Ga0068860_100182369 3300005843 Unclassified 2029
91 Ga0068862_100030520 3300005844 Bacteria 4543
92 Ga0068862_100139599 3300005844 Bacteria 2150
93 Ga0081539_10000886 3300005985 Bacteria 57243
94 Ga0070716_100000014 3300006173 Bacteria 92762
95 Ga0070716_100108880 3300006173 Bacteria 1713
96 Ga0097621_100029306 3300006237 Bacteria 4346
97 Ga0068871_100011643 3300006358 Bacteria 6458
98 Ga0075428_100121545 3300006844 Bacteria 2843
99 Ga0075431_100341192 3300006847 Bacteria 1507
100 Ga0075433_10066307 3300006852 Bacteria 3167
101 Ga0075433_10140911 3300006852 Unclassified 2143
102 Ga0075433_10335581 3300006852 Bacteria 1336
103 Ga0075434_100019992 3300006871 Bacteria 6486
104 Ga0075429_100049411 3300006880 Bacteria 3657
105 Ga0068865_100099617 3300006881 Bacteria 2125
106 Ga0075436_100000052 3300006914 Bacteria 70308
107 Ga0075436_100194626 3300006914 Bacteria 1435
108 Ga0097620_100028567 3300006931 Bacteria 5592
109 Ga0097620_100035321 3300006931 Bacteria 5016
110 Ga0097620_100141191 3300006931 Bacteria 2482
111 Ga0075435_100080927 3300007076 Bacteria 2668
112 Ga0099794_10002245 3300007265 Bacteria 7075
113 Ga0111539_10013513 3300009094 Bacteria 10204
114 Ga0111539_10104293 3300009094 Bacteria 3327
115 Ga0105245_10045425 3300009098 Bacteria 3923
116 Ga0105247_10000003 3300009101 Bacteria 694517
117 Ga0105247_10076741 3300009101 Bacteria 2098
118 Ga0114129_10014441 3300009147 Bacteria 11254
119 Ga0114129_10094122 3300009147 Bacteria 4150
120 Ga0114129_10175606 3300009147 Unclassified 2918
121 Ga0114129_10300585 3300009147 Unclassified 2139
122 Ga0105243_10000427 3300009148 Bacteria 44095
123 Ga0105243_10001156 3300009148 Bacteria 23918
124 Ga0105243_10096120 3300009148 Bacteria 2450
125 Ga0105243_10242589 3300009148 Bacteria 1604
126 Ga0105241_10086710 3300009174 Bacteria 2462
127 Ga0105242_10000055 3300009176 Bacteria 76298
128 Ga0105242_10020364 3300009176 Bacteria 5199
129 Ga0105242_10032338 3300009176 Bacteria 4183
130 Ga0105242_10239648 3300009176 Bacteria 1630
131 Ga0105248_10008275 3300009177 Bacteria 11428
132 Ga0105248_10010968 3300009177 Bacteria 9999
133 Ga0105248_10059636 3300009177 Bacteria 4286
134 Ga0105248_10366907 3300009177 Bacteria 1621
135 Ga0105237_10000403 3300009545 Bacteria 61490
136 Ga0105249_10000118 3300009553 Bacteria 107887
137 Ga0105239_10032710 3300010375 Bacteria 5715
138 Ga0157373_10004621 3300013100 Bacteria 10359
139 Ga0157373_10007186 3300013100 Bacteria 8310
140 Ga0157378_10000306 3300013297 Bacteria 47715
141 Ga0157378_10003138 3300013297 Bacteria 14688
142 Ga0157378_10032090 3300013297 Bacteria 4639
143 Ga0157378_10059926 3300013297 Bacteria 3397
144 Ga0157378_10111367 3300013297 Unclassified 2510
145 Ga0163162_10000059 3300013306 Bacteria 107864
146 Ga0163162_10002421 3300013306 Bacteria 17570
147 Ga0163162_10026011 3300013306 Bacteria 5783
148 Ga0163162_10040571 3300013306 Bacteria 4655
149 Ga0163162_10049158 3300013306 Bacteria 4227
150 Ga0163162_10055597 3300013306 Bacteria 3985
151 Ga0163162_10060582 3300013306 Bacteria 3821
152 Ga0157372_10321371 3300013307 Unclassified 1802
153 Ga0157375_10049653 3300013308 Bacteria 4112
154 Ga0157375_10072983 3300013308 Unclassified 3450
155 Ga0157375_10094512 3300013308 Unclassified 3058
156 Ga0157375_10204226 3300013308 Bacteria 2132
157 Ga0157375_10551478 3300013308 Bacteria 1314
158 Ga0163163_10003070 3300014325 Bacteria 14133
159 Ga0163163_10022227 3300014325 Bacteria 6001
160 Ga0163163_10037791 3300014325 Bacteria 4698
161 Ga0163163_10123994 3300014325 Bacteria 2620
162 Ga0157380_10017324 3300014326 Bacteria 5330
163 Ga0157379_10071494 3300014968 Bacteria 3103
164 Ga0157379_10192143 3300014968 Bacteria 1845
165 Ga0213876_10040082 3300021384 Bacteria 2474
166 Ga0207672_1000060 3300025223 Bacteria 14472
167 Ga0207653_10000205 3300025885 Bacteria 40042
168 Ga0207653_10003397 3300025885 Bacteria 5027
169 Ga0207710_10000001 3300025900 Bacteria 1797433
170 Ga0207684_10002329 3300025910 Bacteria 19247
171 Ga0207707_10003977 3300025912 Bacteria 13121
172 Ga0207671_10002799 3300025914 Bacteria 18183
173 Ga0207662_10133854 3300025918 Unclassified 1565
174 Ga0207652_10035029 3300025921 Bacteria 4235
175 Ga0207652_10289152 3300025921 Bacteria 1479
176 Ga0207646_10000702 3300025922 Bacteria 43444
177 Ga0207650_10156070 3300025925 Bacteria 1805
178 Ga0207650_10336349 3300025925 Bacteria 1239
179 Ga0207659_10165650 3300025926 Bacteria 1739
180 Ga0207690_10049981 3300025932 Bacteria 2789
181 Ga0207690_10098593 3300025932 Bacteria 2082
182 Ga0207686_10000038 3300025934 Bacteria 127610
183 Ga0207709_10000017 3300025935 Bacteria 470753
184 Ga0207709_10000054 3300025935 Bacteria 223290
185 Ga0207709_10001548 3300025935 Bacteria 15803
186 Ga0207709_10002971 3300025935 Bacteria 10334
187 Ga0207665_10000029 3300025939 Bacteria 95174
188 Ga0207665_10044008 3300025939 Unclassified 2987
189 Ga0207711_10015979 3300025941 Bacteria 6227
190 Ga0207711_10043390 3300025941 Bacteria 3835
191 Ga0207711_10282226 3300025941 Bacteria 1530
192 Ga0207711_10377665 3300025941 Bacteria 1315
193 Ga0207689_10025850 3300025942 Archaea 4919
194 Ga0207689_10045088 3300025942 Bacteria 3647
195 Ga0207689_10120721 3300025942 Unclassified 2156
196 Ga0207689_10175773 3300025942 Bacteria 1766
197 Ga0207689_10239719 3300025942 Bacteria 1499
198 Ga0207689_10257511 3300025942 Bacteria 1443
199 Ga0207651_10063068 3300025960 Bacteria 2586
200 Ga0207712_10000106 3300025961 Bacteria 94950
201 Ga0207668_10007620 3300025972 Bacteria 6444
202 Ga0207677_10034723 3300026023 Bacteria 3268
203 Ga0207703_10000055 3300026035 Bacteria 143420
204 Ga0207703_10029078 3300026035 Bacteria 4360
205 Ga0207639_10140583 3300026041 Bacteria 2011
206 Ga0207708_10001792 3300026075 Bacteria 15837
207 Ga0207708_10081249 3300026075 Bacteria 2491
208 Ga0207641_10109611 3300026088 Bacteria 2445
209 Ga0207648_10036969 3300026089 Bacteria 4301
210 Ga0207648_10050123 3300026089 Bacteria 3651
211 Ga0207648_10225840 3300026089 Bacteria 1665
212 Ga0207676_10027152 3300026095 Bacteria 4261
213 Ga0207676_10145268 3300026095 Bacteria 2036
214 Ga0207674_10000216 3300026116 Bacteria 71622
215 Ga0207674_10110927 3300026116 Bacteria 2718
216 Ga0207428_10017032 3300027907 Bacteria 6242
217 Ga0268266_10042660 3300028379 Bacteria 3876
218 Ga0268264_10042918 3300028381 Bacteria 3745
219 Ga0268264_10117639 3300028381 Bacteria 2338
220 Ga0268264_10452909 3300028381 Bacteria 1244
221 Ga0307408_100001805 3300031548 Bacteria 15614
222 Ga0307405_10115029 3300031731 Bacteria 1829
223 Ga0307413_10251477 3300031824 Bacteria 1311
224 Ga0307410_10003103 3300031852 Bacteria 8240
225 Ga0307406_10001256 3300031901 Bacteria 14213
226 Ga0307414_10002516 3300032004 Bacteria 9618
227 Ga0373951_0003154 3300035091 Bacteria 4054
228 Ga0373941_0044637 3300035115 Bacteria 1384
229 Ga0373961_0025291 3300035241 Bacteria 1613
230 Ga0395900_0209124 3300037418 Bacteria 1971
231 Ga0395898_0035752 3300037466 Bacteria 4936
232 Ga0242420_000225 3300038996 Bacteria 6082
233 Ga0242420_000725 3300038996 Bacteria 3950
234 Ga0436365_0318622 3300039437 Bacteria 7679
235 Ga0439434_0008165 3300042435 Bacteria 3068
236 Ga0451577_0269509 3300042876 Bacteria 1542
237 Ga0495610_0033114 3300046512 Unclassified 2675
238 Ga0495632_0011400 3300046519 Bacteria 5188
239 Ga0495663_0000580 3300046525 Bacteria 12852
240 Ga0496106_0002178 3300048909 Bacteria 14639
241 Ga0496113_0071634 3300048916 Bacteria 2636
242 Ga0501298_018615 3300049521 Unclassified 1279
243 Ga0501199_004462 3300049650 Bacteria 1379
244 Ga0501202_002672 3300049652 Bacteria 3010
245 Ga0501207_004321 3300049654 Bacteria 1926
246 Ga0501223_000430 3300049663 Bacteria 10185
247 Ga0501227_001934 3300049665 Bacteria 4600
248 Ga0501227_016597 3300049665 Unclassified 1655
249 Ga0501233_001287 3300049668 Bacteria 4288
250 Ga0501257_059350 3300049686 Unclassified 965
251 Ga0501212_012050 3300049851 Unclassified 1253
252 nmdc:mga05p37_220422_c1 3300050507 Bacteria 2289
253 nmdc:mga05p37_64278_c1 3300050507 Bacteria 4515
254 nmdc:mga05p37_75695_c1 3300050507 Archaea 4143
255 nmdc:mga09592_358068_c1 3300050508 Bacteria 1263
256 nmdc:mga08y16_146860_c1 3300050511 Unclassified 2452
257 nmdc:mga08y16_189965_c1 3300050511 Unclassified 1707
258 nmdc:mga08y16_77890_c1 3300050511 Bacteria 3456
259 nmdc:mga08x19_106_c1 3300050514 Bacteria 74458
260 nmdc:mga0a205_263250_c1 3300050515 Bacteria 1602
261 Ga0495655_0042982 3300053083 Bacteria 1163

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0033114 Ga0495610_0033114_1775_2665 265
2 3300013306 Ga0163162_10060582 Ga0163162_100605823 275
3 3300049686 Ga0501257_059350 Ga0501257_059350_48_953 275
4 3300005518 Ga0070699_100097311 Ga0070699_1000973112 281
5 3300005578 Ga0068854_100203103 Ga0068854_1002031032 283
6 3300005618 Ga0068864_100181159 Ga0068864_1001811592 285
7 3300025942 Ga0207689_10120721 Ga0207689_101207212 285
8 3300005340 Ga0070689_100097338 Ga0070689_1000973382 286
9 3300005440 Ga0070705_100103131 Ga0070705_1001031312 286
10 3300005544 Ga0070686_100024548 Ga0070686_1000245482 286
11 3300025921 Ga0207652_10289152 Ga0207652_102891522 286
12 3300009174 Ga0105241_10086710 Ga0105241_100867102 287
13 3300005295 Ga0065707_10005614 Ga0065707_100056141 289
14 3300005441 Ga0070700_100000244 Ga0070700_10000024434 289
15 3300005471 Ga0070698_100138112 Ga0070698_1001381122 289
16 3300005518 Ga0070699_100143253 Ga0070699_1001432532 289
17 3300005536 Ga0070697_100021012 Ga0070697_1000210121 289
18 3300009094 Ga0111539_10013513 Ga0111539_100135133 289
19 3300009101 Ga0105247_10076741 Ga0105247_100767411 289
20 3300009177 Ga0105248_10010968 Ga0105248_100109685 289
21 3300025941 Ga0207711_10015979 Ga0207711_100159792 289
22 3300026075 Ga0207708_10001792 Ga0207708_1000179210 289
23 3300027907 Ga0207428_10017032 Ga0207428_100170324 289
24 3300031548 Ga0307408_100001805 Ga0307408_10000180511 289
25 3300031731 Ga0307405_10115029 Ga0307405_101150291 289
26 3300031824 Ga0307413_10251477 Ga0307413_102514772 289
27 3300031852 Ga0307410_10003103 Ga0307410_100031036 289
28 3300031901 Ga0307406_10001256 Ga0307406_1000125610 289
29 3300032004 Ga0307414_10002516 Ga0307414_1000251610 289
30 3300035115 Ga0373941_0044637 Ga0373941_0044637_181_1140 289
31 3300035241 Ga0373961_0025291 Ga0373961_0025291_282_1241 289
32 3300049650 Ga0501199_004462 Ga0501199_004462_114_1076 289
33 3300049652 Ga0501202_002672 Ga0501202_002672_649_1611 289
34 3300049654 Ga0501207_004321 Ga0501207_004321_929_1891 289
35 3300049663 Ga0501223_000430 Ga0501223_000430_7303_8265 289
36 3300049665 Ga0501227_001934 Ga0501227_001934_1525_2487 289
37 3300049668 Ga0501233_001287 Ga0501233_001287_2273_3235 289
38 3300050511 nmdc:mga08y16_146860_c1 nmdc:mga08y16_146860_c1_434_1369 289
39 3300005549 Ga0070704_100022292 Ga0070704_1000222922 291
40 3300005844 Ga0068862_100139599 Ga0068862_1001395992 291
41 3300009147 Ga0114129_10094122 Ga0114129_100941223 291
42 3300009177 Ga0105248_10366907 Ga0105248_103669071 291
43 3300013100 Ga0157373_10007186 Ga0157373_100071867 291
44 3300013306 Ga0163162_10049158 Ga0163162_100491583 291
45 3300025918 Ga0207662_10133854 Ga0207662_101338542 291
46 3300025941 Ga0207711_10282226 Ga0207711_102822261 291
47 3300037418 Ga0395900_0209124 Ga0395900_0209124_156_1157 291
48 3300037466 Ga0395898_0035752 Ga0395898_0035752_3203_4204 291
49 3300003203 JGI25406J46586_10016881 JGI25406J46586_100168812 292
50 3300005334 Ga0068869_100258607 Ga0068869_1002586072 292
51 3300005459 Ga0068867_100035581 Ga0068867_1000355812 292
52 3300005467 Ga0070706_100145049 Ga0070706_1001450492 292
53 3300005564 Ga0070664_100052265 Ga0070664_1000522652 292
54 3300005985 Ga0081539_10000886 Ga0081539_1000088635 292
55 3300009148 Ga0105243_10096120 Ga0105243_100961202 292
56 3300009176 Ga0105242_10239648 Ga0105242_102396482 292
57 3300025935 Ga0207709_10002971 Ga0207709_100029712 292
58 3300025942 Ga0207689_10257511 Ga0207689_102575112 292
59 3300026089 Ga0207648_10036969 Ga0207648_100369693 292
60 3300026116 Ga0207674_10110927 Ga0207674_101109272 292
61 3300028381 Ga0268264_10452909 Ga0268264_104529092 292
62 3300005445 Ga0070708_100208872 Ga0070708_1002088722 293
63 3300050511 nmdc:mga08y16_189965_c1 nmdc:mga08y16_189965_c1_16_1023 293
64 3300005337 Ga0070682_100015152 Ga0070682_1000151524 295
65 3300005345 Ga0070692_10006514 Ga0070692_100065143 295
66 3300005366 Ga0070659_100183085 Ga0070659_1001830852 295
67 3300005444 Ga0070694_100015247 Ga0070694_1000152473 295
68 3300005444 Ga0070694_100067559 Ga0070694_1000675593 295
69 3300005546 Ga0070696_100119502 Ga0070696_1001195022 295
70 3300005547 Ga0070693_100029190 Ga0070693_1000291902 295
71 3300005549 Ga0070704_100305641 Ga0070704_1003056412 295
72 3300005615 Ga0070702_100029195 Ga0070702_1000291953 295
73 3300005617 Ga0068859_100028567 Ga0068859_1000285673 295
74 3300005719 Ga0068861_100003664 Ga0068861_1000036642 295
75 3300005842 Ga0068858_100186660 Ga0068858_1001866602 295
76 3300006173 Ga0070716_100000014 Ga0070716_10000001469 295
77 3300006844 Ga0075428_100121545 Ga0075428_1001215452 295
78 3300006847 Ga0075431_100341192 Ga0075431_1003411922 295
79 3300006852 Ga0075433_10066307 Ga0075433_100663072 295
80 3300006871 Ga0075434_100019992 Ga0075434_1000199924 295
81 3300006931 Ga0097620_100028567 Ga0097620_1000285673 295
82 3300007076 Ga0075435_100080927 Ga0075435_1000809272 295
83 3300007265 Ga0099794_10002245 Ga0099794_100022455 295
84 3300009094 Ga0111539_10104293 Ga0111539_101042932 295
85 3300009098 Ga0105245_10045425 Ga0105245_100454252 295
86 3300009148 Ga0105243_10242589 Ga0105243_102425892 295
87 3300009545 Ga0105237_10000403 Ga0105237_1000040320 295
88 3300010375 Ga0105239_10032710 Ga0105239_100327102 295
89 3300013306 Ga0163162_10040571 Ga0163162_100405714 295
90 3300013307 Ga0157372_10321371 Ga0157372_103213712 295
91 3300013308 Ga0157375_10551478 Ga0157375_105514781 295
92 3300014968 Ga0157379_10071494 Ga0157379_100714943 295
93 3300025885 Ga0207653_10003397 Ga0207653_100033973 295
94 3300025914 Ga0207671_10002799 Ga0207671_100027992 295
95 3300025925 Ga0207650_10336349 Ga0207650_103363491 295
96 3300025932 Ga0207690_10098593 Ga0207690_100985932 295
97 3300025939 Ga0207665_10000029 Ga0207665_1000002928 295
98 3300025942 Ga0207689_10045088 Ga0207689_100450882 295
99 3300035091 Ga0373951_0003154 Ga0373951_0003154_2185_3201 295
100 3300038996 Ga0242420_000225 Ga0242420_000225_800_1891 295
101 3300038996 Ga0242420_000725 Ga0242420_000725_877_1812 295
102 3300042876 Ga0451577_0269509 Ga0451577_0269509_514_1449 295
103 3300048916 Ga0496113_0071634 Ga0496113_0071634_1489_2457 295
104 3300049521 Ga0501298_018615 Ga0501298_018615_258_1232 295
105 3300049665 Ga0501227_016597 Ga0501227_016597_325_1299 295
106 3300049851 Ga0501212_012050 Ga0501212_012050_248_1222 295
107 3300050508 nmdc:mga09592_358068_c1 nmdc:mga09592_358068_c1_42_1049 295
108 3300050511 nmdc:mga08y16_77890_c1 nmdc:mga08y16_77890_c1_955_1929 295
109 3300005295 Ga0065707_10008949 Ga0065707_100089493 296
110 3300005330 Ga0070690_100057867 Ga0070690_1000578672 296
111 3300005364 Ga0070673_100041517 Ga0070673_1000415172 296
112 3300005406 Ga0070703_10000148 Ga0070703_1000014834 296
113 3300005444 Ga0070694_100001163 Ga0070694_1000011639 296
114 3300005471 Ga0070698_100079647 Ga0070698_1000796472 296
115 3300005544 Ga0070686_100097896 Ga0070686_1000978962 296
116 3300005617 Ga0068859_100141191 Ga0068859_1001411912 296
117 3300005844 Ga0068862_100030520 Ga0068862_1000305203 296
118 3300006173 Ga0070716_100108880 Ga0070716_1001088802 296
119 3300006880 Ga0075429_100049411 Ga0075429_1000494111 296
120 3300006881 Ga0068865_100099617 Ga0068865_1000996171 296
121 3300006914 Ga0075436_100000052 Ga0075436_10000005233 296
122 3300006914 Ga0075436_100194626 Ga0075436_1001946262 296
123 3300006931 Ga0097620_100141191 Ga0097620_1001411912 296
124 3300009148 Ga0105243_10000427 Ga0105243_100004273 296
125 3300009148 Ga0105243_10001156 Ga0105243_1000115623 296
126 3300009176 Ga0105242_10000055 Ga0105242_1000005545 296
127 3300009176 Ga0105242_10032338 Ga0105242_100323383 296
128 3300009177 Ga0105248_10059636 Ga0105248_100596363 296
129 3300013297 Ga0157378_10000306 Ga0157378_1000030641 296
130 3300013297 Ga0157378_10032090 Ga0157378_100320905 296
131 3300013297 Ga0157378_10111367 Ga0157378_101113672 296
132 3300013308 Ga0157375_10049653 Ga0157375_100496533 296
133 3300025885 Ga0207653_10000205 Ga0207653_1000020511 296
134 3300025926 Ga0207659_10165650 Ga0207659_101656502 296
135 3300025934 Ga0207686_10000038 Ga0207686_1000003868 296
136 3300025935 Ga0207709_10000017 Ga0207709_1000001761 296
137 3300025935 Ga0207709_10000054 Ga0207709_1000005461 296
138 3300025935 Ga0207709_10001548 Ga0207709_100015484 296
139 3300025939 Ga0207665_10044008 Ga0207665_100440082 296
140 3300025942 Ga0207689_10175773 Ga0207689_101757732 296
141 3300025960 Ga0207651_10063068 Ga0207651_100630682 296
142 3300048909 Ga0496106_0002178 Ga0496106_0002178_3084_4019 296
143 3300050514 nmdc:mga08x19_106_c1 nmdc:mga08x19_106_c1_30044_31051 296
144 3300005295 Ga0065707_10173941 Ga0065707_101739411 297
145 3300005468 Ga0070707_100109711 Ga0070707_1001097112 297
146 3300005536 Ga0070697_100005288 Ga0070697_1000052886 297
147 3300006852 Ga0075433_10140911 Ga0075433_101409112 297
148 3300009147 Ga0114129_10014441 Ga0114129_100144416 297
149 3300050507 nmdc:mga05p37_64278_c1 nmdc:mga05p37_64278_c1_1821_2798 297
150 3300050515 nmdc:mga0a205_263250_c1 nmdc:mga0a205_263250_c1_503_1480 297
151 3300005295 Ga0065707_10154291 Ga0065707_101542912 298
152 3300005440 Ga0070705_100100701 Ga0070705_1001007012 298
153 3300005467 Ga0070706_100030921 Ga0070706_1000309213 298
154 3300005468 Ga0070707_100000659 Ga0070707_1000006599 298
155 3300005471 Ga0070698_100026096 Ga0070698_1000260963 298
156 3300005518 Ga0070699_100066882 Ga0070699_1000668822 298
157 3300005546 Ga0070696_100058241 Ga0070696_1000582412 298
158 3300005546 Ga0070696_100222264 Ga0070696_1002222641 298
159 3300005549 Ga0070704_100000663 Ga0070704_10000066314 298
160 3300005617 Ga0068859_100035321 Ga0068859_1000353212 298
161 3300006852 Ga0075433_10335581 Ga0075433_103355812 298
162 3300006931 Ga0097620_100035321 Ga0097620_1000353212 298
163 3300013306 Ga0163162_10055597 Ga0163162_100555972 298
164 3300025922 Ga0207646_10000702 Ga0207646_1000070236 298
165 3300025942 Ga0207689_10239719 Ga0207689_102397192 298
166 3300028381 Ga0268264_10042918 Ga0268264_100429183 298
167 3300005343 Ga0070687_100145189 Ga0070687_1001451892 299
168 3300005355 Ga0070671_100007734 Ga0070671_1000077344 299
169 3300005440 Ga0070705_100040838 Ga0070705_1000408382 299
170 3300005445 Ga0070708_100000828 Ga0070708_10000082815 299
171 3300005467 Ga0070706_100001569 Ga0070706_10000156923 299
172 3300005468 Ga0070707_100012709 Ga0070707_1000127098 299
173 3300005471 Ga0070698_100000852 Ga0070698_10000085218 299
174 3300005536 Ga0070697_100050587 Ga0070697_1000505873 299
175 3300005536 Ga0070697_100073383 Ga0070697_1000733832 299
176 3300005546 Ga0070696_100116957 Ga0070696_1001169572 299
177 3300009176 Ga0105242_10020364 Ga0105242_100203643 299
178 3300013306 Ga0163162_10026011 Ga0163162_100260112 299
179 3300021384 Ga0213876_10040082 Ga0213876_100400822 299
180 3300025910 Ga0207684_10002329 Ga0207684_1000232910 299
181 3300026075 Ga0207708_10081249 Ga0207708_100812492 299
182 3300039437 Ga0436365_0318622 Ga0436365_0318622_5235_6203 299
183 3300046519 Ga0495632_0011400 Ga0495632_0011400_4179_5147 299
184 3300046525 Ga0495663_0000580 Ga0495663_0000580_8901_9908 299
185 3300005334 Ga0068869_100041800 Ga0068869_1000418003 300
186 3300005336 Ga0070680_100087726 Ga0070680_1000877262 300
187 3300005337 Ga0070682_100000056 Ga0070682_10000005645 300
188 3300005338 Ga0068868_100013310 Ga0068868_1000133102 300
189 3300005347 Ga0070668_100003549 Ga0070668_1000035494 300
190 3300005367 Ga0070667_100074618 Ga0070667_1000746183 300
191 3300005457 Ga0070662_100108426 Ga0070662_1001084262 300
192 3300005616 Ga0068852_100042378 Ga0068852_1000423782 300
193 3300005618 Ga0068864_100003312 Ga0068864_10000331210 300
194 3300005719 Ga0068861_100068044 Ga0068861_1000680442 300
195 3300005842 Ga0068858_100028815 Ga0068858_1000288153 300
196 3300005843 Ga0068860_100085547 Ga0068860_1000855472 300
197 3300006237 Ga0097621_100029306 Ga0097621_1000293062 300
198 3300006358 Ga0068871_100011643 Ga0068871_1000116433 300
199 3300009177 Ga0105248_10008275 Ga0105248_100082759 300
200 3300009553 Ga0105249_10000118 Ga0105249_1000011895 300
201 3300013297 Ga0157378_10003138 Ga0157378_1000313810 300
202 3300013306 Ga0163162_10000059 Ga0163162_1000005915 300
203 3300013306 Ga0163162_10002421 Ga0163162_100024215 300
204 3300013308 Ga0157375_10072983 Ga0157375_100729831 300
205 3300013308 Ga0157375_10094512 Ga0157375_100945123 300
206 3300013308 Ga0157375_10204226 Ga0157375_102042261 300
207 3300014325 Ga0163163_10003070 Ga0163163_100030702 300
208 3300014325 Ga0163163_10022227 Ga0163163_100222274 300
209 3300014325 Ga0163163_10123994 Ga0163163_101239942 300
210 3300014326 Ga0157380_10017324 Ga0157380_100173244 300
211 3300014968 Ga0157379_10192143 Ga0157379_101921431 300
212 3300025941 Ga0207711_10043390 Ga0207711_100433903 300
213 3300025941 Ga0207711_10377665 Ga0207711_103776652 300
214 3300025942 Ga0207689_10025850 Ga0207689_100258502 300
215 3300025961 Ga0207712_10000106 Ga0207712_1000010649 300
216 3300025972 Ga0207668_10007620 Ga0207668_100076203 300
217 3300026023 Ga0207677_10034723 Ga0207677_100347232 300
218 3300026035 Ga0207703_10029078 Ga0207703_100290783 300
219 3300026089 Ga0207648_10050123 Ga0207648_100501232 300
220 3300026095 Ga0207676_10145268 Ga0207676_101452682 300
221 3300028379 Ga0268266_10042660 Ga0268266_100426603 300
222 3300028381 Ga0268264_10117639 Ga0268264_101176392 300
223 3300042435 Ga0439434_0008165 Ga0439434_0008165_972_1985 300
224 3300005344 Ga0070661_100023106 Ga0070661_1000231063 301
225 3300005366 Ga0070659_100002005 Ga0070659_1000020055 301
226 3300005458 Ga0070681_10004597 Ga0070681_100045976 301
227 3300005530 Ga0070679_100005246 Ga0070679_1000052463 301
228 3300005535 Ga0070684_100272562 Ga0070684_1002725622 301
229 3300005539 Ga0068853_100004734 Ga0068853_1000047342 301
230 3300005564 Ga0070664_100000648 Ga0070664_10000064817 301
231 3300005577 Ga0068857_100002248 Ga0068857_10000224810 301
232 3300005618 Ga0068864_100006867 Ga0068864_1000068676 301
233 3300005618 Ga0068864_100031323 Ga0068864_1000313234 301
234 3300009147 Ga0114129_10175606 Ga0114129_101756062 301
235 3300013100 Ga0157373_10004621 Ga0157373_100046213 301
236 3300014325 Ga0163163_10037791 Ga0163163_100377913 301
237 3300025912 Ga0207707_10003977 Ga0207707_1000397710 301
238 3300025921 Ga0207652_10035029 Ga0207652_100350294 301
239 3300025925 Ga0207650_10156070 Ga0207650_101560702 301
240 3300025932 Ga0207690_10049981 Ga0207690_100499813 301
241 3300026041 Ga0207639_10140583 Ga0207639_101405832 301
242 3300026088 Ga0207641_10109611 Ga0207641_101096112 301
243 3300026089 Ga0207648_10225840 Ga0207648_102258402 301
244 3300026095 Ga0207676_10027152 Ga0207676_100271523 301
245 3300026116 Ga0207674_10000216 Ga0207674_1000021617 301
246 3300050507 nmdc:mga05p37_220422_c1 nmdc:mga05p37_220422_c1_1112_2125 301
247 3300002074 JGI24748J21848_1000011 JGI24748J21848_100001114 309
248 3300002239 JGI24034J26672_10000037 JGI24034J26672_1000003716 309
249 3300005459 Ga0068867_100167555 Ga0068867_1001675552 309
250 3300005468 Ga0070707_100030833 Ga0070707_1000308334 309
251 3300005471 Ga0070698_100043528 Ga0070698_1000435282 309
252 3300005842 Ga0068858_100000052 Ga0068858_10000005211 309
253 3300005843 Ga0068860_100182369 Ga0068860_1001823692 309
254 3300009101 Ga0105247_10000003 Ga0105247_10000003470 309
255 3300009147 Ga0114129_10300585 Ga0114129_103005852 309
256 3300013297 Ga0157378_10059926 Ga0157378_100599262 309
257 3300025223 Ga0207672_1000060 Ga0207672_100006012 309
258 3300025900 Ga0207710_10000001 Ga0207710_10000001840 309
259 3300026035 Ga0207703_10000055 Ga0207703_10000055124 309
260 3300050507 nmdc:mga05p37_75695_c1 nmdc:mga05p37_75695_c1_79_1017 309
261 3300053083 Ga0495655_0042982 Ga0495655_0042982_86_1087 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02873

MurB_C

UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain

209

311

0.95

PF01565

FAD_binding_4

FAD binding domain

55

175

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6evj-assembly2.cif.gz_E crystal structure of bat influenza a/h17n10 polymerase with viral rna promoter and capped rna primer 0.5503 196 231
6evj-assembly1.cif.gz_B crystal structure of bat influenza a/h17n10 polymerase with viral rna promoter and capped rna primer 0.5495 196 231
2w45-assembly2.cif.gz_B epstein-barr virus alkaline nuclease 0.5485 185 211
3eyc-assembly2.cif.gz_B new crystal structure of human tear lipocalin in complex with 1,4-butanediol in space group p21 0.5482 185 214
5a96-assembly1.cif.gz_A crystal structure of lymantria dispar cpv14 polyhedra 0.5481 195 229
ID Description Score Start End Superfamily
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.8572 227 306 3.90.78.10
3tx1A01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8515 21 94 3.30.43.10
af_P9WJL9_7_87_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.8163 20 89 3.30.43.10
2fugZ00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;NADH-quinone oxidoreductase, subunit 15 0.8096 3 29 3.30.920.80
4pytA01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.7878 9 89 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A838MYK6-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase C-terminal domain-containing protein 0.8869 228 306 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0050660
GO:0051301
GO:0071555
AF-A0A6C9IKC9-F1-model_v4 deleted 0.8613 10 113
AF-A0A7W0GT07-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase C-terminal domain-containing protein 0.8593 219 306 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0050660
GO:0051301
GO:0071555
AF-A0A7V0PJI8-F1-model_v4 FAD-binding protein 0.8436 12 102 GO:0005829
GO:0008762
GO:0071555
GO:0071949
AF-A0A354M6U8-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.8421 10 96 GO:0005829
GO:0008762
GO:0071555
GO:0071949

Feature Viewer

pLDDT pTM Quality
75 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map