F370417
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 261 | 143 | 254 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10003911|Ga0307515_100039115 |
| Length | 238 |
| Sequence | VPYIKAMKLPGGYLADFVSLFFPQLCPACNASLVTSEHIICSDCRYNLPFTNFHTQPDNIVAQQFYGKIKVEAAYALYFFNKGGNVQNLMHHFKYSGMKQIGNLTGNIAGAQLKENPIFNTVDYIIPVPLHKKRLKERGYNQSACFADGLADKLTASVELDNLIRKVATATQTHKSRFARFENMQEVFAVAKPEKLEGKHVLLVDDVVTTGSTLEACGIELLKVPGLRLSIATIAYAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 5 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 6 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 7 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 59 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 88 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 89 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 91 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 92 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 93 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 94 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 95 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 96 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 97 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 98 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 99 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 132 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 135 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 136 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 137 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 138 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 139 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 140 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 141 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 142 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 143 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.32 |
| Metatranscriptomes | 0 |
| Isolates | 2.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.05 |
| Nodule | 0 |
| Rhizoplane | 0.77 |
| Rhizosphere | 84.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10000351 | 3300001990 | Bacteria | 15507 |
| 2 | JGI24735J21928_10000015 | 3300002067 | Bacteria | 167231 |
| 3 | JGI25162J39368_1000016 | 3300002737 | Bacteria | 288734 |
| 4 | JGI25164J39214_1000885 | 3300002772 | Bacteria | 10157 |
| 5 | JGI25165J46597_1001337 | 3300003214 | Bacteria | 13860 |
| 6 | rootH1_10095582 | 3300003316 | Bacteria | 4184 |
| 7 | rootH2_10049945 | 3300003320 | Bacteria | 4042 |
| 8 | rootL2_10032779 | 3300003322 | Bacteria | 3358 |
| 9 | rootL2_10037514 | 3300003322 | Bacteria | 2645 |
| 10 | rootH1_10012646 | 3300003323 | Bacteria | 62371 |
| 11 | rootH1_10054869 | 3300003323 | Bacteria | 1361 |
| 12 | rootH1_10125780 | 3300003323 | Bacteria | 3378 |
| 13 | Ga0065714_10003781 | 3300005288 | Bacteria | 6944 |
| 14 | Ga0065714_10071471 | 3300005288 | Bacteria | 3570 |
| 15 | Ga0065714_10101285 | 3300005288 | Bacteria | 1647 |
| 16 | Ga0070658_10046669 | 3300005327 | Bacteria | 3505 |
| 17 | Ga0070658_10214721 | 3300005327 | Bacteria | 1626 |
| 18 | Ga0070676_10001032 | 3300005328 | Bacteria | 13870 |
| 19 | Ga0068869_100346431 | 3300005334 | Unclassified | 1210 |
| 20 | Ga0070680_100014364 | 3300005336 | Bacteria | 6187 |
| 21 | Ga0068868_100077823 | 3300005338 | Bacteria | 2654 |
| 22 | Ga0070674_100065975 | 3300005356 | Bacteria | 2542 |
| 23 | Ga0070673_100009101 | 3300005364 | Bacteria | 6649 |
| 24 | Ga0070678_100003253 | 3300005456 | Bacteria | 9026 |
| 25 | Ga0070662_100062543 | 3300005457 | Bacteria | 2720 |
| 26 | Ga0070681_10067347 | 3300005458 | Bacteria | 3549 |
| 27 | Ga0068867_100000211 | 3300005459 | Bacteria | 38776 |
| 28 | Ga0070679_100003625 | 3300005530 | Bacteria | 14116 |
| 29 | Ga0068853_100009441 | 3300005539 | Bacteria | 7861 |
| 30 | Ga0068853_100079341 | 3300005539 | Bacteria | 2870 |
| 31 | Ga0068853_100082592 | 3300005539 | Bacteria | 2814 |
| 32 | Ga0068853_100552686 | 3300005539 | Bacteria | 1091 |
| 33 | Ga0070672_100142160 | 3300005543 | Bacteria | 1980 |
| 34 | Ga0070665_100000061 | 3300005548 | Bacteria | 222138 |
| 35 | Ga0068855_100000204 | 3300005563 | Bacteria | 76041 |
| 36 | Ga0068855_100047775 | 3300005563 | Bacteria | 5055 |
| 37 | Ga0068855_100140772 | 3300005563 | Bacteria | 2750 |
| 38 | Ga0068855_100254249 | 3300005563 | Bacteria | 1959 |
| 39 | Ga0068855_101009190 | 3300005563 | Bacteria | 874 |
| 40 | Ga0068857_100305075 | 3300005577 | Bacteria | 1468 |
| 41 | Ga0068857_100324966 | 3300005577 | Bacteria | 1421 |
| 42 | Ga0068854_100046670 | 3300005578 | Bacteria | 3085 |
| 43 | Ga0068854_100311781 | 3300005578 | Bacteria | 1276 |
| 44 | Ga0068856_100000112 | 3300005614 | Bacteria | 80466 |
| 45 | Ga0068856_100003707 | 3300005614 | Bacteria | 15330 |
| 46 | Ga0068856_100007894 | 3300005614 | Bacteria | 10394 |
| 47 | Ga0068856_100071737 | 3300005614 | Bacteria | 3429 |
| 48 | Ga0068856_100168277 | 3300005614 | Bacteria | 2203 |
| 49 | Ga0068856_100685550 | 3300005614 | Bacteria | 1045 |
| 50 | Ga0068852_100003124 | 3300005616 | Bacteria | 11535 |
| 51 | Ga0068852_100042977 | 3300005616 | Bacteria | 3830 |
| 52 | Ga0068852_100972101 | 3300005616 | Bacteria | 867 |
| 53 | Ga0068858_100173504 | 3300005842 | Bacteria | 2034 |
| 54 | Ga0075366_10019430 | 3300006195 | Bacteria | 3931 |
| 55 | Ga0097621_100000016 | 3300006237 | Bacteria | 91785 |
| 56 | Ga0068871_100000504 | 3300006358 | Bacteria | 26679 |
| 57 | Ga0068865_100000063 | 3300006881 | Bacteria | 56994 |
| 58 | Ga0105240_10000082 | 3300009093 | Bacteria | 195184 |
| 59 | Ga0105240_10070139 | 3300009093 | Bacteria | 4336 |
| 60 | Ga0105240_10079849 | 3300009093 | Bacteria | 4025 |
| 61 | Ga0105240_10093972 | 3300009093 | Bacteria | 3659 |
| 62 | Ga0105240_10166788 | 3300009093 | Bacteria | 2611 |
| 63 | Ga0105240_10193224 | 3300009093 | Bacteria | 2392 |
| 64 | Ga0105240_10259216 | 3300009093 | Bacteria | 2007 |
| 65 | Ga0105240_10474803 | 3300009093 | Unclassified | 1395 |
| 66 | Ga0105240_10600857 | 3300009093 | Bacteria | 1211 |
| 67 | Ga0105241_10003889 | 3300009174 | Bacteria | 11066 |
| 68 | Ga0105241_10006907 | 3300009174 | Bacteria | 8354 |
| 69 | Ga0105237_10002253 | 3300009545 | Bacteria | 24013 |
| 70 | Ga0105237_10008175 | 3300009545 | Bacteria | 11366 |
| 71 | Ga0105237_10009770 | 3300009545 | Bacteria | 10262 |
| 72 | Ga0105237_10011011 | 3300009545 | Bacteria | 9598 |
| 73 | Ga0105237_10037116 | 3300009545 | Bacteria | 4927 |
| 74 | Ga0105237_10037117 | 3300009545 | Bacteria | 4927 |
| 75 | Ga0105237_10066866 | 3300009545 | Bacteria | 3588 |
| 76 | Ga0105237_10106186 | 3300009545 | Bacteria | 2800 |
| 77 | Ga0105237_10171164 | 3300009545 | Bacteria | 2172 |
| 78 | Ga0105237_10283523 | 3300009545 | Bacteria | 1659 |
| 79 | Ga0105238_10011297 | 3300009551 | Bacteria | 8984 |
| 80 | Ga0105238_10624965 | 3300009551 | Bacteria | 1086 |
| 81 | Ga0105238_10947723 | 3300009551 | Bacteria | 880 |
| 82 | Ga0105239_10000166 | 3300010375 | Bacteria | 94743 |
| 83 | Ga0105239_10000740 | 3300010375 | Bacteria | 46443 |
| 84 | Ga0105239_10001606 | 3300010375 | Bacteria | 29871 |
| 85 | Ga0105239_10015876 | 3300010375 | Bacteria | 8336 |
| 86 | Ga0105239_10016923 | 3300010375 | Bacteria | 8058 |
| 87 | Ga0105239_10018327 | 3300010375 | Bacteria | 7739 |
| 88 | Ga0105239_10124138 | 3300010375 | Bacteria | 2869 |
| 89 | Ga0105239_10224604 | 3300010375 | Bacteria | 2106 |
| 90 | Ga0157370_10093764 | 3300013104 | Bacteria | 2817 |
| 91 | Ga0157370_10124419 | 3300013104 | Bacteria | 2408 |
| 92 | Ga0157369_10100098 | 3300013105 | Bacteria | 3090 |
| 93 | Ga0157374_10000642 | 3300013296 | Bacteria | 30802 |
| 94 | Ga0157374_10173550 | 3300013296 | Bacteria | 2104 |
| 95 | Ga0157378_10023503 | 3300013297 | Bacteria | 5423 |
| 96 | Ga0157378_10027254 | 3300013297 | Bacteria | 5043 |
| 97 | Ga0157378_10168607 | 3300013297 | Bacteria | 2052 |
| 98 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 99 | Ga0163162_10002529 | 3300013306 | Bacteria | 17304 |
| 100 | Ga0163162_10032478 | 3300013306 | Bacteria | 5186 |
| 101 | Ga0163162_10405908 | 3300013306 | Bacteria | 1495 |
| 102 | Ga0163162_10626202 | 3300013306 | Bacteria | 1201 |
| 103 | Ga0163162_10976707 | 3300013306 | Bacteria | 957 |
| 104 | Ga0157372_10003356 | 3300013307 | Bacteria | 17289 |
| 105 | Ga0157372_10055183 | 3300013307 | Bacteria | 4436 |
| 106 | Ga0157375_10016114 | 3300013308 | Bacteria | 6703 |
| 107 | Ga0157375_10035896 | 3300013308 | Bacteria | 4736 |
| 108 | Ga0157375_10055533 | 3300013308 | Bacteria | 3906 |
| 109 | Ga0163161_10018922 | 3300017792 | Bacteria | 4827 |
| 110 | Ga0207427_100309 | 3300025231 | Bacteria | 33924 |
| 111 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 112 | Ga0209437_100119 | 3300025233 | Bacteria | 206549 |
| 113 | Ga0209026_1007950 | 3300025250 | Bacteria | 2287 |
| 114 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 115 | Ga0209455_1011441 | 3300025272 | Bacteria | 2183 |
| 116 | Ga0207647_10032014 | 3300025904 | Bacteria | 3382 |
| 117 | Ga0207645_10000289 | 3300025907 | Bacteria | 42106 |
| 118 | Ga0207705_10000035 | 3300025909 | Bacteria | 201649 |
| 119 | Ga0207705_10034439 | 3300025909 | Bacteria | 3621 |
| 120 | Ga0207654_10046821 | 3300025911 | Bacteria | 2468 |
| 121 | Ga0207654_10091741 | 3300025911 | Bacteria | 1853 |
| 122 | Ga0207707_10049701 | 3300025912 | Bacteria | 3653 |
| 123 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 124 | Ga0207695_10084684 | 3300025913 | Bacteria | 3200 |
| 125 | Ga0207695_10086818 | 3300025913 | Bacteria | 3153 |
| 126 | Ga0207695_10108430 | 3300025913 | Bacteria | 2761 |
| 127 | Ga0207695_10184152 | 3300025913 | Bacteria | 2008 |
| 128 | Ga0207695_10470346 | 3300025913 | Bacteria | 1140 |
| 129 | Ga0207671_10002743 | 3300025914 | Bacteria | 18404 |
| 130 | Ga0207671_10012118 | 3300025914 | Bacteria | 6962 |
| 131 | Ga0207671_10020171 | 3300025914 | Bacteria | 5079 |
| 132 | Ga0207671_10021317 | 3300025914 | Bacteria | 4917 |
| 133 | Ga0207671_10033031 | 3300025914 | Bacteria | 3852 |
| 134 | Ga0207671_10060393 | 3300025914 | Bacteria | 2812 |
| 135 | Ga0207671_10103356 | 3300025914 | Bacteria | 2160 |
| 136 | Ga0207671_10270558 | 3300025914 | Bacteria | 1338 |
| 137 | Ga0207660_10009718 | 3300025917 | Bacteria | 6226 |
| 138 | Ga0207652_10029757 | 3300025921 | Bacteria | 4569 |
| 139 | Ga0207652_10045352 | 3300025921 | Bacteria | 3748 |
| 140 | Ga0207694_10399255 | 3300025924 | Bacteria | 1143 |
| 141 | Ga0207706_10089463 | 3300025933 | Bacteria | 2707 |
| 142 | Ga0207686_10068364 | 3300025934 | Bacteria | 2275 |
| 143 | Ga0207704_10000611 | 3300025938 | Bacteria | 15795 |
| 144 | Ga0207691_10248844 | 3300025940 | Bacteria | 1535 |
| 145 | Ga0207667_10000095 | 3300025949 | Bacteria | 143866 |
| 146 | Ga0207667_10018541 | 3300025949 | Bacteria | 7801 |
| 147 | Ga0207667_10292941 | 3300025949 | Bacteria | 1663 |
| 148 | Ga0207651_10141601 | 3300025960 | Bacteria | 1858 |
| 149 | Ga0207640_10035414 | 3300025981 | Bacteria | 3124 |
| 150 | Ga0207640_10282764 | 3300025981 | Bacteria | 1304 |
| 151 | Ga0207677_10173980 | 3300026023 | Unclassified | 1687 |
| 152 | Ga0207703_10180076 | 3300026035 | Bacteria | 1865 |
| 153 | Ga0207639_10042679 | 3300026041 | Bacteria | 3400 |
| 154 | Ga0207639_10142930 | 3300026041 | Bacteria | 1996 |
| 155 | Ga0207702_10000278 | 3300026078 | Bacteria | 58953 |
| 156 | Ga0207702_10039698 | 3300026078 | Bacteria | 3946 |
| 157 | Ga0207702_10053114 | 3300026078 | Bacteria | 3430 |
| 158 | Ga0207702_10087061 | 3300026078 | Bacteria | 2726 |
| 159 | Ga0207702_10282925 | 3300026078 | Bacteria | 1569 |
| 160 | Ga0207648_10000081 | 3300026089 | Bacteria | 90676 |
| 161 | Ga0207674_10281385 | 3300026116 | Bacteria | 1611 |
| 162 | Ga0207683_10040802 | 3300026121 | Bacteria | 4052 |
| 163 | Ga0207698_10234319 | 3300026142 | Bacteria | 1669 |
| 164 | Ga0268266_10000053 | 3300028379 | Bacteria | 295181 |
| 165 | Ga0307517_10000447 | 3300028786 | Bacteria | 70799 |
| 166 | Ga0307515_10000747 | 3300028794 | Bacteria | 75231 |
| 167 | Ga0307515_10003911 | 3300028794 | Bacteria | 31075 |
| 168 | Ga0307515_10079612 | 3300028794 | Bacteria | 4289 |
| 169 | Ga0265338_10018434 | 3300028800 | Bacteria | 7470 |
| 170 | Ga0307507_10001556 | 3300033179 | Bacteria | 51074 |
| 171 | Ga0307510_10008264 | 3300033180 | Bacteria | 12403 |
| 172 | Ga0395899_0000027 | 3300037312 | Bacteria | 337387 |
| 173 | Ga0395899_0035169 | 3300037312 | Bacteria | 3761 |
| 174 | Ga0395900_0010687 | 3300037418 | Bacteria | 9388 |
| 175 | Ga0395900_0622565 | 3300037418 | Bacteria | 1018 |
| 176 | Ga0395905_0002957 | 3300037471 | Bacteria | 18463 |
| 177 | Ga0395901_0000565 | 3300038443 | Bacteria | 42982 |
| 178 | Ga0436361_0402892 | 3300039447 | Bacteria | 11822 |
| 179 | Ga0451791_0744715 | 3300041451 | Bacteria | 822 |
| 180 | Ga0439448_0003114 | 3300042005 | Bacteria | 4569 |
| 181 | Ga0495629_0304130 | 3300046459 | Bacteria | 1092 |
| 182 | Ga0495650_0000144 | 3300046471 | Bacteria | 165957 |
| 183 | Ga0495650_0136577 | 3300046471 | Bacteria | 890 |
| 184 | Ga0495650_0139808 | 3300046471 | Bacteria | 877 |
| 185 | Ga0495585_0000091 | 3300046492 | Bacteria | 95620 |
| 186 | Ga0495585_0001011 | 3300046492 | Bacteria | 23448 |
| 187 | Ga0495585_0060985 | 3300046492 | Bacteria | 2075 |
| 188 | Ga0495607_0069397 | 3300046501 | Bacteria | 1973 |
| 189 | Ga0495583_0064945 | 3300046506 | Bacteria | 1618 |
| 190 | Ga0495606_0000430 | 3300046507 | Bacteria | 69872 |
| 191 | Ga0495606_0041007 | 3300046507 | Bacteria | 3107 |
| 192 | Ga0495606_0052440 | 3300046507 | Bacteria | 2652 |
| 193 | Ga0495610_0001601 | 3300046512 | Bacteria | 19932 |
| 194 | Ga0495610_0100427 | 3300046512 | Bacteria | 1297 |
| 195 | Ga0495616_0001184 | 3300046513 | Bacteria | 18406 |
| 196 | Ga0495631_0051584 | 3300046518 | Bacteria | 1797 |
| 197 | Ga0495632_0044547 | 3300046519 | Bacteria | 2214 |
| 198 | Ga0495632_0116252 | 3300046519 | Bacteria | 1253 |
| 199 | Ga0495644_0010276 | 3300046523 | Bacteria | 3606 |
| 200 | Ga0495648_0035543 | 3300046524 | Bacteria | 3229 |
| 201 | Ga0495652_0497033 | 3300046529 | Bacteria | 846 |
| 202 | Ga0495654_0069441 | 3300046530 | Bacteria | 1673 |
| 203 | Ga0495609_0006478 | 3300046538 | Bacteria | 5968 |
| 204 | Ga0495609_0046420 | 3300046538 | Bacteria | 1945 |
| 205 | Ga0495633_0000157 | 3300046558 | Bacteria | 89236 |
| 206 | Ga0495633_0004850 | 3300046558 | Bacteria | 8417 |
| 207 | Ga0495668_0000086 | 3300046616 | Bacteria | 151960 |
| 208 | Ga0495668_0146165 | 3300046616 | Bacteria | 1294 |
| 209 | Ga0495625_0000059 | 3300046660 | Bacteria | 180330 |
| 210 | Ga0495625_0002845 | 3300046660 | Bacteria | 18183 |
| 211 | Ga0495625_0002928 | 3300046660 | Bacteria | 17812 |
| 212 | Ga0495625_0013664 | 3300046660 | Bacteria | 6511 |
| 213 | Ga0495625_0015890 | 3300046660 | Bacteria | 5940 |
| 214 | Ga0495625_0019273 | 3300046660 | Bacteria | 5298 |
| 215 | Ga0495625_0088602 | 3300046660 | Bacteria | 2143 |
| 216 | Ga0495625_0258594 | 3300046660 | Bacteria | 1127 |
| 217 | Ga0495661_0003314 | 3300046665 | Bacteria | 11935 |
| 218 | Ga0495661_0016583 | 3300046665 | Bacteria | 4879 |
| 219 | Ga0495661_0022369 | 3300046665 | Bacteria | 4113 |
| 220 | Ga0495661_0136359 | 3300046665 | Bacteria | 1339 |
| 221 | Ga0495669_0111455 | 3300046684 | Bacteria | 1278 |
| 222 | Ga0495670_0103517 | 3300046691 | Bacteria | 1468 |
| 223 | Ga0495671_0216686 | 3300046692 | Bacteria | 927 |
| 224 | Ga0495649_0000031 | 3300046694 | Bacteria | 151547 |
| 225 | Ga0495589_0120832 | 3300046794 | Bacteria | 1261 |
| 226 | Ga0495660_0006773 | 3300046810 | Bacteria | 6757 |
| 227 | Ga0495660_0147425 | 3300046810 | Bacteria | 1165 |
| 228 | Ga0495683_0016530 | 3300047323 | Bacteria | 3831 |
| 229 | Ga0495683_0051020 | 3300047323 | Bacteria | 2070 |
| 230 | Ga0495687_004428 | 3300047443 | Bacteria | 9501 |
| 231 | Ga0495687_009766 | 3300047443 | Bacteria | 5332 |
| 232 | Ga0495687_054688 | 3300047443 | Bacteria | 1674 |
| 233 | Ga0495677_0035568 | 3300047445 | Bacteria | 1817 |
| 234 | Ga0495685_024317 | 3300047447 | Bacteria | 2085 |
| 235 | Ga0495673_0010017 | 3300047469 | Bacteria | 5191 |
| 236 | Ga0495686_0000621 | 3300047472 | Bacteria | 48956 |
| 237 | Ga0495686_0000821 | 3300047472 | Bacteria | 40069 |
| 238 | Ga0495686_0112699 | 3300047472 | Bacteria | 1629 |
| 239 | Ga0495614_0079198 | 3300048089 | Bacteria | 1422 |
| 240 | Ga0496126_0229718 | 3300048929 | Bacteria | 1555 |
| 241 | Ga0495678_004703 | 3300049459 | Bacteria | 7800 |
| 242 | Ga0495682_0027088 | 3300049460 | Bacteria | 2127 |
| 243 | nmdc:mga0k408_1733_c1 | 3300050493 | Bacteria | 11700 |
| 244 | nmdc:mga0k408_4746_c1 | 3300050493 | Bacteria | 7200 |
| 245 | Ga0500635_0007374 | 3300053080 | Bacteria | 2982 |
| 246 | Ga0500608_013571 | 3300053122 | Bacteria | 3613 |
| 247 | Ga0500614_073573 | 3300053123 | Bacteria | 943 |
| 248 | Ga0500618_000018 | 3300053125 | Bacteria | 163272 |
| 249 | Ga0500618_054568 | 3300053125 | Bacteria | 902 |
| 250 | Ga0500642_0007977 | 3300053130 | Bacteria | 3592 |
| 251 | Ga0500616_0029530 | 3300053153 | Bacteria | 3016 |
| 252 | Ga0500622_0001949 | 3300053156 | Bacteria | 15533 |
| 253 | Ga0500624_000172 | 3300053157 | Bacteria | 25880 |
| 254 | Ga0500634_0271249 | 3300053161 | Bacteria | 691 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047447 | Ga0495685_024317 | Ga0495685_024317_17_616 | 199 |
| 2 | 3300005578 | Ga0068854_100311781 | Ga0068854_1003117811 | 205 |
| 3 | 3300005616 | Ga0068852_100042977 | Ga0068852_1000429772 | 205 |
| 4 | 3300005842 | Ga0068858_100173504 | Ga0068858_1001735042 | 205 |
| 5 | 3300013306 | Ga0163162_10976707 | Ga0163162_109767072 | 205 |
| 6 | 3300025913 | Ga0207695_10000053 | Ga0207695_10000053266 | 205 |
| 7 | 3300025913 | Ga0207695_10184152 | Ga0207695_101841523 | 205 |
| 8 | 3300025914 | Ga0207671_10060393 | Ga0207671_100603931 | 205 |
| 9 | 3300025981 | Ga0207640_10282764 | Ga0207640_102827642 | 205 |
| 10 | 3300026035 | Ga0207703_10180076 | Ga0207703_101800762 | 205 |
| 11 | 3300053161 | Ga0500634_0271249 | Ga0500634_0271249_11_628 | 205 |
| 12 | 3300046810 | Ga0495660_0147425 | Ga0495660_0147425_173_868 | 225 |
| 13 | 3300005288 | Ga0065714_10071471 | Ga0065714_100714712 | 226 |
| 14 | 3300006195 | Ga0075366_10019430 | Ga0075366_100194302 | 226 |
| 15 | 3300013306 | Ga0163162_10626202 | Ga0163162_106262022 | 226 |
| 16 | 3300033179 | Ga0307507_10001556 | Ga0307507_1000155610 | 226 |
| 17 | 3300046459 | Ga0495629_0304130 | Ga0495629_0304130_89_787 | 226 |
| 18 | 3300046492 | Ga0495585_0001011 | Ga0495585_0001011_6772_7470 | 226 |
| 19 | 3300046524 | Ga0495648_0035543 | Ga0495648_0035543_2129_2827 | 226 |
| 20 | 3300046530 | Ga0495654_0069441 | Ga0495654_0069441_58_756 | 226 |
| 21 | 3300046538 | Ga0495609_0046420 | Ga0495609_0046420_1104_1802 | 226 |
| 22 | 3300046616 | Ga0495668_0000086 | Ga0495668_0000086_95838_96536 | 226 |
| 23 | 3300046660 | Ga0495625_0002928 | Ga0495625_0002928_12566_13264 | 226 |
| 24 | 3300046660 | Ga0495625_0019273 | Ga0495625_0019273_2255_2953 | 226 |
| 25 | 3300048089 | Ga0495614_0079198 | Ga0495614_0079198_512_1210 | 226 |
| 26 | 3300049460 | Ga0495682_0027088 | Ga0495682_0027088_262_960 | 226 |
| 27 | 3300050493 | nmdc:mga0k408_1733_c1 | nmdc:mga0k408_1733_c1_10315_11013 | 226 |
| 28 | 3300053123 | Ga0500614_073573 | Ga0500614_073573_124_822 | 226 |
| 29 | 3300046506 | Ga0495583_0064945 | Ga0495583_0064945_878_1576 | 227 |
| 30 | 3300046665 | Ga0495661_0003314 | Ga0495661_0003314_6173_6871 | 227 |
| 31 | iso_pu_bacteria | 2599185184 | 2599482013 | 228 |
| 32 | iso_pu_bacteria | 2852623160 | 2852625622 | 228 |
| 33 | iso_pu_bacteria | 2884933994 | 2884934620 | 228 |
| 34 | iso_pu_bacteria | 2919437846 | 2919440553 | 228 |
| 35 | iso_pu_bacteria | 2928078545 | 2928082122 | 228 |
| 36 | iso_pu_bacteria | 2928147474 | 2928149301 | 228 |
| 37 | iso_pu_bacteria | 2932082852 | 2932087964 | 228 |
| 38 | 3300046660 | Ga0495625_0013664 | Ga0495625_0013664_3825_4520 | 231 |
| 39 | 3300053156 | Ga0500622_0001949 | Ga0500622_0001949_12026_12721 | 231 |
| 40 | 3300001990 | JGI24737J22298_10000351 | JGI24737J22298_100003519 | 232 |
| 41 | 3300002067 | JGI24735J21928_10000015 | JGI24735J21928_1000001537 | 232 |
| 42 | 3300002737 | JGI25162J39368_1000016 | JGI25162J39368_1000016204 | 232 |
| 43 | 3300002772 | JGI25164J39214_1000885 | JGI25164J39214_10008859 | 232 |
| 44 | 3300003214 | JGI25165J46597_1001337 | JGI25165J46597_10013375 | 232 |
| 45 | 3300003316 | rootH1_10095582 | rootH1_100955822 | 232 |
| 46 | 3300003320 | rootH2_10049945 | rootH2_100499453 | 232 |
| 47 | 3300003322 | rootL2_10032779 | rootL2_100327793 | 232 |
| 48 | 3300003322 | rootL2_10037514 | rootL2_100375142 | 232 |
| 49 | 3300003323 | rootH1_10012646 | rootH1_1001264621 | 232 |
| 50 | 3300003323 | rootH1_10054869 | rootH1_100548692 | 232 |
| 51 | 3300003323 | rootH1_10125780 | rootH1_101257801 | 232 |
| 52 | 3300005288 | Ga0065714_10003781 | Ga0065714_100037813 | 232 |
| 53 | 3300005288 | Ga0065714_10101285 | Ga0065714_101012852 | 232 |
| 54 | 3300005327 | Ga0070658_10046669 | Ga0070658_100466693 | 232 |
| 55 | 3300005327 | Ga0070658_10214721 | Ga0070658_102147212 | 232 |
| 56 | 3300005328 | Ga0070676_10001032 | Ga0070676_100010324 | 232 |
| 57 | 3300005334 | Ga0068869_100346431 | Ga0068869_1003464311 | 232 |
| 58 | 3300005336 | Ga0070680_100014364 | Ga0070680_1000143643 | 232 |
| 59 | 3300005338 | Ga0068868_100077823 | Ga0068868_1000778232 | 232 |
| 60 | 3300005356 | Ga0070674_100065975 | Ga0070674_1000659752 | 232 |
| 61 | 3300005364 | Ga0070673_100009101 | Ga0070673_1000091012 | 232 |
| 62 | 3300005456 | Ga0070678_100003253 | Ga0070678_1000032534 | 232 |
| 63 | 3300005457 | Ga0070662_100062543 | Ga0070662_1000625432 | 232 |
| 64 | 3300005458 | Ga0070681_10067347 | Ga0070681_100673473 | 232 |
| 65 | 3300005459 | Ga0068867_100000211 | Ga0068867_1000002115 | 232 |
| 66 | 3300005530 | Ga0070679_100003625 | Ga0070679_10000362516 | 232 |
| 67 | 3300005539 | Ga0068853_100009441 | Ga0068853_1000094413 | 232 |
| 68 | 3300005539 | Ga0068853_100079341 | Ga0068853_1000793412 | 232 |
| 69 | 3300005539 | Ga0068853_100082592 | Ga0068853_1000825922 | 232 |
| 70 | 3300005539 | Ga0068853_100552686 | Ga0068853_1005526862 | 232 |
| 71 | 3300005543 | Ga0070672_100142160 | Ga0070672_1001421602 | 232 |
| 72 | 3300005548 | Ga0070665_100000061 | Ga0070665_100000061129 | 232 |
| 73 | 3300005563 | Ga0068855_100000204 | Ga0068855_10000020426 | 232 |
| 74 | 3300005563 | Ga0068855_100047775 | Ga0068855_1000477753 | 232 |
| 75 | 3300005563 | Ga0068855_100140772 | Ga0068855_1001407723 | 232 |
| 76 | 3300005563 | Ga0068855_100254249 | Ga0068855_1002542492 | 232 |
| 77 | 3300005563 | Ga0068855_101009190 | Ga0068855_1010091902 | 232 |
| 78 | 3300005577 | Ga0068857_100305075 | Ga0068857_1003050753 | 232 |
| 79 | 3300005577 | Ga0068857_100324966 | Ga0068857_1003249662 | 232 |
| 80 | 3300005578 | Ga0068854_100046670 | Ga0068854_1000466703 | 232 |
| 81 | 3300005614 | Ga0068856_100000112 | Ga0068856_10000011230 | 232 |
| 82 | 3300005614 | Ga0068856_100003707 | Ga0068856_1000037072 | 232 |
| 83 | 3300005614 | Ga0068856_100007894 | Ga0068856_10000789410 | 232 |
| 84 | 3300005614 | Ga0068856_100071737 | Ga0068856_1000717373 | 232 |
| 85 | 3300005614 | Ga0068856_100168277 | Ga0068856_1001682772 | 232 |
| 86 | 3300005614 | Ga0068856_100685550 | Ga0068856_1006855501 | 232 |
| 87 | 3300005616 | Ga0068852_100003124 | Ga0068852_1000031247 | 232 |
| 88 | 3300005616 | Ga0068852_100972101 | Ga0068852_1009721011 | 232 |
| 89 | 3300006237 | Ga0097621_100000016 | Ga0097621_10000001644 | 232 |
| 90 | 3300006358 | Ga0068871_100000504 | Ga0068871_10000050413 | 232 |
| 91 | 3300006881 | Ga0068865_100000063 | Ga0068865_1000000635 | 232 |
| 92 | 3300009093 | Ga0105240_10000082 | Ga0105240_1000008285 | 232 |
| 93 | 3300009093 | Ga0105240_10070139 | Ga0105240_100701393 | 232 |
| 94 | 3300009093 | Ga0105240_10079849 | Ga0105240_100798494 | 232 |
| 95 | 3300009093 | Ga0105240_10093972 | Ga0105240_100939722 | 232 |
| 96 | 3300009093 | Ga0105240_10166788 | Ga0105240_101667882 | 232 |
| 97 | 3300009093 | Ga0105240_10193224 | Ga0105240_101932243 | 232 |
| 98 | 3300009093 | Ga0105240_10259216 | Ga0105240_102592162 | 232 |
| 99 | 3300009093 | Ga0105240_10474803 | Ga0105240_104748032 | 232 |
| 100 | 3300009093 | Ga0105240_10600857 | Ga0105240_106008571 | 232 |
| 101 | 3300009174 | Ga0105241_10003889 | Ga0105241_100038895 | 232 |
| 102 | 3300009174 | Ga0105241_10006907 | Ga0105241_100069072 | 232 |
| 103 | 3300009545 | Ga0105237_10002253 | Ga0105237_100022538 | 232 |
| 104 | 3300009545 | Ga0105237_10008175 | Ga0105237_100081756 | 232 |
| 105 | 3300009545 | Ga0105237_10009770 | Ga0105237_100097705 | 232 |
| 106 | 3300009545 | Ga0105237_10011011 | Ga0105237_100110115 | 232 |
| 107 | 3300009545 | Ga0105237_10037116 | Ga0105237_100371162 | 232 |
| 108 | 3300009545 | Ga0105237_10037117 | Ga0105237_100371172 | 232 |
| 109 | 3300009545 | Ga0105237_10066866 | Ga0105237_100668662 | 232 |
| 110 | 3300009545 | Ga0105237_10106186 | Ga0105237_101061862 | 232 |
| 111 | 3300009545 | Ga0105237_10171164 | Ga0105237_101711642 | 232 |
| 112 | 3300009545 | Ga0105237_10283523 | Ga0105237_102835232 | 232 |
| 113 | 3300009551 | Ga0105238_10011297 | Ga0105238_100112972 | 232 |
| 114 | 3300009551 | Ga0105238_10624965 | Ga0105238_106249652 | 232 |
| 115 | 3300009551 | Ga0105238_10947723 | Ga0105238_109477231 | 232 |
| 116 | 3300010375 | Ga0105239_10000166 | Ga0105239_1000016682 | 232 |
| 117 | 3300010375 | Ga0105239_10000740 | Ga0105239_1000074024 | 232 |
| 118 | 3300010375 | Ga0105239_10001606 | Ga0105239_1000160614 | 232 |
| 119 | 3300010375 | Ga0105239_10015876 | Ga0105239_100158765 | 232 |
| 120 | 3300010375 | Ga0105239_10016923 | Ga0105239_100169238 | 232 |
| 121 | 3300010375 | Ga0105239_10018327 | Ga0105239_100183274 | 232 |
| 122 | 3300010375 | Ga0105239_10124138 | Ga0105239_101241383 | 232 |
| 123 | 3300010375 | Ga0105239_10224604 | Ga0105239_102246042 | 232 |
| 124 | 3300013104 | Ga0157370_10093764 | Ga0157370_100937642 | 232 |
| 125 | 3300013104 | Ga0157370_10124419 | Ga0157370_101244192 | 232 |
| 126 | 3300013105 | Ga0157369_10100098 | Ga0157369_101000983 | 232 |
| 127 | 3300013296 | Ga0157374_10000642 | Ga0157374_1000064214 | 232 |
| 128 | 3300013296 | Ga0157374_10173550 | Ga0157374_101735502 | 232 |
| 129 | 3300013297 | Ga0157378_10023503 | Ga0157378_100235033 | 232 |
| 130 | 3300013297 | Ga0157378_10027254 | Ga0157378_100272543 | 232 |
| 131 | 3300013297 | Ga0157378_10168607 | Ga0157378_101686073 | 232 |
| 132 | 3300013306 | Ga0163162_10000012 | Ga0163162_10000012232 | 232 |
| 133 | 3300013306 | Ga0163162_10002529 | Ga0163162_100025295 | 232 |
| 134 | 3300013306 | Ga0163162_10032478 | Ga0163162_100324785 | 232 |
| 135 | 3300013306 | Ga0163162_10405908 | Ga0163162_104059082 | 232 |
| 136 | 3300013307 | Ga0157372_10003356 | Ga0157372_100033562 | 232 |
| 137 | 3300013307 | Ga0157372_10055183 | Ga0157372_100551833 | 232 |
| 138 | 3300013308 | Ga0157375_10016114 | Ga0157375_100161141 | 232 |
| 139 | 3300013308 | Ga0157375_10035896 | Ga0157375_100358963 | 232 |
| 140 | 3300013308 | Ga0157375_10055533 | Ga0157375_100555332 | 232 |
| 141 | 3300017792 | Ga0163161_10018922 | Ga0163161_100189223 | 232 |
| 142 | 3300025231 | Ga0207427_100309 | Ga0207427_10030913 | 232 |
| 143 | 3300025233 | Ga0209437_100048 | Ga0209437_100048308 | 232 |
| 144 | 3300025233 | Ga0209437_100119 | Ga0209437_100119121 | 232 |
| 145 | 3300025250 | Ga0209026_1007950 | Ga0209026_10079502 | 232 |
| 146 | 3300025261 | Ga0209233_1000029 | Ga0209233_100002968 | 232 |
| 147 | 3300025272 | Ga0209455_1011441 | Ga0209455_10114412 | 232 |
| 148 | 3300025904 | Ga0207647_10032014 | Ga0207647_100320142 | 232 |
| 149 | 3300025907 | Ga0207645_10000289 | Ga0207645_1000028931 | 232 |
| 150 | 3300025909 | Ga0207705_10000035 | Ga0207705_1000003520 | 232 |
| 151 | 3300025909 | Ga0207705_10034439 | Ga0207705_100344393 | 232 |
| 152 | 3300025911 | Ga0207654_10046821 | Ga0207654_100468212 | 232 |
| 153 | 3300025911 | Ga0207654_10091741 | Ga0207654_100917412 | 232 |
| 154 | 3300025912 | Ga0207707_10049701 | Ga0207707_100497013 | 232 |
| 155 | 3300025913 | Ga0207695_10084684 | Ga0207695_100846842 | 232 |
| 156 | 3300025913 | Ga0207695_10086818 | Ga0207695_100868183 | 232 |
| 157 | 3300025913 | Ga0207695_10108430 | Ga0207695_101084302 | 232 |
| 158 | 3300025913 | Ga0207695_10470346 | Ga0207695_104703462 | 232 |
| 159 | 3300025914 | Ga0207671_10002743 | Ga0207671_1000274317 | 232 |
| 160 | 3300025914 | Ga0207671_10012118 | Ga0207671_100121183 | 232 |
| 161 | 3300025914 | Ga0207671_10020171 | Ga0207671_100201712 | 232 |
| 162 | 3300025914 | Ga0207671_10021317 | Ga0207671_100213172 | 232 |
| 163 | 3300025914 | Ga0207671_10033031 | Ga0207671_100330312 | 232 |
| 164 | 3300025914 | Ga0207671_10103356 | Ga0207671_101033562 | 232 |
| 165 | 3300025914 | Ga0207671_10270558 | Ga0207671_102705582 | 232 |
| 166 | 3300025917 | Ga0207660_10009718 | Ga0207660_100097185 | 232 |
| 167 | 3300025921 | Ga0207652_10029757 | Ga0207652_100297572 | 232 |
| 168 | 3300025921 | Ga0207652_10045352 | Ga0207652_100453522 | 232 |
| 169 | 3300025924 | Ga0207694_10399255 | Ga0207694_103992552 | 232 |
| 170 | 3300025933 | Ga0207706_10089463 | Ga0207706_100894632 | 232 |
| 171 | 3300025934 | Ga0207686_10068364 | Ga0207686_100683643 | 232 |
| 172 | 3300025938 | Ga0207704_10000611 | Ga0207704_100006115 | 232 |
| 173 | 3300025940 | Ga0207691_10248844 | Ga0207691_102488441 | 232 |
| 174 | 3300025949 | Ga0207667_10000095 | Ga0207667_1000009597 | 232 |
| 175 | 3300025949 | Ga0207667_10018541 | Ga0207667_100185415 | 232 |
| 176 | 3300025949 | Ga0207667_10292941 | Ga0207667_102929412 | 232 |
| 177 | 3300025960 | Ga0207651_10141601 | Ga0207651_101416011 | 232 |
| 178 | 3300025981 | Ga0207640_10035414 | Ga0207640_100354142 | 232 |
| 179 | 3300026023 | Ga0207677_10173980 | Ga0207677_101739802 | 232 |
| 180 | 3300026041 | Ga0207639_10042679 | Ga0207639_100426792 | 232 |
| 181 | 3300026041 | Ga0207639_10142930 | Ga0207639_101429302 | 232 |
| 182 | 3300026078 | Ga0207702_10000278 | Ga0207702_1000027849 | 232 |
| 183 | 3300026078 | Ga0207702_10039698 | Ga0207702_100396981 | 232 |
| 184 | 3300026078 | Ga0207702_10053114 | Ga0207702_100531142 | 232 |
| 185 | 3300026078 | Ga0207702_10087061 | Ga0207702_100870612 | 232 |
| 186 | 3300026078 | Ga0207702_10282925 | Ga0207702_102829252 | 232 |
| 187 | 3300026089 | Ga0207648_10000081 | Ga0207648_1000008110 | 232 |
| 188 | 3300026116 | Ga0207674_10281385 | Ga0207674_102813852 | 232 |
| 189 | 3300026121 | Ga0207683_10040802 | Ga0207683_100408025 | 232 |
| 190 | 3300026142 | Ga0207698_10234319 | Ga0207698_102343192 | 232 |
| 191 | 3300028379 | Ga0268266_10000053 | Ga0268266_1000005375 | 232 |
| 192 | 3300028786 | Ga0307517_10000447 | Ga0307517_1000044729 | 232 |
| 193 | 3300028794 | Ga0307515_10000747 | Ga0307515_1000074754 | 232 |
| 194 | 3300028794 | Ga0307515_10003911 | Ga0307515_100039115 | 232 |
| 195 | 3300028794 | Ga0307515_10079612 | Ga0307515_100796123 | 232 |
| 196 | 3300028800 | Ga0265338_10018434 | Ga0265338_100184343 | 232 |
| 197 | 3300033180 | Ga0307510_10008264 | Ga0307510_100082649 | 232 |
| 198 | 3300037312 | Ga0395899_0000027 | Ga0395899_0000027_187618_188316 | 232 |
| 199 | 3300037312 | Ga0395899_0035169 | Ga0395899_0035169_2911_3609 | 232 |
| 200 | 3300037418 | Ga0395900_0010687 | Ga0395900_0010687_6861_7559 | 232 |
| 201 | 3300037418 | Ga0395900_0622565 | Ga0395900_0622565_139_837 | 232 |
| 202 | 3300037471 | Ga0395905_0002957 | Ga0395905_0002957_11861_12559 | 232 |
| 203 | 3300038443 | Ga0395901_0000565 | Ga0395901_0000565_42122_42820 | 232 |
| 204 | 3300039447 | Ga0436361_0402892 | Ga0436361_0402892_2211_2909 | 232 |
| 205 | 3300041451 | Ga0451791_0744715 | Ga0451791_0744715_67_765 | 232 |
| 206 | 3300042005 | Ga0439448_0003114 | Ga0439448_0003114_3225_3923 | 232 |
| 207 | 3300046471 | Ga0495650_0000144 | Ga0495650_0000144_105713_106411 | 232 |
| 208 | 3300046471 | Ga0495650_0136577 | Ga0495650_0136577_109_807 | 232 |
| 209 | 3300046471 | Ga0495650_0139808 | Ga0495650_0139808_11_709 | 232 |
| 210 | 3300046492 | Ga0495585_0000091 | Ga0495585_0000091_61779_62477 | 232 |
| 211 | 3300046492 | Ga0495585_0060985 | Ga0495585_0060985_912_1610 | 232 |
| 212 | 3300046501 | Ga0495607_0069397 | Ga0495607_0069397_663_1361 | 232 |
| 213 | 3300046507 | Ga0495606_0000430 | Ga0495606_0000430_6409_7107 | 232 |
| 214 | 3300046507 | Ga0495606_0041007 | Ga0495606_0041007_531_1229 | 232 |
| 215 | 3300046507 | Ga0495606_0052440 | Ga0495606_0052440_131_829 | 232 |
| 216 | 3300046512 | Ga0495610_0001601 | Ga0495610_0001601_3505_4203 | 232 |
| 217 | 3300046512 | Ga0495610_0100427 | Ga0495610_0100427_402_1100 | 232 |
| 218 | 3300046513 | Ga0495616_0001184 | Ga0495616_0001184_1675_2373 | 232 |
| 219 | 3300046518 | Ga0495631_0051584 | Ga0495631_0051584_648_1346 | 232 |
| 220 | 3300046519 | Ga0495632_0044547 | Ga0495632_0044547_764_1462 | 232 |
| 221 | 3300046519 | Ga0495632_0116252 | Ga0495632_0116252_43_741 | 232 |
| 222 | 3300046523 | Ga0495644_0010276 | Ga0495644_0010276_2067_2765 | 232 |
| 223 | 3300046529 | Ga0495652_0497033 | Ga0495652_0497033_69_767 | 232 |
| 224 | 3300046538 | Ga0495609_0006478 | Ga0495609_0006478_1267_1965 | 232 |
| 225 | 3300046558 | Ga0495633_0000157 | Ga0495633_0000157_5252_5950 | 232 |
| 226 | 3300046558 | Ga0495633_0004850 | Ga0495633_0004850_2397_3095 | 232 |
| 227 | 3300046616 | Ga0495668_0146165 | Ga0495668_0146165_508_1206 | 232 |
| 228 | 3300046660 | Ga0495625_0000059 | Ga0495625_0000059_71809_72507 | 232 |
| 229 | 3300046660 | Ga0495625_0002845 | Ga0495625_0002845_4719_5417 | 232 |
| 230 | 3300046660 | Ga0495625_0015890 | Ga0495625_0015890_2101_2799 | 232 |
| 231 | 3300046660 | Ga0495625_0088602 | Ga0495625_0088602_275_973 | 232 |
| 232 | 3300046660 | Ga0495625_0258594 | Ga0495625_0258594_275_973 | 232 |
| 233 | 3300046665 | Ga0495661_0016583 | Ga0495661_0016583_2574_3272 | 232 |
| 234 | 3300046665 | Ga0495661_0022369 | Ga0495661_0022369_115_813 | 232 |
| 235 | 3300046665 | Ga0495661_0136359 | Ga0495661_0136359_57_755 | 232 |
| 236 | 3300046684 | Ga0495669_0111455 | Ga0495669_0111455_255_953 | 232 |
| 237 | 3300046691 | Ga0495670_0103517 | Ga0495670_0103517_244_942 | 232 |
| 238 | 3300046692 | Ga0495671_0216686 | Ga0495671_0216686_68_766 | 232 |
| 239 | 3300046694 | Ga0495649_0000031 | Ga0495649_0000031_43033_43731 | 232 |
| 240 | 3300046794 | Ga0495589_0120832 | Ga0495589_0120832_115_813 | 232 |
| 241 | 3300046810 | Ga0495660_0006773 | Ga0495660_0006773_211_909 | 232 |
| 242 | 3300047323 | Ga0495683_0016530 | Ga0495683_0016530_1992_2690 | 232 |
| 243 | 3300047323 | Ga0495683_0051020 | Ga0495683_0051020_351_1049 | 232 |
| 244 | 3300047443 | Ga0495687_004428 | Ga0495687_004428_2121_2819 | 232 |
| 245 | 3300047443 | Ga0495687_009766 | Ga0495687_009766_634_1332 | 232 |
| 246 | 3300047443 | Ga0495687_054688 | Ga0495687_054688_82_780 | 232 |
| 247 | 3300047445 | Ga0495677_0035568 | Ga0495677_0035568_259_957 | 232 |
| 248 | 3300047469 | Ga0495673_0010017 | Ga0495673_0010017_1589_2287 | 232 |
| 249 | 3300047472 | Ga0495686_0000621 | Ga0495686_0000621_18339_19037 | 232 |
| 250 | 3300047472 | Ga0495686_0000821 | Ga0495686_0000821_27160_27858 | 232 |
| 251 | 3300047472 | Ga0495686_0112699 | Ga0495686_0112699_140_838 | 232 |
| 252 | 3300048929 | Ga0496126_0229718 | Ga0496126_0229718_601_1299 | 232 |
| 253 | 3300049459 | Ga0495678_004703 | Ga0495678_004703_6674_7372 | 232 |
| 254 | 3300050493 | nmdc:mga0k408_4746_c1 | nmdc:mga0k408_4746_c1_872_1570 | 232 |
| 255 | 3300053080 | Ga0500635_0007374 | Ga0500635_0007374_866_1564 | 232 |
| 256 | 3300053122 | Ga0500608_013571 | Ga0500608_013571_2597_3295 | 232 |
| 257 | 3300053125 | Ga0500618_000018 | Ga0500618_000018_136903_137601 | 232 |
| 258 | 3300053125 | Ga0500618_054568 | Ga0500618_054568_119_817 | 232 |
| 259 | 3300053130 | Ga0500642_0007977 | Ga0500642_0007977_360_1058 | 232 |
| 260 | 3300053153 | Ga0500616_0029530 | Ga0500616_0029530_665_1363 | 232 |
| 261 | 3300053157 | Ga0500624_000172 | Ga0500624_000172_1734_2432 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ecb-assembly1.cif.gz_A | escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit | 0.7786 | 96 | 225 |
| 8w7d-assembly1.cif.gz_A | crystal structure of ecppat-fr901483 complex | 0.7564 | 96 | 227 |
| 7p0h-assembly2.cif.gz_B | crystal structure of helicobacter pylori comf fused to an artificial alpharep crystallization helper(named b2) | 0.754 | 2 | 232 |
| 1ecf-assembly1.cif.gz_B | escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase | 0.7522 | 96 | 225 |
| 8dbo-assembly1.cif.gz_A | human prps1-e307a engineered mutation with adp; hexamer | 0.7271 | 100 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P46846_104_226_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9173 | 109 | 230 | 3.40.50.2020 |
| af_P46846_104_226_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8893 | 109 | 230 | 3.40.50.2020 |
| af_Q2G056_117_224_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8471 | 117 | 229 | 3.40.50.2020 |
| af_Q2G056_117_224_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8258 | 117 | 229 | 3.40.50.2020 |
| af_Q22134_2_446_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7819 | 93 | 223 | 3.60.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645IR79-F1-model_v4 | Phosphoribosyltransferase domain-containing protein | 0.9715 | 100 | 232 |
|
| AF-A0A645IR79-F1-model_v4 | Phosphoribosyltransferase domain-containing protein | 0.9574 | 100 | 232 |
|
| AF-A0A5M4AHR5-F1-model_v4 | Phosphoribosyltransferase domain-containing protein | 0.9521 | 56 | 230 |
|
| AF-A0A2L2WQE1-F1-model_v4 | ComF family protein | 0.95 | 103 | 232 |
|
| AF-A0A512BGG3-F1-model_v4 | Phosphoribosyltransferase domain-containing protein | 0.9445 | 80 | 232 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar