F370417

General Info

Members Datasets Scaffolds Average Seq Length
261 143 254 230

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10003911|Ga0307515_100039115
Length 238
Sequence VPYIKAMKLPGGYLADFVSLFFPQLCPACNASLVTSEHIICSDCRYNLPFTNFHTQPDNIVAQQFYGKIKVEAAYALYFFNKGGNVQNLMHHFKYSGMKQIGNLTGNIAGAQLKENPIFNTVDYIIPVPLHKKRLKERGYNQSACFADGLADKLTASVELDNLIRKVATATQTHKSRFARFENMQEVFAVAKPEKLEGKHVLLVDDVVTTGSTLEACGIELLKVPGLRLSIATIAYAV

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
133 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
136 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
137 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
138 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
139 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
142 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
143 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 0
Isolates 2.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.05
Nodule 0
Rhizoplane 0.77
Rhizosphere 84.67
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000351 3300001990 Bacteria 15507
2 JGI24735J21928_10000015 3300002067 Bacteria 167231
3 JGI25162J39368_1000016 3300002737 Bacteria 288734
4 JGI25164J39214_1000885 3300002772 Bacteria 10157
5 JGI25165J46597_1001337 3300003214 Bacteria 13860
6 rootH1_10095582 3300003316 Bacteria 4184
7 rootH2_10049945 3300003320 Bacteria 4042
8 rootL2_10032779 3300003322 Bacteria 3358
9 rootL2_10037514 3300003322 Bacteria 2645
10 rootH1_10012646 3300003323 Bacteria 62371
11 rootH1_10054869 3300003323 Bacteria 1361
12 rootH1_10125780 3300003323 Bacteria 3378
13 Ga0065714_10003781 3300005288 Bacteria 6944
14 Ga0065714_10071471 3300005288 Bacteria 3570
15 Ga0065714_10101285 3300005288 Bacteria 1647
16 Ga0070658_10046669 3300005327 Bacteria 3505
17 Ga0070658_10214721 3300005327 Bacteria 1626
18 Ga0070676_10001032 3300005328 Bacteria 13870
19 Ga0068869_100346431 3300005334 Unclassified 1210
20 Ga0070680_100014364 3300005336 Bacteria 6187
21 Ga0068868_100077823 3300005338 Bacteria 2654
22 Ga0070674_100065975 3300005356 Bacteria 2542
23 Ga0070673_100009101 3300005364 Bacteria 6649
24 Ga0070678_100003253 3300005456 Bacteria 9026
25 Ga0070662_100062543 3300005457 Bacteria 2720
26 Ga0070681_10067347 3300005458 Bacteria 3549
27 Ga0068867_100000211 3300005459 Bacteria 38776
28 Ga0070679_100003625 3300005530 Bacteria 14116
29 Ga0068853_100009441 3300005539 Bacteria 7861
30 Ga0068853_100079341 3300005539 Bacteria 2870
31 Ga0068853_100082592 3300005539 Bacteria 2814
32 Ga0068853_100552686 3300005539 Bacteria 1091
33 Ga0070672_100142160 3300005543 Bacteria 1980
34 Ga0070665_100000061 3300005548 Bacteria 222138
35 Ga0068855_100000204 3300005563 Bacteria 76041
36 Ga0068855_100047775 3300005563 Bacteria 5055
37 Ga0068855_100140772 3300005563 Bacteria 2750
38 Ga0068855_100254249 3300005563 Bacteria 1959
39 Ga0068855_101009190 3300005563 Bacteria 874
40 Ga0068857_100305075 3300005577 Bacteria 1468
41 Ga0068857_100324966 3300005577 Bacteria 1421
42 Ga0068854_100046670 3300005578 Bacteria 3085
43 Ga0068854_100311781 3300005578 Bacteria 1276
44 Ga0068856_100000112 3300005614 Bacteria 80466
45 Ga0068856_100003707 3300005614 Bacteria 15330
46 Ga0068856_100007894 3300005614 Bacteria 10394
47 Ga0068856_100071737 3300005614 Bacteria 3429
48 Ga0068856_100168277 3300005614 Bacteria 2203
49 Ga0068856_100685550 3300005614 Bacteria 1045
50 Ga0068852_100003124 3300005616 Bacteria 11535
51 Ga0068852_100042977 3300005616 Bacteria 3830
52 Ga0068852_100972101 3300005616 Bacteria 867
53 Ga0068858_100173504 3300005842 Bacteria 2034
54 Ga0075366_10019430 3300006195 Bacteria 3931
55 Ga0097621_100000016 3300006237 Bacteria 91785
56 Ga0068871_100000504 3300006358 Bacteria 26679
57 Ga0068865_100000063 3300006881 Bacteria 56994
58 Ga0105240_10000082 3300009093 Bacteria 195184
59 Ga0105240_10070139 3300009093 Bacteria 4336
60 Ga0105240_10079849 3300009093 Bacteria 4025
61 Ga0105240_10093972 3300009093 Bacteria 3659
62 Ga0105240_10166788 3300009093 Bacteria 2611
63 Ga0105240_10193224 3300009093 Bacteria 2392
64 Ga0105240_10259216 3300009093 Bacteria 2007
65 Ga0105240_10474803 3300009093 Unclassified 1395
66 Ga0105240_10600857 3300009093 Bacteria 1211
67 Ga0105241_10003889 3300009174 Bacteria 11066
68 Ga0105241_10006907 3300009174 Bacteria 8354
69 Ga0105237_10002253 3300009545 Bacteria 24013
70 Ga0105237_10008175 3300009545 Bacteria 11366
71 Ga0105237_10009770 3300009545 Bacteria 10262
72 Ga0105237_10011011 3300009545 Bacteria 9598
73 Ga0105237_10037116 3300009545 Bacteria 4927
74 Ga0105237_10037117 3300009545 Bacteria 4927
75 Ga0105237_10066866 3300009545 Bacteria 3588
76 Ga0105237_10106186 3300009545 Bacteria 2800
77 Ga0105237_10171164 3300009545 Bacteria 2172
78 Ga0105237_10283523 3300009545 Bacteria 1659
79 Ga0105238_10011297 3300009551 Bacteria 8984
80 Ga0105238_10624965 3300009551 Bacteria 1086
81 Ga0105238_10947723 3300009551 Bacteria 880
82 Ga0105239_10000166 3300010375 Bacteria 94743
83 Ga0105239_10000740 3300010375 Bacteria 46443
84 Ga0105239_10001606 3300010375 Bacteria 29871
85 Ga0105239_10015876 3300010375 Bacteria 8336
86 Ga0105239_10016923 3300010375 Bacteria 8058
87 Ga0105239_10018327 3300010375 Bacteria 7739
88 Ga0105239_10124138 3300010375 Bacteria 2869
89 Ga0105239_10224604 3300010375 Bacteria 2106
90 Ga0157370_10093764 3300013104 Bacteria 2817
91 Ga0157370_10124419 3300013104 Bacteria 2408
92 Ga0157369_10100098 3300013105 Bacteria 3090
93 Ga0157374_10000642 3300013296 Bacteria 30802
94 Ga0157374_10173550 3300013296 Bacteria 2104
95 Ga0157378_10023503 3300013297 Bacteria 5423
96 Ga0157378_10027254 3300013297 Bacteria 5043
97 Ga0157378_10168607 3300013297 Bacteria 2052
98 Ga0163162_10000012 3300013306 Bacteria 292674
99 Ga0163162_10002529 3300013306 Bacteria 17304
100 Ga0163162_10032478 3300013306 Bacteria 5186
101 Ga0163162_10405908 3300013306 Bacteria 1495
102 Ga0163162_10626202 3300013306 Bacteria 1201
103 Ga0163162_10976707 3300013306 Bacteria 957
104 Ga0157372_10003356 3300013307 Bacteria 17289
105 Ga0157372_10055183 3300013307 Bacteria 4436
106 Ga0157375_10016114 3300013308 Bacteria 6703
107 Ga0157375_10035896 3300013308 Bacteria 4736
108 Ga0157375_10055533 3300013308 Bacteria 3906
109 Ga0163161_10018922 3300017792 Bacteria 4827
110 Ga0207427_100309 3300025231 Bacteria 33924
111 Ga0209437_100048 3300025233 Bacteria 405107
112 Ga0209437_100119 3300025233 Bacteria 206549
113 Ga0209026_1007950 3300025250 Bacteria 2287
114 Ga0209233_1000029 3300025261 Bacteria 641642
115 Ga0209455_1011441 3300025272 Bacteria 2183
116 Ga0207647_10032014 3300025904 Bacteria 3382
117 Ga0207645_10000289 3300025907 Bacteria 42106
118 Ga0207705_10000035 3300025909 Bacteria 201649
119 Ga0207705_10034439 3300025909 Bacteria 3621
120 Ga0207654_10046821 3300025911 Bacteria 2468
121 Ga0207654_10091741 3300025911 Bacteria 1853
122 Ga0207707_10049701 3300025912 Bacteria 3653
123 Ga0207695_10000053 3300025913 Bacteria 396740
124 Ga0207695_10084684 3300025913 Bacteria 3200
125 Ga0207695_10086818 3300025913 Bacteria 3153
126 Ga0207695_10108430 3300025913 Bacteria 2761
127 Ga0207695_10184152 3300025913 Bacteria 2008
128 Ga0207695_10470346 3300025913 Bacteria 1140
129 Ga0207671_10002743 3300025914 Bacteria 18404
130 Ga0207671_10012118 3300025914 Bacteria 6962
131 Ga0207671_10020171 3300025914 Bacteria 5079
132 Ga0207671_10021317 3300025914 Bacteria 4917
133 Ga0207671_10033031 3300025914 Bacteria 3852
134 Ga0207671_10060393 3300025914 Bacteria 2812
135 Ga0207671_10103356 3300025914 Bacteria 2160
136 Ga0207671_10270558 3300025914 Bacteria 1338
137 Ga0207660_10009718 3300025917 Bacteria 6226
138 Ga0207652_10029757 3300025921 Bacteria 4569
139 Ga0207652_10045352 3300025921 Bacteria 3748
140 Ga0207694_10399255 3300025924 Bacteria 1143
141 Ga0207706_10089463 3300025933 Bacteria 2707
142 Ga0207686_10068364 3300025934 Bacteria 2275
143 Ga0207704_10000611 3300025938 Bacteria 15795
144 Ga0207691_10248844 3300025940 Bacteria 1535
145 Ga0207667_10000095 3300025949 Bacteria 143866
146 Ga0207667_10018541 3300025949 Bacteria 7801
147 Ga0207667_10292941 3300025949 Bacteria 1663
148 Ga0207651_10141601 3300025960 Bacteria 1858
149 Ga0207640_10035414 3300025981 Bacteria 3124
150 Ga0207640_10282764 3300025981 Bacteria 1304
151 Ga0207677_10173980 3300026023 Unclassified 1687
152 Ga0207703_10180076 3300026035 Bacteria 1865
153 Ga0207639_10042679 3300026041 Bacteria 3400
154 Ga0207639_10142930 3300026041 Bacteria 1996
155 Ga0207702_10000278 3300026078 Bacteria 58953
156 Ga0207702_10039698 3300026078 Bacteria 3946
157 Ga0207702_10053114 3300026078 Bacteria 3430
158 Ga0207702_10087061 3300026078 Bacteria 2726
159 Ga0207702_10282925 3300026078 Bacteria 1569
160 Ga0207648_10000081 3300026089 Bacteria 90676
161 Ga0207674_10281385 3300026116 Bacteria 1611
162 Ga0207683_10040802 3300026121 Bacteria 4052
163 Ga0207698_10234319 3300026142 Bacteria 1669
164 Ga0268266_10000053 3300028379 Bacteria 295181
165 Ga0307517_10000447 3300028786 Bacteria 70799
166 Ga0307515_10000747 3300028794 Bacteria 75231
167 Ga0307515_10003911 3300028794 Bacteria 31075
168 Ga0307515_10079612 3300028794 Bacteria 4289
169 Ga0265338_10018434 3300028800 Bacteria 7470
170 Ga0307507_10001556 3300033179 Bacteria 51074
171 Ga0307510_10008264 3300033180 Bacteria 12403
172 Ga0395899_0000027 3300037312 Bacteria 337387
173 Ga0395899_0035169 3300037312 Bacteria 3761
174 Ga0395900_0010687 3300037418 Bacteria 9388
175 Ga0395900_0622565 3300037418 Bacteria 1018
176 Ga0395905_0002957 3300037471 Bacteria 18463
177 Ga0395901_0000565 3300038443 Bacteria 42982
178 Ga0436361_0402892 3300039447 Bacteria 11822
179 Ga0451791_0744715 3300041451 Bacteria 822
180 Ga0439448_0003114 3300042005 Bacteria 4569
181 Ga0495629_0304130 3300046459 Bacteria 1092
182 Ga0495650_0000144 3300046471 Bacteria 165957
183 Ga0495650_0136577 3300046471 Bacteria 890
184 Ga0495650_0139808 3300046471 Bacteria 877
185 Ga0495585_0000091 3300046492 Bacteria 95620
186 Ga0495585_0001011 3300046492 Bacteria 23448
187 Ga0495585_0060985 3300046492 Bacteria 2075
188 Ga0495607_0069397 3300046501 Bacteria 1973
189 Ga0495583_0064945 3300046506 Bacteria 1618
190 Ga0495606_0000430 3300046507 Bacteria 69872
191 Ga0495606_0041007 3300046507 Bacteria 3107
192 Ga0495606_0052440 3300046507 Bacteria 2652
193 Ga0495610_0001601 3300046512 Bacteria 19932
194 Ga0495610_0100427 3300046512 Bacteria 1297
195 Ga0495616_0001184 3300046513 Bacteria 18406
196 Ga0495631_0051584 3300046518 Bacteria 1797
197 Ga0495632_0044547 3300046519 Bacteria 2214
198 Ga0495632_0116252 3300046519 Bacteria 1253
199 Ga0495644_0010276 3300046523 Bacteria 3606
200 Ga0495648_0035543 3300046524 Bacteria 3229
201 Ga0495652_0497033 3300046529 Bacteria 846
202 Ga0495654_0069441 3300046530 Bacteria 1673
203 Ga0495609_0006478 3300046538 Bacteria 5968
204 Ga0495609_0046420 3300046538 Bacteria 1945
205 Ga0495633_0000157 3300046558 Bacteria 89236
206 Ga0495633_0004850 3300046558 Bacteria 8417
207 Ga0495668_0000086 3300046616 Bacteria 151960
208 Ga0495668_0146165 3300046616 Bacteria 1294
209 Ga0495625_0000059 3300046660 Bacteria 180330
210 Ga0495625_0002845 3300046660 Bacteria 18183
211 Ga0495625_0002928 3300046660 Bacteria 17812
212 Ga0495625_0013664 3300046660 Bacteria 6511
213 Ga0495625_0015890 3300046660 Bacteria 5940
214 Ga0495625_0019273 3300046660 Bacteria 5298
215 Ga0495625_0088602 3300046660 Bacteria 2143
216 Ga0495625_0258594 3300046660 Bacteria 1127
217 Ga0495661_0003314 3300046665 Bacteria 11935
218 Ga0495661_0016583 3300046665 Bacteria 4879
219 Ga0495661_0022369 3300046665 Bacteria 4113
220 Ga0495661_0136359 3300046665 Bacteria 1339
221 Ga0495669_0111455 3300046684 Bacteria 1278
222 Ga0495670_0103517 3300046691 Bacteria 1468
223 Ga0495671_0216686 3300046692 Bacteria 927
224 Ga0495649_0000031 3300046694 Bacteria 151547
225 Ga0495589_0120832 3300046794 Bacteria 1261
226 Ga0495660_0006773 3300046810 Bacteria 6757
227 Ga0495660_0147425 3300046810 Bacteria 1165
228 Ga0495683_0016530 3300047323 Bacteria 3831
229 Ga0495683_0051020 3300047323 Bacteria 2070
230 Ga0495687_004428 3300047443 Bacteria 9501
231 Ga0495687_009766 3300047443 Bacteria 5332
232 Ga0495687_054688 3300047443 Bacteria 1674
233 Ga0495677_0035568 3300047445 Bacteria 1817
234 Ga0495685_024317 3300047447 Bacteria 2085
235 Ga0495673_0010017 3300047469 Bacteria 5191
236 Ga0495686_0000621 3300047472 Bacteria 48956
237 Ga0495686_0000821 3300047472 Bacteria 40069
238 Ga0495686_0112699 3300047472 Bacteria 1629
239 Ga0495614_0079198 3300048089 Bacteria 1422
240 Ga0496126_0229718 3300048929 Bacteria 1555
241 Ga0495678_004703 3300049459 Bacteria 7800
242 Ga0495682_0027088 3300049460 Bacteria 2127
243 nmdc:mga0k408_1733_c1 3300050493 Bacteria 11700
244 nmdc:mga0k408_4746_c1 3300050493 Bacteria 7200
245 Ga0500635_0007374 3300053080 Bacteria 2982
246 Ga0500608_013571 3300053122 Bacteria 3613
247 Ga0500614_073573 3300053123 Bacteria 943
248 Ga0500618_000018 3300053125 Bacteria 163272
249 Ga0500618_054568 3300053125 Bacteria 902
250 Ga0500642_0007977 3300053130 Bacteria 3592
251 Ga0500616_0029530 3300053153 Bacteria 3016
252 Ga0500622_0001949 3300053156 Bacteria 15533
253 Ga0500624_000172 3300053157 Bacteria 25880
254 Ga0500634_0271249 3300053161 Bacteria 691

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047447 Ga0495685_024317 Ga0495685_024317_17_616 199
2 3300005578 Ga0068854_100311781 Ga0068854_1003117811 205
3 3300005616 Ga0068852_100042977 Ga0068852_1000429772 205
4 3300005842 Ga0068858_100173504 Ga0068858_1001735042 205
5 3300013306 Ga0163162_10976707 Ga0163162_109767072 205
6 3300025913 Ga0207695_10000053 Ga0207695_10000053266 205
7 3300025913 Ga0207695_10184152 Ga0207695_101841523 205
8 3300025914 Ga0207671_10060393 Ga0207671_100603931 205
9 3300025981 Ga0207640_10282764 Ga0207640_102827642 205
10 3300026035 Ga0207703_10180076 Ga0207703_101800762 205
11 3300053161 Ga0500634_0271249 Ga0500634_0271249_11_628 205
12 3300046810 Ga0495660_0147425 Ga0495660_0147425_173_868 225
13 3300005288 Ga0065714_10071471 Ga0065714_100714712 226
14 3300006195 Ga0075366_10019430 Ga0075366_100194302 226
15 3300013306 Ga0163162_10626202 Ga0163162_106262022 226
16 3300033179 Ga0307507_10001556 Ga0307507_1000155610 226
17 3300046459 Ga0495629_0304130 Ga0495629_0304130_89_787 226
18 3300046492 Ga0495585_0001011 Ga0495585_0001011_6772_7470 226
19 3300046524 Ga0495648_0035543 Ga0495648_0035543_2129_2827 226
20 3300046530 Ga0495654_0069441 Ga0495654_0069441_58_756 226
21 3300046538 Ga0495609_0046420 Ga0495609_0046420_1104_1802 226
22 3300046616 Ga0495668_0000086 Ga0495668_0000086_95838_96536 226
23 3300046660 Ga0495625_0002928 Ga0495625_0002928_12566_13264 226
24 3300046660 Ga0495625_0019273 Ga0495625_0019273_2255_2953 226
25 3300048089 Ga0495614_0079198 Ga0495614_0079198_512_1210 226
26 3300049460 Ga0495682_0027088 Ga0495682_0027088_262_960 226
27 3300050493 nmdc:mga0k408_1733_c1 nmdc:mga0k408_1733_c1_10315_11013 226
28 3300053123 Ga0500614_073573 Ga0500614_073573_124_822 226
29 3300046506 Ga0495583_0064945 Ga0495583_0064945_878_1576 227
30 3300046665 Ga0495661_0003314 Ga0495661_0003314_6173_6871 227
31 iso_pu_bacteria 2599185184 2599482013 228
32 iso_pu_bacteria 2852623160 2852625622 228
33 iso_pu_bacteria 2884933994 2884934620 228
34 iso_pu_bacteria 2919437846 2919440553 228
35 iso_pu_bacteria 2928078545 2928082122 228
36 iso_pu_bacteria 2928147474 2928149301 228
37 iso_pu_bacteria 2932082852 2932087964 228
38 3300046660 Ga0495625_0013664 Ga0495625_0013664_3825_4520 231
39 3300053156 Ga0500622_0001949 Ga0500622_0001949_12026_12721 231
40 3300001990 JGI24737J22298_10000351 JGI24737J22298_100003519 232
41 3300002067 JGI24735J21928_10000015 JGI24735J21928_1000001537 232
42 3300002737 JGI25162J39368_1000016 JGI25162J39368_1000016204 232
43 3300002772 JGI25164J39214_1000885 JGI25164J39214_10008859 232
44 3300003214 JGI25165J46597_1001337 JGI25165J46597_10013375 232
45 3300003316 rootH1_10095582 rootH1_100955822 232
46 3300003320 rootH2_10049945 rootH2_100499453 232
47 3300003322 rootL2_10032779 rootL2_100327793 232
48 3300003322 rootL2_10037514 rootL2_100375142 232
49 3300003323 rootH1_10012646 rootH1_1001264621 232
50 3300003323 rootH1_10054869 rootH1_100548692 232
51 3300003323 rootH1_10125780 rootH1_101257801 232
52 3300005288 Ga0065714_10003781 Ga0065714_100037813 232
53 3300005288 Ga0065714_10101285 Ga0065714_101012852 232
54 3300005327 Ga0070658_10046669 Ga0070658_100466693 232
55 3300005327 Ga0070658_10214721 Ga0070658_102147212 232
56 3300005328 Ga0070676_10001032 Ga0070676_100010324 232
57 3300005334 Ga0068869_100346431 Ga0068869_1003464311 232
58 3300005336 Ga0070680_100014364 Ga0070680_1000143643 232
59 3300005338 Ga0068868_100077823 Ga0068868_1000778232 232
60 3300005356 Ga0070674_100065975 Ga0070674_1000659752 232
61 3300005364 Ga0070673_100009101 Ga0070673_1000091012 232
62 3300005456 Ga0070678_100003253 Ga0070678_1000032534 232
63 3300005457 Ga0070662_100062543 Ga0070662_1000625432 232
64 3300005458 Ga0070681_10067347 Ga0070681_100673473 232
65 3300005459 Ga0068867_100000211 Ga0068867_1000002115 232
66 3300005530 Ga0070679_100003625 Ga0070679_10000362516 232
67 3300005539 Ga0068853_100009441 Ga0068853_1000094413 232
68 3300005539 Ga0068853_100079341 Ga0068853_1000793412 232
69 3300005539 Ga0068853_100082592 Ga0068853_1000825922 232
70 3300005539 Ga0068853_100552686 Ga0068853_1005526862 232
71 3300005543 Ga0070672_100142160 Ga0070672_1001421602 232
72 3300005548 Ga0070665_100000061 Ga0070665_100000061129 232
73 3300005563 Ga0068855_100000204 Ga0068855_10000020426 232
74 3300005563 Ga0068855_100047775 Ga0068855_1000477753 232
75 3300005563 Ga0068855_100140772 Ga0068855_1001407723 232
76 3300005563 Ga0068855_100254249 Ga0068855_1002542492 232
77 3300005563 Ga0068855_101009190 Ga0068855_1010091902 232
78 3300005577 Ga0068857_100305075 Ga0068857_1003050753 232
79 3300005577 Ga0068857_100324966 Ga0068857_1003249662 232
80 3300005578 Ga0068854_100046670 Ga0068854_1000466703 232
81 3300005614 Ga0068856_100000112 Ga0068856_10000011230 232
82 3300005614 Ga0068856_100003707 Ga0068856_1000037072 232
83 3300005614 Ga0068856_100007894 Ga0068856_10000789410 232
84 3300005614 Ga0068856_100071737 Ga0068856_1000717373 232
85 3300005614 Ga0068856_100168277 Ga0068856_1001682772 232
86 3300005614 Ga0068856_100685550 Ga0068856_1006855501 232
87 3300005616 Ga0068852_100003124 Ga0068852_1000031247 232
88 3300005616 Ga0068852_100972101 Ga0068852_1009721011 232
89 3300006237 Ga0097621_100000016 Ga0097621_10000001644 232
90 3300006358 Ga0068871_100000504 Ga0068871_10000050413 232
91 3300006881 Ga0068865_100000063 Ga0068865_1000000635 232
92 3300009093 Ga0105240_10000082 Ga0105240_1000008285 232
93 3300009093 Ga0105240_10070139 Ga0105240_100701393 232
94 3300009093 Ga0105240_10079849 Ga0105240_100798494 232
95 3300009093 Ga0105240_10093972 Ga0105240_100939722 232
96 3300009093 Ga0105240_10166788 Ga0105240_101667882 232
97 3300009093 Ga0105240_10193224 Ga0105240_101932243 232
98 3300009093 Ga0105240_10259216 Ga0105240_102592162 232
99 3300009093 Ga0105240_10474803 Ga0105240_104748032 232
100 3300009093 Ga0105240_10600857 Ga0105240_106008571 232
101 3300009174 Ga0105241_10003889 Ga0105241_100038895 232
102 3300009174 Ga0105241_10006907 Ga0105241_100069072 232
103 3300009545 Ga0105237_10002253 Ga0105237_100022538 232
104 3300009545 Ga0105237_10008175 Ga0105237_100081756 232
105 3300009545 Ga0105237_10009770 Ga0105237_100097705 232
106 3300009545 Ga0105237_10011011 Ga0105237_100110115 232
107 3300009545 Ga0105237_10037116 Ga0105237_100371162 232
108 3300009545 Ga0105237_10037117 Ga0105237_100371172 232
109 3300009545 Ga0105237_10066866 Ga0105237_100668662 232
110 3300009545 Ga0105237_10106186 Ga0105237_101061862 232
111 3300009545 Ga0105237_10171164 Ga0105237_101711642 232
112 3300009545 Ga0105237_10283523 Ga0105237_102835232 232
113 3300009551 Ga0105238_10011297 Ga0105238_100112972 232
114 3300009551 Ga0105238_10624965 Ga0105238_106249652 232
115 3300009551 Ga0105238_10947723 Ga0105238_109477231 232
116 3300010375 Ga0105239_10000166 Ga0105239_1000016682 232
117 3300010375 Ga0105239_10000740 Ga0105239_1000074024 232
118 3300010375 Ga0105239_10001606 Ga0105239_1000160614 232
119 3300010375 Ga0105239_10015876 Ga0105239_100158765 232
120 3300010375 Ga0105239_10016923 Ga0105239_100169238 232
121 3300010375 Ga0105239_10018327 Ga0105239_100183274 232
122 3300010375 Ga0105239_10124138 Ga0105239_101241383 232
123 3300010375 Ga0105239_10224604 Ga0105239_102246042 232
124 3300013104 Ga0157370_10093764 Ga0157370_100937642 232
125 3300013104 Ga0157370_10124419 Ga0157370_101244192 232
126 3300013105 Ga0157369_10100098 Ga0157369_101000983 232
127 3300013296 Ga0157374_10000642 Ga0157374_1000064214 232
128 3300013296 Ga0157374_10173550 Ga0157374_101735502 232
129 3300013297 Ga0157378_10023503 Ga0157378_100235033 232
130 3300013297 Ga0157378_10027254 Ga0157378_100272543 232
131 3300013297 Ga0157378_10168607 Ga0157378_101686073 232
132 3300013306 Ga0163162_10000012 Ga0163162_10000012232 232
133 3300013306 Ga0163162_10002529 Ga0163162_100025295 232
134 3300013306 Ga0163162_10032478 Ga0163162_100324785 232
135 3300013306 Ga0163162_10405908 Ga0163162_104059082 232
136 3300013307 Ga0157372_10003356 Ga0157372_100033562 232
137 3300013307 Ga0157372_10055183 Ga0157372_100551833 232
138 3300013308 Ga0157375_10016114 Ga0157375_100161141 232
139 3300013308 Ga0157375_10035896 Ga0157375_100358963 232
140 3300013308 Ga0157375_10055533 Ga0157375_100555332 232
141 3300017792 Ga0163161_10018922 Ga0163161_100189223 232
142 3300025231 Ga0207427_100309 Ga0207427_10030913 232
143 3300025233 Ga0209437_100048 Ga0209437_100048308 232
144 3300025233 Ga0209437_100119 Ga0209437_100119121 232
145 3300025250 Ga0209026_1007950 Ga0209026_10079502 232
146 3300025261 Ga0209233_1000029 Ga0209233_100002968 232
147 3300025272 Ga0209455_1011441 Ga0209455_10114412 232
148 3300025904 Ga0207647_10032014 Ga0207647_100320142 232
149 3300025907 Ga0207645_10000289 Ga0207645_1000028931 232
150 3300025909 Ga0207705_10000035 Ga0207705_1000003520 232
151 3300025909 Ga0207705_10034439 Ga0207705_100344393 232
152 3300025911 Ga0207654_10046821 Ga0207654_100468212 232
153 3300025911 Ga0207654_10091741 Ga0207654_100917412 232
154 3300025912 Ga0207707_10049701 Ga0207707_100497013 232
155 3300025913 Ga0207695_10084684 Ga0207695_100846842 232
156 3300025913 Ga0207695_10086818 Ga0207695_100868183 232
157 3300025913 Ga0207695_10108430 Ga0207695_101084302 232
158 3300025913 Ga0207695_10470346 Ga0207695_104703462 232
159 3300025914 Ga0207671_10002743 Ga0207671_1000274317 232
160 3300025914 Ga0207671_10012118 Ga0207671_100121183 232
161 3300025914 Ga0207671_10020171 Ga0207671_100201712 232
162 3300025914 Ga0207671_10021317 Ga0207671_100213172 232
163 3300025914 Ga0207671_10033031 Ga0207671_100330312 232
164 3300025914 Ga0207671_10103356 Ga0207671_101033562 232
165 3300025914 Ga0207671_10270558 Ga0207671_102705582 232
166 3300025917 Ga0207660_10009718 Ga0207660_100097185 232
167 3300025921 Ga0207652_10029757 Ga0207652_100297572 232
168 3300025921 Ga0207652_10045352 Ga0207652_100453522 232
169 3300025924 Ga0207694_10399255 Ga0207694_103992552 232
170 3300025933 Ga0207706_10089463 Ga0207706_100894632 232
171 3300025934 Ga0207686_10068364 Ga0207686_100683643 232
172 3300025938 Ga0207704_10000611 Ga0207704_100006115 232
173 3300025940 Ga0207691_10248844 Ga0207691_102488441 232
174 3300025949 Ga0207667_10000095 Ga0207667_1000009597 232
175 3300025949 Ga0207667_10018541 Ga0207667_100185415 232
176 3300025949 Ga0207667_10292941 Ga0207667_102929412 232
177 3300025960 Ga0207651_10141601 Ga0207651_101416011 232
178 3300025981 Ga0207640_10035414 Ga0207640_100354142 232
179 3300026023 Ga0207677_10173980 Ga0207677_101739802 232
180 3300026041 Ga0207639_10042679 Ga0207639_100426792 232
181 3300026041 Ga0207639_10142930 Ga0207639_101429302 232
182 3300026078 Ga0207702_10000278 Ga0207702_1000027849 232
183 3300026078 Ga0207702_10039698 Ga0207702_100396981 232
184 3300026078 Ga0207702_10053114 Ga0207702_100531142 232
185 3300026078 Ga0207702_10087061 Ga0207702_100870612 232
186 3300026078 Ga0207702_10282925 Ga0207702_102829252 232
187 3300026089 Ga0207648_10000081 Ga0207648_1000008110 232
188 3300026116 Ga0207674_10281385 Ga0207674_102813852 232
189 3300026121 Ga0207683_10040802 Ga0207683_100408025 232
190 3300026142 Ga0207698_10234319 Ga0207698_102343192 232
191 3300028379 Ga0268266_10000053 Ga0268266_1000005375 232
192 3300028786 Ga0307517_10000447 Ga0307517_1000044729 232
193 3300028794 Ga0307515_10000747 Ga0307515_1000074754 232
194 3300028794 Ga0307515_10003911 Ga0307515_100039115 232
195 3300028794 Ga0307515_10079612 Ga0307515_100796123 232
196 3300028800 Ga0265338_10018434 Ga0265338_100184343 232
197 3300033180 Ga0307510_10008264 Ga0307510_100082649 232
198 3300037312 Ga0395899_0000027 Ga0395899_0000027_187618_188316 232
199 3300037312 Ga0395899_0035169 Ga0395899_0035169_2911_3609 232
200 3300037418 Ga0395900_0010687 Ga0395900_0010687_6861_7559 232
201 3300037418 Ga0395900_0622565 Ga0395900_0622565_139_837 232
202 3300037471 Ga0395905_0002957 Ga0395905_0002957_11861_12559 232
203 3300038443 Ga0395901_0000565 Ga0395901_0000565_42122_42820 232
204 3300039447 Ga0436361_0402892 Ga0436361_0402892_2211_2909 232
205 3300041451 Ga0451791_0744715 Ga0451791_0744715_67_765 232
206 3300042005 Ga0439448_0003114 Ga0439448_0003114_3225_3923 232
207 3300046471 Ga0495650_0000144 Ga0495650_0000144_105713_106411 232
208 3300046471 Ga0495650_0136577 Ga0495650_0136577_109_807 232
209 3300046471 Ga0495650_0139808 Ga0495650_0139808_11_709 232
210 3300046492 Ga0495585_0000091 Ga0495585_0000091_61779_62477 232
211 3300046492 Ga0495585_0060985 Ga0495585_0060985_912_1610 232
212 3300046501 Ga0495607_0069397 Ga0495607_0069397_663_1361 232
213 3300046507 Ga0495606_0000430 Ga0495606_0000430_6409_7107 232
214 3300046507 Ga0495606_0041007 Ga0495606_0041007_531_1229 232
215 3300046507 Ga0495606_0052440 Ga0495606_0052440_131_829 232
216 3300046512 Ga0495610_0001601 Ga0495610_0001601_3505_4203 232
217 3300046512 Ga0495610_0100427 Ga0495610_0100427_402_1100 232
218 3300046513 Ga0495616_0001184 Ga0495616_0001184_1675_2373 232
219 3300046518 Ga0495631_0051584 Ga0495631_0051584_648_1346 232
220 3300046519 Ga0495632_0044547 Ga0495632_0044547_764_1462 232
221 3300046519 Ga0495632_0116252 Ga0495632_0116252_43_741 232
222 3300046523 Ga0495644_0010276 Ga0495644_0010276_2067_2765 232
223 3300046529 Ga0495652_0497033 Ga0495652_0497033_69_767 232
224 3300046538 Ga0495609_0006478 Ga0495609_0006478_1267_1965 232
225 3300046558 Ga0495633_0000157 Ga0495633_0000157_5252_5950 232
226 3300046558 Ga0495633_0004850 Ga0495633_0004850_2397_3095 232
227 3300046616 Ga0495668_0146165 Ga0495668_0146165_508_1206 232
228 3300046660 Ga0495625_0000059 Ga0495625_0000059_71809_72507 232
229 3300046660 Ga0495625_0002845 Ga0495625_0002845_4719_5417 232
230 3300046660 Ga0495625_0015890 Ga0495625_0015890_2101_2799 232
231 3300046660 Ga0495625_0088602 Ga0495625_0088602_275_973 232
232 3300046660 Ga0495625_0258594 Ga0495625_0258594_275_973 232
233 3300046665 Ga0495661_0016583 Ga0495661_0016583_2574_3272 232
234 3300046665 Ga0495661_0022369 Ga0495661_0022369_115_813 232
235 3300046665 Ga0495661_0136359 Ga0495661_0136359_57_755 232
236 3300046684 Ga0495669_0111455 Ga0495669_0111455_255_953 232
237 3300046691 Ga0495670_0103517 Ga0495670_0103517_244_942 232
238 3300046692 Ga0495671_0216686 Ga0495671_0216686_68_766 232
239 3300046694 Ga0495649_0000031 Ga0495649_0000031_43033_43731 232
240 3300046794 Ga0495589_0120832 Ga0495589_0120832_115_813 232
241 3300046810 Ga0495660_0006773 Ga0495660_0006773_211_909 232
242 3300047323 Ga0495683_0016530 Ga0495683_0016530_1992_2690 232
243 3300047323 Ga0495683_0051020 Ga0495683_0051020_351_1049 232
244 3300047443 Ga0495687_004428 Ga0495687_004428_2121_2819 232
245 3300047443 Ga0495687_009766 Ga0495687_009766_634_1332 232
246 3300047443 Ga0495687_054688 Ga0495687_054688_82_780 232
247 3300047445 Ga0495677_0035568 Ga0495677_0035568_259_957 232
248 3300047469 Ga0495673_0010017 Ga0495673_0010017_1589_2287 232
249 3300047472 Ga0495686_0000621 Ga0495686_0000621_18339_19037 232
250 3300047472 Ga0495686_0000821 Ga0495686_0000821_27160_27858 232
251 3300047472 Ga0495686_0112699 Ga0495686_0112699_140_838 232
252 3300048929 Ga0496126_0229718 Ga0496126_0229718_601_1299 232
253 3300049459 Ga0495678_004703 Ga0495678_004703_6674_7372 232
254 3300050493 nmdc:mga0k408_4746_c1 nmdc:mga0k408_4746_c1_872_1570 232
255 3300053080 Ga0500635_0007374 Ga0500635_0007374_866_1564 232
256 3300053122 Ga0500608_013571 Ga0500608_013571_2597_3295 232
257 3300053125 Ga0500618_000018 Ga0500618_000018_136903_137601 232
258 3300053125 Ga0500618_054568 Ga0500618_054568_119_817 232
259 3300053130 Ga0500642_0007977 Ga0500642_0007977_360_1058 232
260 3300053153 Ga0500616_0029530 Ga0500616_0029530_665_1363 232
261 3300053157 Ga0500624_000172 Ga0500624_000172_1734_2432 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

141

237

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ecb-assembly1.cif.gz_A escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit 0.7786 96 225
8w7d-assembly1.cif.gz_A crystal structure of ecppat-fr901483 complex 0.7564 96 227
7p0h-assembly2.cif.gz_B crystal structure of helicobacter pylori comf fused to an artificial alpharep crystallization helper(named b2) 0.754 2 232
1ecf-assembly1.cif.gz_B escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase 0.7522 96 225
8dbo-assembly1.cif.gz_A human prps1-e307a engineered mutation with adp; hexamer 0.7271 100 230
ID Description Score Start End Superfamily
af_P46846_104_226_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9173 109 230 3.40.50.2020
af_P46846_104_226_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8893 109 230 3.40.50.2020
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8471 117 229 3.40.50.2020
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8258 117 229 3.40.50.2020
af_Q22134_2_446_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7819 93 223 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A645IR79-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9715 100 232
AF-A0A645IR79-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9574 100 232
AF-A0A5M4AHR5-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9521 56 230
AF-A0A2L2WQE1-F1-model_v4 ComF family protein 0.95 103 232
AF-A0A512BGG3-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9445 80 232

Feature Viewer

pLDDT pTM Quality
87.1 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map