F370346
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 261 | 149 | 261 | 314 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10094512|Ga0157375_100945123 |
| Length | 344 |
| Sequence | MTSAAKLKMESEALGTLDFRERDEAIQEIASRLNVSAERGRRFAELTSLRVGGAIDWVIAPETEEQAAAVVQAMDQARVAWRALGSGSNVLADDQDHHYVVLSLKELKGEPVFDGERVSVSAGYSLPRLCIDAARRGLAGIVGGALWMNAGAYDHEIGTVTESVRVARDGQVVAVPGREIKWDYRHTSFREGELLLGATLRLRPDEVEKIQERMEKAKTQRLATQPHGARSAGCFFKNPPNSTTGTGKMIDDLGMKGSRRGGAVVSPKHANFIVTEGDNAQAADALALAEEIRERVKREHGIDLEYEVELWRSQPLTGPGEVSTAGDSGRVVPAIDPQEGDKRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 118 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 119 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 127 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 128 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 129 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 130 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 134 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 135 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 136 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 137 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 138 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 139 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 140 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 141 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 142 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 143 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 144 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.77 |
| Rhizosphere | 98.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000011 | 3300002074 | Bacteria | 157004 |
| 2 | JGI24034J26672_10000037 | 3300002239 | Bacteria | 76023 |
| 3 | JGI25406J46586_10016881 | 3300003203 | Bacteria | 3031 |
| 4 | Ga0065707_10005614 | 3300005295 | Bacteria | 4314 |
| 5 | Ga0065707_10008949 | 3300005295 | Bacteria | 3792 |
| 6 | Ga0065707_10154291 | 3300005295 | Bacteria | 1624 |
| 7 | Ga0065707_10173941 | 3300005295 | Unclassified | 1464 |
| 8 | Ga0070690_100057867 | 3300005330 | Bacteria | 2488 |
| 9 | Ga0068869_100041800 | 3300005334 | Bacteria | 3283 |
| 10 | Ga0068869_100258607 | 3300005334 | Bacteria | 1393 |
| 11 | Ga0070680_100087726 | 3300005336 | Bacteria | 2573 |
| 12 | Ga0070682_100000056 | 3300005337 | Bacteria | 108991 |
| 13 | Ga0070682_100015152 | 3300005337 | Bacteria | 4463 |
| 14 | Ga0068868_100013310 | 3300005338 | Bacteria | 6029 |
| 15 | Ga0070689_100097338 | 3300005340 | Bacteria | 2326 |
| 16 | Ga0070687_100145189 | 3300005343 | Unclassified | 1386 |
| 17 | Ga0070661_100023106 | 3300005344 | Bacteria | 4456 |
| 18 | Ga0070692_10006514 | 3300005345 | Bacteria | 5076 |
| 19 | Ga0070668_100003549 | 3300005347 | Bacteria | 11506 |
| 20 | Ga0070671_100007734 | 3300005355 | Bacteria | 8586 |
| 21 | Ga0070673_100041517 | 3300005364 | Bacteria | 3539 |
| 22 | Ga0070659_100002005 | 3300005366 | Bacteria | 14544 |
| 23 | Ga0070659_100183085 | 3300005366 | Bacteria | 1720 |
| 24 | Ga0070667_100074618 | 3300005367 | Bacteria | 2894 |
| 25 | Ga0070703_10000148 | 3300005406 | Bacteria | 36116 |
| 26 | Ga0070705_100040838 | 3300005440 | Bacteria | 2641 |
| 27 | Ga0070705_100100701 | 3300005440 | Bacteria | 1824 |
| 28 | Ga0070705_100103131 | 3300005440 | Bacteria | 1806 |
| 29 | Ga0070700_100000244 | 3300005441 | Bacteria | 29748 |
| 30 | Ga0070694_100001163 | 3300005444 | Bacteria | 15147 |
| 31 | Ga0070694_100015247 | 3300005444 | Bacteria | 4822 |
| 32 | Ga0070694_100067559 | 3300005444 | Bacteria | 2454 |
| 33 | Ga0070708_100000828 | 3300005445 | Bacteria | 23303 |
| 34 | Ga0070708_100208872 | 3300005445 | Bacteria | 1829 |
| 35 | Ga0070662_100108426 | 3300005457 | Bacteria | 2112 |
| 36 | Ga0070681_10004597 | 3300005458 | Bacteria | 13180 |
| 37 | Ga0068867_100035581 | 3300005459 | Bacteria | 3613 |
| 38 | Ga0068867_100167555 | 3300005459 | Bacteria | 1737 |
| 39 | Ga0070706_100001569 | 3300005467 | Bacteria | 23870 |
| 40 | Ga0070706_100030921 | 3300005467 | Unclassified | 4936 |
| 41 | Ga0070706_100145049 | 3300005467 | Bacteria | 2217 |
| 42 | Ga0070707_100000659 | 3300005468 | Bacteria | 34403 |
| 43 | Ga0070707_100012709 | 3300005468 | Bacteria | 7861 |
| 44 | Ga0070707_100030833 | 3300005468 | Bacteria | 5107 |
| 45 | Ga0070707_100109711 | 3300005468 | Bacteria | 2676 |
| 46 | Ga0070698_100000852 | 3300005471 | Bacteria | 33433 |
| 47 | Ga0070698_100026096 | 3300005471 | Bacteria | 6084 |
| 48 | Ga0070698_100043528 | 3300005471 | Bacteria | 4602 |
| 49 | Ga0070698_100079647 | 3300005471 | Bacteria | 3272 |
| 50 | Ga0070698_100138112 | 3300005471 | Bacteria | 2390 |
| 51 | Ga0070699_100066882 | 3300005518 | Unclassified | 3121 |
| 52 | Ga0070699_100097311 | 3300005518 | Bacteria | 2578 |
| 53 | Ga0070699_100143253 | 3300005518 | Bacteria | 2111 |
| 54 | Ga0070679_100005246 | 3300005530 | Bacteria | 11992 |
| 55 | Ga0070684_100272562 | 3300005535 | Bacteria | 1549 |
| 56 | Ga0070697_100005288 | 3300005536 | Bacteria | 9911 |
| 57 | Ga0070697_100021012 | 3300005536 | Bacteria | 5168 |
| 58 | Ga0070697_100050587 | 3300005536 | Bacteria | 3374 |
| 59 | Ga0070697_100073383 | 3300005536 | Bacteria | 2809 |
| 60 | Ga0068853_100004734 | 3300005539 | Bacteria | 10568 |
| 61 | Ga0070686_100024548 | 3300005544 | Unclassified | 3615 |
| 62 | Ga0070686_100097896 | 3300005544 | Bacteria | 1976 |
| 63 | Ga0070696_100058241 | 3300005546 | Bacteria | 2698 |
| 64 | Ga0070696_100116957 | 3300005546 | Unclassified | 1926 |
| 65 | Ga0070696_100119502 | 3300005546 | Unclassified | 1906 |
| 66 | Ga0070696_100222264 | 3300005546 | Bacteria | 1417 |
| 67 | Ga0070693_100029190 | 3300005547 | Unclassified | 3006 |
| 68 | Ga0070704_100000663 | 3300005549 | Bacteria | 16621 |
| 69 | Ga0070704_100022292 | 3300005549 | Bacteria | 4120 |
| 70 | Ga0070704_100305641 | 3300005549 | Unclassified | 1327 |
| 71 | Ga0070664_100000648 | 3300005564 | Bacteria | 26692 |
| 72 | Ga0070664_100052265 | 3300005564 | Bacteria | 3460 |
| 73 | Ga0068857_100002248 | 3300005577 | Bacteria | 15713 |
| 74 | Ga0068854_100203103 | 3300005578 | Bacteria | 1559 |
| 75 | Ga0070702_100029195 | 3300005615 | Bacteria | 2996 |
| 76 | Ga0068852_100042378 | 3300005616 | Bacteria | 3854 |
| 77 | Ga0068859_100028567 | 3300005617 | Bacteria | 5592 |
| 78 | Ga0068859_100035321 | 3300005617 | Bacteria | 5016 |
| 79 | Ga0068859_100141191 | 3300005617 | Bacteria | 2482 |
| 80 | Ga0068864_100003312 | 3300005618 | Bacteria | 13309 |
| 81 | Ga0068864_100006867 | 3300005618 | Bacteria | 9324 |
| 82 | Ga0068864_100031323 | 3300005618 | Bacteria | 4512 |
| 83 | Ga0068864_100181159 | 3300005618 | Bacteria | 1926 |
| 84 | Ga0068861_100003664 | 3300005719 | Bacteria | 10247 |
| 85 | Ga0068861_100068044 | 3300005719 | Bacteria | 2750 |
| 86 | Ga0068858_100000052 | 3300005842 | Bacteria | 119935 |
| 87 | Ga0068858_100028815 | 3300005842 | Bacteria | 5156 |
| 88 | Ga0068858_100186660 | 3300005842 | Bacteria | 1958 |
| 89 | Ga0068860_100085547 | 3300005843 | Bacteria | 3001 |
| 90 | Ga0068860_100182369 | 3300005843 | Unclassified | 2029 |
| 91 | Ga0068862_100030520 | 3300005844 | Bacteria | 4543 |
| 92 | Ga0068862_100139599 | 3300005844 | Bacteria | 2150 |
| 93 | Ga0081539_10000886 | 3300005985 | Bacteria | 57243 |
| 94 | Ga0070716_100000014 | 3300006173 | Bacteria | 92762 |
| 95 | Ga0070716_100108880 | 3300006173 | Bacteria | 1713 |
| 96 | Ga0097621_100029306 | 3300006237 | Bacteria | 4346 |
| 97 | Ga0068871_100011643 | 3300006358 | Bacteria | 6458 |
| 98 | Ga0075428_100121545 | 3300006844 | Bacteria | 2843 |
| 99 | Ga0075431_100341192 | 3300006847 | Bacteria | 1507 |
| 100 | Ga0075433_10066307 | 3300006852 | Bacteria | 3167 |
| 101 | Ga0075433_10140911 | 3300006852 | Unclassified | 2143 |
| 102 | Ga0075433_10335581 | 3300006852 | Bacteria | 1336 |
| 103 | Ga0075434_100019992 | 3300006871 | Bacteria | 6486 |
| 104 | Ga0075429_100049411 | 3300006880 | Bacteria | 3657 |
| 105 | Ga0068865_100099617 | 3300006881 | Bacteria | 2125 |
| 106 | Ga0075436_100000052 | 3300006914 | Bacteria | 70308 |
| 107 | Ga0075436_100194626 | 3300006914 | Bacteria | 1435 |
| 108 | Ga0097620_100028567 | 3300006931 | Bacteria | 5592 |
| 109 | Ga0097620_100035321 | 3300006931 | Bacteria | 5016 |
| 110 | Ga0097620_100141191 | 3300006931 | Bacteria | 2482 |
| 111 | Ga0075435_100080927 | 3300007076 | Bacteria | 2668 |
| 112 | Ga0099794_10002245 | 3300007265 | Bacteria | 7075 |
| 113 | Ga0111539_10013513 | 3300009094 | Bacteria | 10204 |
| 114 | Ga0111539_10104293 | 3300009094 | Bacteria | 3327 |
| 115 | Ga0105245_10045425 | 3300009098 | Bacteria | 3923 |
| 116 | Ga0105247_10000003 | 3300009101 | Bacteria | 694517 |
| 117 | Ga0105247_10076741 | 3300009101 | Bacteria | 2098 |
| 118 | Ga0114129_10014441 | 3300009147 | Bacteria | 11254 |
| 119 | Ga0114129_10094122 | 3300009147 | Bacteria | 4150 |
| 120 | Ga0114129_10175606 | 3300009147 | Unclassified | 2918 |
| 121 | Ga0114129_10300585 | 3300009147 | Unclassified | 2139 |
| 122 | Ga0105243_10000427 | 3300009148 | Bacteria | 44095 |
| 123 | Ga0105243_10001156 | 3300009148 | Bacteria | 23918 |
| 124 | Ga0105243_10096120 | 3300009148 | Bacteria | 2450 |
| 125 | Ga0105243_10242589 | 3300009148 | Bacteria | 1604 |
| 126 | Ga0105241_10086710 | 3300009174 | Bacteria | 2462 |
| 127 | Ga0105242_10000055 | 3300009176 | Bacteria | 76298 |
| 128 | Ga0105242_10020364 | 3300009176 | Bacteria | 5199 |
| 129 | Ga0105242_10032338 | 3300009176 | Bacteria | 4183 |
| 130 | Ga0105242_10239648 | 3300009176 | Bacteria | 1630 |
| 131 | Ga0105248_10008275 | 3300009177 | Bacteria | 11428 |
| 132 | Ga0105248_10010968 | 3300009177 | Bacteria | 9999 |
| 133 | Ga0105248_10059636 | 3300009177 | Bacteria | 4286 |
| 134 | Ga0105248_10366907 | 3300009177 | Bacteria | 1621 |
| 135 | Ga0105237_10000403 | 3300009545 | Bacteria | 61490 |
| 136 | Ga0105249_10000118 | 3300009553 | Bacteria | 107887 |
| 137 | Ga0105239_10032710 | 3300010375 | Bacteria | 5715 |
| 138 | Ga0157373_10004621 | 3300013100 | Bacteria | 10359 |
| 139 | Ga0157373_10007186 | 3300013100 | Bacteria | 8310 |
| 140 | Ga0157378_10000306 | 3300013297 | Bacteria | 47715 |
| 141 | Ga0157378_10003138 | 3300013297 | Bacteria | 14688 |
| 142 | Ga0157378_10032090 | 3300013297 | Bacteria | 4639 |
| 143 | Ga0157378_10059926 | 3300013297 | Bacteria | 3397 |
| 144 | Ga0157378_10111367 | 3300013297 | Unclassified | 2510 |
| 145 | Ga0163162_10000059 | 3300013306 | Bacteria | 107864 |
| 146 | Ga0163162_10002421 | 3300013306 | Bacteria | 17570 |
| 147 | Ga0163162_10026011 | 3300013306 | Bacteria | 5783 |
| 148 | Ga0163162_10040571 | 3300013306 | Bacteria | 4655 |
| 149 | Ga0163162_10049158 | 3300013306 | Bacteria | 4227 |
| 150 | Ga0163162_10055597 | 3300013306 | Bacteria | 3985 |
| 151 | Ga0163162_10060582 | 3300013306 | Bacteria | 3821 |
| 152 | Ga0157372_10321371 | 3300013307 | Unclassified | 1802 |
| 153 | Ga0157375_10049653 | 3300013308 | Bacteria | 4112 |
| 154 | Ga0157375_10072983 | 3300013308 | Unclassified | 3450 |
| 155 | Ga0157375_10094512 | 3300013308 | Unclassified | 3058 |
| 156 | Ga0157375_10204226 | 3300013308 | Bacteria | 2132 |
| 157 | Ga0157375_10551478 | 3300013308 | Bacteria | 1314 |
| 158 | Ga0163163_10003070 | 3300014325 | Bacteria | 14133 |
| 159 | Ga0163163_10022227 | 3300014325 | Bacteria | 6001 |
| 160 | Ga0163163_10037791 | 3300014325 | Bacteria | 4698 |
| 161 | Ga0163163_10123994 | 3300014325 | Bacteria | 2620 |
| 162 | Ga0157380_10017324 | 3300014326 | Bacteria | 5330 |
| 163 | Ga0157379_10071494 | 3300014968 | Bacteria | 3103 |
| 164 | Ga0157379_10192143 | 3300014968 | Bacteria | 1845 |
| 165 | Ga0213876_10040082 | 3300021384 | Bacteria | 2474 |
| 166 | Ga0207672_1000060 | 3300025223 | Bacteria | 14472 |
| 167 | Ga0207653_10000205 | 3300025885 | Bacteria | 40042 |
| 168 | Ga0207653_10003397 | 3300025885 | Bacteria | 5027 |
| 169 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 170 | Ga0207684_10002329 | 3300025910 | Bacteria | 19247 |
| 171 | Ga0207707_10003977 | 3300025912 | Bacteria | 13121 |
| 172 | Ga0207671_10002799 | 3300025914 | Bacteria | 18183 |
| 173 | Ga0207662_10133854 | 3300025918 | Unclassified | 1565 |
| 174 | Ga0207652_10035029 | 3300025921 | Bacteria | 4235 |
| 175 | Ga0207652_10289152 | 3300025921 | Bacteria | 1479 |
| 176 | Ga0207646_10000702 | 3300025922 | Bacteria | 43444 |
| 177 | Ga0207650_10156070 | 3300025925 | Bacteria | 1805 |
| 178 | Ga0207650_10336349 | 3300025925 | Bacteria | 1239 |
| 179 | Ga0207659_10165650 | 3300025926 | Bacteria | 1739 |
| 180 | Ga0207690_10049981 | 3300025932 | Bacteria | 2789 |
| 181 | Ga0207690_10098593 | 3300025932 | Bacteria | 2082 |
| 182 | Ga0207686_10000038 | 3300025934 | Bacteria | 127610 |
| 183 | Ga0207709_10000017 | 3300025935 | Bacteria | 470753 |
| 184 | Ga0207709_10000054 | 3300025935 | Bacteria | 223290 |
| 185 | Ga0207709_10001548 | 3300025935 | Bacteria | 15803 |
| 186 | Ga0207709_10002971 | 3300025935 | Bacteria | 10334 |
| 187 | Ga0207665_10000029 | 3300025939 | Bacteria | 95174 |
| 188 | Ga0207665_10044008 | 3300025939 | Unclassified | 2987 |
| 189 | Ga0207711_10015979 | 3300025941 | Bacteria | 6227 |
| 190 | Ga0207711_10043390 | 3300025941 | Bacteria | 3835 |
| 191 | Ga0207711_10282226 | 3300025941 | Bacteria | 1530 |
| 192 | Ga0207711_10377665 | 3300025941 | Bacteria | 1315 |
| 193 | Ga0207689_10025850 | 3300025942 | Archaea | 4919 |
| 194 | Ga0207689_10045088 | 3300025942 | Bacteria | 3647 |
| 195 | Ga0207689_10120721 | 3300025942 | Unclassified | 2156 |
| 196 | Ga0207689_10175773 | 3300025942 | Bacteria | 1766 |
| 197 | Ga0207689_10239719 | 3300025942 | Bacteria | 1499 |
| 198 | Ga0207689_10257511 | 3300025942 | Bacteria | 1443 |
| 199 | Ga0207651_10063068 | 3300025960 | Bacteria | 2586 |
| 200 | Ga0207712_10000106 | 3300025961 | Bacteria | 94950 |
| 201 | Ga0207668_10007620 | 3300025972 | Bacteria | 6444 |
| 202 | Ga0207677_10034723 | 3300026023 | Bacteria | 3268 |
| 203 | Ga0207703_10000055 | 3300026035 | Bacteria | 143420 |
| 204 | Ga0207703_10029078 | 3300026035 | Bacteria | 4360 |
| 205 | Ga0207639_10140583 | 3300026041 | Bacteria | 2011 |
| 206 | Ga0207708_10001792 | 3300026075 | Bacteria | 15837 |
| 207 | Ga0207708_10081249 | 3300026075 | Bacteria | 2491 |
| 208 | Ga0207641_10109611 | 3300026088 | Bacteria | 2445 |
| 209 | Ga0207648_10036969 | 3300026089 | Bacteria | 4301 |
| 210 | Ga0207648_10050123 | 3300026089 | Bacteria | 3651 |
| 211 | Ga0207648_10225840 | 3300026089 | Bacteria | 1665 |
| 212 | Ga0207676_10027152 | 3300026095 | Bacteria | 4261 |
| 213 | Ga0207676_10145268 | 3300026095 | Bacteria | 2036 |
| 214 | Ga0207674_10000216 | 3300026116 | Bacteria | 71622 |
| 215 | Ga0207674_10110927 | 3300026116 | Bacteria | 2718 |
| 216 | Ga0207428_10017032 | 3300027907 | Bacteria | 6242 |
| 217 | Ga0268266_10042660 | 3300028379 | Bacteria | 3876 |
| 218 | Ga0268264_10042918 | 3300028381 | Bacteria | 3745 |
| 219 | Ga0268264_10117639 | 3300028381 | Bacteria | 2338 |
| 220 | Ga0268264_10452909 | 3300028381 | Bacteria | 1244 |
| 221 | Ga0307408_100001805 | 3300031548 | Bacteria | 15614 |
| 222 | Ga0307405_10115029 | 3300031731 | Bacteria | 1829 |
| 223 | Ga0307413_10251477 | 3300031824 | Bacteria | 1311 |
| 224 | Ga0307410_10003103 | 3300031852 | Bacteria | 8240 |
| 225 | Ga0307406_10001256 | 3300031901 | Bacteria | 14213 |
| 226 | Ga0307414_10002516 | 3300032004 | Bacteria | 9618 |
| 227 | Ga0373951_0003154 | 3300035091 | Bacteria | 4054 |
| 228 | Ga0373941_0044637 | 3300035115 | Bacteria | 1384 |
| 229 | Ga0373961_0025291 | 3300035241 | Bacteria | 1613 |
| 230 | Ga0395900_0209124 | 3300037418 | Bacteria | 1971 |
| 231 | Ga0395898_0035752 | 3300037466 | Bacteria | 4936 |
| 232 | Ga0242420_000225 | 3300038996 | Bacteria | 6082 |
| 233 | Ga0242420_000725 | 3300038996 | Bacteria | 3950 |
| 234 | Ga0436365_0318622 | 3300039437 | Bacteria | 7679 |
| 235 | Ga0439434_0008165 | 3300042435 | Bacteria | 3068 |
| 236 | Ga0451577_0269509 | 3300042876 | Bacteria | 1542 |
| 237 | Ga0495610_0033114 | 3300046512 | Unclassified | 2675 |
| 238 | Ga0495632_0011400 | 3300046519 | Bacteria | 5188 |
| 239 | Ga0495663_0000580 | 3300046525 | Bacteria | 12852 |
| 240 | Ga0496106_0002178 | 3300048909 | Bacteria | 14639 |
| 241 | Ga0496113_0071634 | 3300048916 | Bacteria | 2636 |
| 242 | Ga0501298_018615 | 3300049521 | Unclassified | 1279 |
| 243 | Ga0501199_004462 | 3300049650 | Bacteria | 1379 |
| 244 | Ga0501202_002672 | 3300049652 | Bacteria | 3010 |
| 245 | Ga0501207_004321 | 3300049654 | Bacteria | 1926 |
| 246 | Ga0501223_000430 | 3300049663 | Bacteria | 10185 |
| 247 | Ga0501227_001934 | 3300049665 | Bacteria | 4600 |
| 248 | Ga0501227_016597 | 3300049665 | Unclassified | 1655 |
| 249 | Ga0501233_001287 | 3300049668 | Bacteria | 4288 |
| 250 | Ga0501257_059350 | 3300049686 | Unclassified | 965 |
| 251 | Ga0501212_012050 | 3300049851 | Unclassified | 1253 |
| 252 | nmdc:mga05p37_220422_c1 | 3300050507 | Bacteria | 2289 |
| 253 | nmdc:mga05p37_64278_c1 | 3300050507 | Bacteria | 4515 |
| 254 | nmdc:mga05p37_75695_c1 | 3300050507 | Archaea | 4143 |
| 255 | nmdc:mga09592_358068_c1 | 3300050508 | Bacteria | 1263 |
| 256 | nmdc:mga08y16_146860_c1 | 3300050511 | Unclassified | 2452 |
| 257 | nmdc:mga08y16_189965_c1 | 3300050511 | Unclassified | 1707 |
| 258 | nmdc:mga08y16_77890_c1 | 3300050511 | Bacteria | 3456 |
| 259 | nmdc:mga08x19_106_c1 | 3300050514 | Bacteria | 74458 |
| 260 | nmdc:mga0a205_263250_c1 | 3300050515 | Bacteria | 1602 |
| 261 | Ga0495655_0042982 | 3300053083 | Bacteria | 1163 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046512 | Ga0495610_0033114 | Ga0495610_0033114_1775_2665 | 265 |
| 2 | 3300013306 | Ga0163162_10060582 | Ga0163162_100605823 | 275 |
| 3 | 3300049686 | Ga0501257_059350 | Ga0501257_059350_48_953 | 275 |
| 4 | 3300005518 | Ga0070699_100097311 | Ga0070699_1000973112 | 281 |
| 5 | 3300005578 | Ga0068854_100203103 | Ga0068854_1002031032 | 283 |
| 6 | 3300005618 | Ga0068864_100181159 | Ga0068864_1001811592 | 285 |
| 7 | 3300025942 | Ga0207689_10120721 | Ga0207689_101207212 | 285 |
| 8 | 3300005340 | Ga0070689_100097338 | Ga0070689_1000973382 | 286 |
| 9 | 3300005440 | Ga0070705_100103131 | Ga0070705_1001031312 | 286 |
| 10 | 3300005544 | Ga0070686_100024548 | Ga0070686_1000245482 | 286 |
| 11 | 3300025921 | Ga0207652_10289152 | Ga0207652_102891522 | 286 |
| 12 | 3300009174 | Ga0105241_10086710 | Ga0105241_100867102 | 287 |
| 13 | 3300005295 | Ga0065707_10005614 | Ga0065707_100056141 | 289 |
| 14 | 3300005441 | Ga0070700_100000244 | Ga0070700_10000024434 | 289 |
| 15 | 3300005471 | Ga0070698_100138112 | Ga0070698_1001381122 | 289 |
| 16 | 3300005518 | Ga0070699_100143253 | Ga0070699_1001432532 | 289 |
| 17 | 3300005536 | Ga0070697_100021012 | Ga0070697_1000210121 | 289 |
| 18 | 3300009094 | Ga0111539_10013513 | Ga0111539_100135133 | 289 |
| 19 | 3300009101 | Ga0105247_10076741 | Ga0105247_100767411 | 289 |
| 20 | 3300009177 | Ga0105248_10010968 | Ga0105248_100109685 | 289 |
| 21 | 3300025941 | Ga0207711_10015979 | Ga0207711_100159792 | 289 |
| 22 | 3300026075 | Ga0207708_10001792 | Ga0207708_1000179210 | 289 |
| 23 | 3300027907 | Ga0207428_10017032 | Ga0207428_100170324 | 289 |
| 24 | 3300031548 | Ga0307408_100001805 | Ga0307408_10000180511 | 289 |
| 25 | 3300031731 | Ga0307405_10115029 | Ga0307405_101150291 | 289 |
| 26 | 3300031824 | Ga0307413_10251477 | Ga0307413_102514772 | 289 |
| 27 | 3300031852 | Ga0307410_10003103 | Ga0307410_100031036 | 289 |
| 28 | 3300031901 | Ga0307406_10001256 | Ga0307406_1000125610 | 289 |
| 29 | 3300032004 | Ga0307414_10002516 | Ga0307414_1000251610 | 289 |
| 30 | 3300035115 | Ga0373941_0044637 | Ga0373941_0044637_181_1140 | 289 |
| 31 | 3300035241 | Ga0373961_0025291 | Ga0373961_0025291_282_1241 | 289 |
| 32 | 3300049650 | Ga0501199_004462 | Ga0501199_004462_114_1076 | 289 |
| 33 | 3300049652 | Ga0501202_002672 | Ga0501202_002672_649_1611 | 289 |
| 34 | 3300049654 | Ga0501207_004321 | Ga0501207_004321_929_1891 | 289 |
| 35 | 3300049663 | Ga0501223_000430 | Ga0501223_000430_7303_8265 | 289 |
| 36 | 3300049665 | Ga0501227_001934 | Ga0501227_001934_1525_2487 | 289 |
| 37 | 3300049668 | Ga0501233_001287 | Ga0501233_001287_2273_3235 | 289 |
| 38 | 3300050511 | nmdc:mga08y16_146860_c1 | nmdc:mga08y16_146860_c1_434_1369 | 289 |
| 39 | 3300005549 | Ga0070704_100022292 | Ga0070704_1000222922 | 291 |
| 40 | 3300005844 | Ga0068862_100139599 | Ga0068862_1001395992 | 291 |
| 41 | 3300009147 | Ga0114129_10094122 | Ga0114129_100941223 | 291 |
| 42 | 3300009177 | Ga0105248_10366907 | Ga0105248_103669071 | 291 |
| 43 | 3300013100 | Ga0157373_10007186 | Ga0157373_100071867 | 291 |
| 44 | 3300013306 | Ga0163162_10049158 | Ga0163162_100491583 | 291 |
| 45 | 3300025918 | Ga0207662_10133854 | Ga0207662_101338542 | 291 |
| 46 | 3300025941 | Ga0207711_10282226 | Ga0207711_102822261 | 291 |
| 47 | 3300037418 | Ga0395900_0209124 | Ga0395900_0209124_156_1157 | 291 |
| 48 | 3300037466 | Ga0395898_0035752 | Ga0395898_0035752_3203_4204 | 291 |
| 49 | 3300003203 | JGI25406J46586_10016881 | JGI25406J46586_100168812 | 292 |
| 50 | 3300005334 | Ga0068869_100258607 | Ga0068869_1002586072 | 292 |
| 51 | 3300005459 | Ga0068867_100035581 | Ga0068867_1000355812 | 292 |
| 52 | 3300005467 | Ga0070706_100145049 | Ga0070706_1001450492 | 292 |
| 53 | 3300005564 | Ga0070664_100052265 | Ga0070664_1000522652 | 292 |
| 54 | 3300005985 | Ga0081539_10000886 | Ga0081539_1000088635 | 292 |
| 55 | 3300009148 | Ga0105243_10096120 | Ga0105243_100961202 | 292 |
| 56 | 3300009176 | Ga0105242_10239648 | Ga0105242_102396482 | 292 |
| 57 | 3300025935 | Ga0207709_10002971 | Ga0207709_100029712 | 292 |
| 58 | 3300025942 | Ga0207689_10257511 | Ga0207689_102575112 | 292 |
| 59 | 3300026089 | Ga0207648_10036969 | Ga0207648_100369693 | 292 |
| 60 | 3300026116 | Ga0207674_10110927 | Ga0207674_101109272 | 292 |
| 61 | 3300028381 | Ga0268264_10452909 | Ga0268264_104529092 | 292 |
| 62 | 3300005445 | Ga0070708_100208872 | Ga0070708_1002088722 | 293 |
| 63 | 3300050511 | nmdc:mga08y16_189965_c1 | nmdc:mga08y16_189965_c1_16_1023 | 293 |
| 64 | 3300005337 | Ga0070682_100015152 | Ga0070682_1000151524 | 295 |
| 65 | 3300005345 | Ga0070692_10006514 | Ga0070692_100065143 | 295 |
| 66 | 3300005366 | Ga0070659_100183085 | Ga0070659_1001830852 | 295 |
| 67 | 3300005444 | Ga0070694_100015247 | Ga0070694_1000152473 | 295 |
| 68 | 3300005444 | Ga0070694_100067559 | Ga0070694_1000675593 | 295 |
| 69 | 3300005546 | Ga0070696_100119502 | Ga0070696_1001195022 | 295 |
| 70 | 3300005547 | Ga0070693_100029190 | Ga0070693_1000291902 | 295 |
| 71 | 3300005549 | Ga0070704_100305641 | Ga0070704_1003056412 | 295 |
| 72 | 3300005615 | Ga0070702_100029195 | Ga0070702_1000291953 | 295 |
| 73 | 3300005617 | Ga0068859_100028567 | Ga0068859_1000285673 | 295 |
| 74 | 3300005719 | Ga0068861_100003664 | Ga0068861_1000036642 | 295 |
| 75 | 3300005842 | Ga0068858_100186660 | Ga0068858_1001866602 | 295 |
| 76 | 3300006173 | Ga0070716_100000014 | Ga0070716_10000001469 | 295 |
| 77 | 3300006844 | Ga0075428_100121545 | Ga0075428_1001215452 | 295 |
| 78 | 3300006847 | Ga0075431_100341192 | Ga0075431_1003411922 | 295 |
| 79 | 3300006852 | Ga0075433_10066307 | Ga0075433_100663072 | 295 |
| 80 | 3300006871 | Ga0075434_100019992 | Ga0075434_1000199924 | 295 |
| 81 | 3300006931 | Ga0097620_100028567 | Ga0097620_1000285673 | 295 |
| 82 | 3300007076 | Ga0075435_100080927 | Ga0075435_1000809272 | 295 |
| 83 | 3300007265 | Ga0099794_10002245 | Ga0099794_100022455 | 295 |
| 84 | 3300009094 | Ga0111539_10104293 | Ga0111539_101042932 | 295 |
| 85 | 3300009098 | Ga0105245_10045425 | Ga0105245_100454252 | 295 |
| 86 | 3300009148 | Ga0105243_10242589 | Ga0105243_102425892 | 295 |
| 87 | 3300009545 | Ga0105237_10000403 | Ga0105237_1000040320 | 295 |
| 88 | 3300010375 | Ga0105239_10032710 | Ga0105239_100327102 | 295 |
| 89 | 3300013306 | Ga0163162_10040571 | Ga0163162_100405714 | 295 |
| 90 | 3300013307 | Ga0157372_10321371 | Ga0157372_103213712 | 295 |
| 91 | 3300013308 | Ga0157375_10551478 | Ga0157375_105514781 | 295 |
| 92 | 3300014968 | Ga0157379_10071494 | Ga0157379_100714943 | 295 |
| 93 | 3300025885 | Ga0207653_10003397 | Ga0207653_100033973 | 295 |
| 94 | 3300025914 | Ga0207671_10002799 | Ga0207671_100027992 | 295 |
| 95 | 3300025925 | Ga0207650_10336349 | Ga0207650_103363491 | 295 |
| 96 | 3300025932 | Ga0207690_10098593 | Ga0207690_100985932 | 295 |
| 97 | 3300025939 | Ga0207665_10000029 | Ga0207665_1000002928 | 295 |
| 98 | 3300025942 | Ga0207689_10045088 | Ga0207689_100450882 | 295 |
| 99 | 3300035091 | Ga0373951_0003154 | Ga0373951_0003154_2185_3201 | 295 |
| 100 | 3300038996 | Ga0242420_000225 | Ga0242420_000225_800_1891 | 295 |
| 101 | 3300038996 | Ga0242420_000725 | Ga0242420_000725_877_1812 | 295 |
| 102 | 3300042876 | Ga0451577_0269509 | Ga0451577_0269509_514_1449 | 295 |
| 103 | 3300048916 | Ga0496113_0071634 | Ga0496113_0071634_1489_2457 | 295 |
| 104 | 3300049521 | Ga0501298_018615 | Ga0501298_018615_258_1232 | 295 |
| 105 | 3300049665 | Ga0501227_016597 | Ga0501227_016597_325_1299 | 295 |
| 106 | 3300049851 | Ga0501212_012050 | Ga0501212_012050_248_1222 | 295 |
| 107 | 3300050508 | nmdc:mga09592_358068_c1 | nmdc:mga09592_358068_c1_42_1049 | 295 |
| 108 | 3300050511 | nmdc:mga08y16_77890_c1 | nmdc:mga08y16_77890_c1_955_1929 | 295 |
| 109 | 3300005295 | Ga0065707_10008949 | Ga0065707_100089493 | 296 |
| 110 | 3300005330 | Ga0070690_100057867 | Ga0070690_1000578672 | 296 |
| 111 | 3300005364 | Ga0070673_100041517 | Ga0070673_1000415172 | 296 |
| 112 | 3300005406 | Ga0070703_10000148 | Ga0070703_1000014834 | 296 |
| 113 | 3300005444 | Ga0070694_100001163 | Ga0070694_1000011639 | 296 |
| 114 | 3300005471 | Ga0070698_100079647 | Ga0070698_1000796472 | 296 |
| 115 | 3300005544 | Ga0070686_100097896 | Ga0070686_1000978962 | 296 |
| 116 | 3300005617 | Ga0068859_100141191 | Ga0068859_1001411912 | 296 |
| 117 | 3300005844 | Ga0068862_100030520 | Ga0068862_1000305203 | 296 |
| 118 | 3300006173 | Ga0070716_100108880 | Ga0070716_1001088802 | 296 |
| 119 | 3300006880 | Ga0075429_100049411 | Ga0075429_1000494111 | 296 |
| 120 | 3300006881 | Ga0068865_100099617 | Ga0068865_1000996171 | 296 |
| 121 | 3300006914 | Ga0075436_100000052 | Ga0075436_10000005233 | 296 |
| 122 | 3300006914 | Ga0075436_100194626 | Ga0075436_1001946262 | 296 |
| 123 | 3300006931 | Ga0097620_100141191 | Ga0097620_1001411912 | 296 |
| 124 | 3300009148 | Ga0105243_10000427 | Ga0105243_100004273 | 296 |
| 125 | 3300009148 | Ga0105243_10001156 | Ga0105243_1000115623 | 296 |
| 126 | 3300009176 | Ga0105242_10000055 | Ga0105242_1000005545 | 296 |
| 127 | 3300009176 | Ga0105242_10032338 | Ga0105242_100323383 | 296 |
| 128 | 3300009177 | Ga0105248_10059636 | Ga0105248_100596363 | 296 |
| 129 | 3300013297 | Ga0157378_10000306 | Ga0157378_1000030641 | 296 |
| 130 | 3300013297 | Ga0157378_10032090 | Ga0157378_100320905 | 296 |
| 131 | 3300013297 | Ga0157378_10111367 | Ga0157378_101113672 | 296 |
| 132 | 3300013308 | Ga0157375_10049653 | Ga0157375_100496533 | 296 |
| 133 | 3300025885 | Ga0207653_10000205 | Ga0207653_1000020511 | 296 |
| 134 | 3300025926 | Ga0207659_10165650 | Ga0207659_101656502 | 296 |
| 135 | 3300025934 | Ga0207686_10000038 | Ga0207686_1000003868 | 296 |
| 136 | 3300025935 | Ga0207709_10000017 | Ga0207709_1000001761 | 296 |
| 137 | 3300025935 | Ga0207709_10000054 | Ga0207709_1000005461 | 296 |
| 138 | 3300025935 | Ga0207709_10001548 | Ga0207709_100015484 | 296 |
| 139 | 3300025939 | Ga0207665_10044008 | Ga0207665_100440082 | 296 |
| 140 | 3300025942 | Ga0207689_10175773 | Ga0207689_101757732 | 296 |
| 141 | 3300025960 | Ga0207651_10063068 | Ga0207651_100630682 | 296 |
| 142 | 3300048909 | Ga0496106_0002178 | Ga0496106_0002178_3084_4019 | 296 |
| 143 | 3300050514 | nmdc:mga08x19_106_c1 | nmdc:mga08x19_106_c1_30044_31051 | 296 |
| 144 | 3300005295 | Ga0065707_10173941 | Ga0065707_101739411 | 297 |
| 145 | 3300005468 | Ga0070707_100109711 | Ga0070707_1001097112 | 297 |
| 146 | 3300005536 | Ga0070697_100005288 | Ga0070697_1000052886 | 297 |
| 147 | 3300006852 | Ga0075433_10140911 | Ga0075433_101409112 | 297 |
| 148 | 3300009147 | Ga0114129_10014441 | Ga0114129_100144416 | 297 |
| 149 | 3300050507 | nmdc:mga05p37_64278_c1 | nmdc:mga05p37_64278_c1_1821_2798 | 297 |
| 150 | 3300050515 | nmdc:mga0a205_263250_c1 | nmdc:mga0a205_263250_c1_503_1480 | 297 |
| 151 | 3300005295 | Ga0065707_10154291 | Ga0065707_101542912 | 298 |
| 152 | 3300005440 | Ga0070705_100100701 | Ga0070705_1001007012 | 298 |
| 153 | 3300005467 | Ga0070706_100030921 | Ga0070706_1000309213 | 298 |
| 154 | 3300005468 | Ga0070707_100000659 | Ga0070707_1000006599 | 298 |
| 155 | 3300005471 | Ga0070698_100026096 | Ga0070698_1000260963 | 298 |
| 156 | 3300005518 | Ga0070699_100066882 | Ga0070699_1000668822 | 298 |
| 157 | 3300005546 | Ga0070696_100058241 | Ga0070696_1000582412 | 298 |
| 158 | 3300005546 | Ga0070696_100222264 | Ga0070696_1002222641 | 298 |
| 159 | 3300005549 | Ga0070704_100000663 | Ga0070704_10000066314 | 298 |
| 160 | 3300005617 | Ga0068859_100035321 | Ga0068859_1000353212 | 298 |
| 161 | 3300006852 | Ga0075433_10335581 | Ga0075433_103355812 | 298 |
| 162 | 3300006931 | Ga0097620_100035321 | Ga0097620_1000353212 | 298 |
| 163 | 3300013306 | Ga0163162_10055597 | Ga0163162_100555972 | 298 |
| 164 | 3300025922 | Ga0207646_10000702 | Ga0207646_1000070236 | 298 |
| 165 | 3300025942 | Ga0207689_10239719 | Ga0207689_102397192 | 298 |
| 166 | 3300028381 | Ga0268264_10042918 | Ga0268264_100429183 | 298 |
| 167 | 3300005343 | Ga0070687_100145189 | Ga0070687_1001451892 | 299 |
| 168 | 3300005355 | Ga0070671_100007734 | Ga0070671_1000077344 | 299 |
| 169 | 3300005440 | Ga0070705_100040838 | Ga0070705_1000408382 | 299 |
| 170 | 3300005445 | Ga0070708_100000828 | Ga0070708_10000082815 | 299 |
| 171 | 3300005467 | Ga0070706_100001569 | Ga0070706_10000156923 | 299 |
| 172 | 3300005468 | Ga0070707_100012709 | Ga0070707_1000127098 | 299 |
| 173 | 3300005471 | Ga0070698_100000852 | Ga0070698_10000085218 | 299 |
| 174 | 3300005536 | Ga0070697_100050587 | Ga0070697_1000505873 | 299 |
| 175 | 3300005536 | Ga0070697_100073383 | Ga0070697_1000733832 | 299 |
| 176 | 3300005546 | Ga0070696_100116957 | Ga0070696_1001169572 | 299 |
| 177 | 3300009176 | Ga0105242_10020364 | Ga0105242_100203643 | 299 |
| 178 | 3300013306 | Ga0163162_10026011 | Ga0163162_100260112 | 299 |
| 179 | 3300021384 | Ga0213876_10040082 | Ga0213876_100400822 | 299 |
| 180 | 3300025910 | Ga0207684_10002329 | Ga0207684_1000232910 | 299 |
| 181 | 3300026075 | Ga0207708_10081249 | Ga0207708_100812492 | 299 |
| 182 | 3300039437 | Ga0436365_0318622 | Ga0436365_0318622_5235_6203 | 299 |
| 183 | 3300046519 | Ga0495632_0011400 | Ga0495632_0011400_4179_5147 | 299 |
| 184 | 3300046525 | Ga0495663_0000580 | Ga0495663_0000580_8901_9908 | 299 |
| 185 | 3300005334 | Ga0068869_100041800 | Ga0068869_1000418003 | 300 |
| 186 | 3300005336 | Ga0070680_100087726 | Ga0070680_1000877262 | 300 |
| 187 | 3300005337 | Ga0070682_100000056 | Ga0070682_10000005645 | 300 |
| 188 | 3300005338 | Ga0068868_100013310 | Ga0068868_1000133102 | 300 |
| 189 | 3300005347 | Ga0070668_100003549 | Ga0070668_1000035494 | 300 |
| 190 | 3300005367 | Ga0070667_100074618 | Ga0070667_1000746183 | 300 |
| 191 | 3300005457 | Ga0070662_100108426 | Ga0070662_1001084262 | 300 |
| 192 | 3300005616 | Ga0068852_100042378 | Ga0068852_1000423782 | 300 |
| 193 | 3300005618 | Ga0068864_100003312 | Ga0068864_10000331210 | 300 |
| 194 | 3300005719 | Ga0068861_100068044 | Ga0068861_1000680442 | 300 |
| 195 | 3300005842 | Ga0068858_100028815 | Ga0068858_1000288153 | 300 |
| 196 | 3300005843 | Ga0068860_100085547 | Ga0068860_1000855472 | 300 |
| 197 | 3300006237 | Ga0097621_100029306 | Ga0097621_1000293062 | 300 |
| 198 | 3300006358 | Ga0068871_100011643 | Ga0068871_1000116433 | 300 |
| 199 | 3300009177 | Ga0105248_10008275 | Ga0105248_100082759 | 300 |
| 200 | 3300009553 | Ga0105249_10000118 | Ga0105249_1000011895 | 300 |
| 201 | 3300013297 | Ga0157378_10003138 | Ga0157378_1000313810 | 300 |
| 202 | 3300013306 | Ga0163162_10000059 | Ga0163162_1000005915 | 300 |
| 203 | 3300013306 | Ga0163162_10002421 | Ga0163162_100024215 | 300 |
| 204 | 3300013308 | Ga0157375_10072983 | Ga0157375_100729831 | 300 |
| 205 | 3300013308 | Ga0157375_10094512 | Ga0157375_100945123 | 300 |
| 206 | 3300013308 | Ga0157375_10204226 | Ga0157375_102042261 | 300 |
| 207 | 3300014325 | Ga0163163_10003070 | Ga0163163_100030702 | 300 |
| 208 | 3300014325 | Ga0163163_10022227 | Ga0163163_100222274 | 300 |
| 209 | 3300014325 | Ga0163163_10123994 | Ga0163163_101239942 | 300 |
| 210 | 3300014326 | Ga0157380_10017324 | Ga0157380_100173244 | 300 |
| 211 | 3300014968 | Ga0157379_10192143 | Ga0157379_101921431 | 300 |
| 212 | 3300025941 | Ga0207711_10043390 | Ga0207711_100433903 | 300 |
| 213 | 3300025941 | Ga0207711_10377665 | Ga0207711_103776652 | 300 |
| 214 | 3300025942 | Ga0207689_10025850 | Ga0207689_100258502 | 300 |
| 215 | 3300025961 | Ga0207712_10000106 | Ga0207712_1000010649 | 300 |
| 216 | 3300025972 | Ga0207668_10007620 | Ga0207668_100076203 | 300 |
| 217 | 3300026023 | Ga0207677_10034723 | Ga0207677_100347232 | 300 |
| 218 | 3300026035 | Ga0207703_10029078 | Ga0207703_100290783 | 300 |
| 219 | 3300026089 | Ga0207648_10050123 | Ga0207648_100501232 | 300 |
| 220 | 3300026095 | Ga0207676_10145268 | Ga0207676_101452682 | 300 |
| 221 | 3300028379 | Ga0268266_10042660 | Ga0268266_100426603 | 300 |
| 222 | 3300028381 | Ga0268264_10117639 | Ga0268264_101176392 | 300 |
| 223 | 3300042435 | Ga0439434_0008165 | Ga0439434_0008165_972_1985 | 300 |
| 224 | 3300005344 | Ga0070661_100023106 | Ga0070661_1000231063 | 301 |
| 225 | 3300005366 | Ga0070659_100002005 | Ga0070659_1000020055 | 301 |
| 226 | 3300005458 | Ga0070681_10004597 | Ga0070681_100045976 | 301 |
| 227 | 3300005530 | Ga0070679_100005246 | Ga0070679_1000052463 | 301 |
| 228 | 3300005535 | Ga0070684_100272562 | Ga0070684_1002725622 | 301 |
| 229 | 3300005539 | Ga0068853_100004734 | Ga0068853_1000047342 | 301 |
| 230 | 3300005564 | Ga0070664_100000648 | Ga0070664_10000064817 | 301 |
| 231 | 3300005577 | Ga0068857_100002248 | Ga0068857_10000224810 | 301 |
| 232 | 3300005618 | Ga0068864_100006867 | Ga0068864_1000068676 | 301 |
| 233 | 3300005618 | Ga0068864_100031323 | Ga0068864_1000313234 | 301 |
| 234 | 3300009147 | Ga0114129_10175606 | Ga0114129_101756062 | 301 |
| 235 | 3300013100 | Ga0157373_10004621 | Ga0157373_100046213 | 301 |
| 236 | 3300014325 | Ga0163163_10037791 | Ga0163163_100377913 | 301 |
| 237 | 3300025912 | Ga0207707_10003977 | Ga0207707_1000397710 | 301 |
| 238 | 3300025921 | Ga0207652_10035029 | Ga0207652_100350294 | 301 |
| 239 | 3300025925 | Ga0207650_10156070 | Ga0207650_101560702 | 301 |
| 240 | 3300025932 | Ga0207690_10049981 | Ga0207690_100499813 | 301 |
| 241 | 3300026041 | Ga0207639_10140583 | Ga0207639_101405832 | 301 |
| 242 | 3300026088 | Ga0207641_10109611 | Ga0207641_101096112 | 301 |
| 243 | 3300026089 | Ga0207648_10225840 | Ga0207648_102258402 | 301 |
| 244 | 3300026095 | Ga0207676_10027152 | Ga0207676_100271523 | 301 |
| 245 | 3300026116 | Ga0207674_10000216 | Ga0207674_1000021617 | 301 |
| 246 | 3300050507 | nmdc:mga05p37_220422_c1 | nmdc:mga05p37_220422_c1_1112_2125 | 301 |
| 247 | 3300002074 | JGI24748J21848_1000011 | JGI24748J21848_100001114 | 309 |
| 248 | 3300002239 | JGI24034J26672_10000037 | JGI24034J26672_1000003716 | 309 |
| 249 | 3300005459 | Ga0068867_100167555 | Ga0068867_1001675552 | 309 |
| 250 | 3300005468 | Ga0070707_100030833 | Ga0070707_1000308334 | 309 |
| 251 | 3300005471 | Ga0070698_100043528 | Ga0070698_1000435282 | 309 |
| 252 | 3300005842 | Ga0068858_100000052 | Ga0068858_10000005211 | 309 |
| 253 | 3300005843 | Ga0068860_100182369 | Ga0068860_1001823692 | 309 |
| 254 | 3300009101 | Ga0105247_10000003 | Ga0105247_10000003470 | 309 |
| 255 | 3300009147 | Ga0114129_10300585 | Ga0114129_103005852 | 309 |
| 256 | 3300013297 | Ga0157378_10059926 | Ga0157378_100599262 | 309 |
| 257 | 3300025223 | Ga0207672_1000060 | Ga0207672_100006012 | 309 |
| 258 | 3300025900 | Ga0207710_10000001 | Ga0207710_10000001840 | 309 |
| 259 | 3300026035 | Ga0207703_10000055 | Ga0207703_10000055124 | 309 |
| 260 | 3300050507 | nmdc:mga05p37_75695_c1 | nmdc:mga05p37_75695_c1_79_1017 | 309 |
| 261 | 3300053083 | Ga0495655_0042982 | Ga0495655_0042982_86_1087 | 309 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6evj-assembly2.cif.gz_E | crystal structure of bat influenza a/h17n10 polymerase with viral rna promoter and capped rna primer | 0.5503 | 196 | 231 |
| 6evj-assembly1.cif.gz_B | crystal structure of bat influenza a/h17n10 polymerase with viral rna promoter and capped rna primer | 0.5495 | 196 | 231 |
| 2w45-assembly2.cif.gz_B | epstein-barr virus alkaline nuclease | 0.5485 | 185 | 211 |
| 3eyc-assembly2.cif.gz_B | new crystal structure of human tear lipocalin in complex with 1,4-butanediol in space group p21 | 0.5482 | 185 | 214 |
| 5a96-assembly1.cif.gz_A | crystal structure of lymantria dispar cpv14 polyhedra | 0.5481 | 195 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tx1A03 | Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain | 0.8572 | 227 | 306 | 3.90.78.10 |
| 3tx1A01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.8515 | 21 | 94 | 3.30.43.10 |
| af_P9WJL9_7_87_3.30.43.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.8163 | 20 | 89 | 3.30.43.10 |
| 2fugZ00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;NADH-quinone oxidoreductase, subunit 15 | 0.8096 | 3 | 29 | 3.30.920.80 |
| 4pytA01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.7878 | 9 | 89 | 3.30.43.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838MYK6-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase C-terminal domain-containing protein | 0.8869 | 228 | 306 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0050660 GO:0051301 GO:0071555 |
| AF-A0A6C9IKC9-F1-model_v4 | deleted | 0.8613 | 10 | 113 |
|
| AF-A0A7W0GT07-F1-model_v4 | UDP-N-acetylenolpyruvoylglucosamine reductase C-terminal domain-containing protein | 0.8593 | 219 | 306 |
GO:0005829
GO:0008360 GO:0008762 GO:0009252 GO:0050660 GO:0051301 GO:0071555 |
| AF-A0A7V0PJI8-F1-model_v4 | FAD-binding protein | 0.8436 | 12 | 102 |
GO:0005829
GO:0008762 GO:0071555 GO:0071949 |
| AF-A0A354M6U8-F1-model_v4 | FAD-binding PCMH-type domain-containing protein | 0.8421 | 10 | 96 |
GO:0005829
GO:0008762 GO:0071555 GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar