F370536

General Info

Members Datasets Scaffolds Average Seq Length
261 156 522 435

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0002678|Ga0466964_0002678_2791_4248
Length 485
Sequence VAEAERQHPNVTLAILALGAAAYALLQSAVVPALSDLQRSLHTSETGIAWVLTAYLLSASVATPVLGRLGDMFGKERVLLWTYVLLAAGTLMAALVDSVGLLDVARVIQGAGGGVFPLAFGIIRDEFPREKVAGAIGLLSAILGIGAGAGIVLGGLIVEHLSWHWLFWLPLIALVGAVVLTALYVPESPVRVPGRINWLSGLLMGLGLSAVLLAISEATVWGWGSAKTVGLLLGGLAVCVAWVLAELRSAEPLVDMGMMRLRGVWTTNLAGFLLGGGMYASFILIPQFVEEPHSTGYGFGASVLAGGIYLLPSTVAMLVTGSLAGRLXXXFGSKSALVAGAVICAGAYLILTLAHSRPWHVYVAAGLLGAGIGLAFAAMGNLIVQAVPAGQTGVASGMNTVLRTIGGAVGVALAATLIAAHTGPGGLPAEHGYVLAFLLSLAFLAVCVLASLLVPGASSVDEDEAERHEAEHARRRGHRERAVRA

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 12.64
Rhizosphere 82.38
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0002678 3300044706 Bacteria 6380
2 rootH2_10012791 3300003320 Bacteria 9344
3 Ga0070683_100027982 3300005329 Bacteria 5090
4 Ga0070680_100006974 3300005336 Bacteria 8612
5 Ga0070680_100018757 3300005336 Bacteria 5474
6 Ga0070680_100046006 3300005336 Bacteria 3549
7 Ga0070682_100007912 3300005337 Bacteria 5984
8 Ga0070682_100008022 3300005337 Bacteria 5945
9 Ga0070660_100020926 3300005339 Bacteria 4815
10 Ga0070660_100051728 3300005339 Bacteria 3164
11 Ga0070660_100079959 3300005339 Bacteria 2565
12 Ga0070660_100187256 3300005339 Bacteria 1676
13 Ga0070661_100033052 3300005344 Bacteria 3746
14 Ga0070668_100010552 3300005347 Bacteria 6871
15 Ga0070659_100082297 3300005366 Bacteria 2572
16 Ga0070667_100000192 3300005367 Bacteria 72961
17 Ga0070709_10010432 3300005434 Bacteria 5148
18 Ga0070714_100111391 3300005435 Bacteria 2424
19 Ga0070713_100085812 3300005436 Bacteria 2697
20 Ga0070711_100052472 3300005439 Bacteria 2806
21 Ga0070708_100008324 3300005445 Bacteria 8329
22 Ga0070681_10021702 3300005458 Bacteria 6438
23 Ga0070681_10022968 3300005458 Bacteria 6268
24 Ga0070681_10029115 3300005458 Bacteria 5545
25 Ga0070681_10122676 3300005458 Bacteria 2531
26 Ga0070681_10168840 3300005458 Bacteria 2110
27 Ga0070706_100056733 3300005467 Bacteria 3614
28 Ga0070707_100211144 3300005468 Bacteria 1892
29 Ga0070679_100018391 3300005530 Bacteria 6781
30 Ga0070679_100093640 3300005530 Bacteria 2992
31 Ga0070684_100009787 3300005535 Bacteria 7569
32 Ga0068853_100120063 3300005539 Bacteria 2344
33 Ga0068855_100222134 3300005563 Bacteria 2118
34 Ga0068856_100013467 3300005614 Bacteria 7914
35 Ga0068856_100069071 3300005614 Bacteria 3493
36 Ga0068856_100112961 3300005614 Bacteria 2714
37 Ga0068852_100026579 3300005616 Bacteria 4707
38 Ga0068852_100140842 3300005616 Bacteria 2232
39 Ga0068860_100169002 3300005843 Bacteria 2112
40 Ga0068862_100000050 3300005844 Bacteria 145502
41 Ga0070717_10006294 3300006028 Bacteria 8718
42 Ga0070717_10007865 3300006028 Bacteria 7938
43 Ga0070712_100033911 3300006175 Bacteria 3457
44 Ga0105245_10004769 3300009098 Bacteria 11968
45 Ga0105241_10178997 3300009174 Bacteria 1757
46 Ga0105238_10164695 3300009551 Bacteria 2193
47 Ga0105249_10001649 3300009553 Bacteria 19558
48 Ga0157370_10154006 3300013104 Bacteria 2139
49 Ga0157369_10006313 3300013105 Bacteria 13763
50 Ga0157369_10046925 3300013105 Bacteria 4693
51 Ga0157369_10106705 3300013105 Bacteria 2980
52 Ga0157369_10189646 3300013105 Bacteria 2160
53 Ga0157369_10213613 3300013105 Bacteria 2021
54 Ga0157372_10054576 3300013307 Bacteria 4458
55 Ga0157372_10185139 3300013307 Bacteria 2411
56 Ga0157379_10037383 3300014968 Bacteria 4329
57 Ga0206353_10703416 3300020082 Bacteria 1968
58 Ga0206353_12004089 3300020082 Bacteria 3371
59 Ga0213874_10000147 3300021377 Bacteria 12174
60 Ga0207707_10146230 3300025912 Bacteria 2066
61 Ga0207663_10061636 3300025916 Bacteria 2381
62 Ga0207660_10004053 3300025917 Bacteria 9559
63 Ga0207657_10003035 3300025919 Bacteria 17975
64 Ga0207657_10012499 3300025919 Bacteria 8380
65 Ga0207657_10032982 3300025919 Bacteria 4672
66 Ga0207657_10033517 3300025919 Bacteria 4629
67 Ga0207657_10057428 3300025919 Bacteria 3354
68 Ga0207657_10182743 3300025919 Bacteria 1694
69 Ga0207649_10069977 3300025920 Bacteria 2236
70 Ga0207652_10033539 3300025921 Bacteria 4323
71 Ga0207652_10036746 3300025921 Bacteria 4142
72 Ga0207652_10064519 3300025921 Bacteria 3169
73 Ga0207687_10057308 3300025927 Bacteria 2737
74 Ga0207700_10000002 3300025928 Bacteria 775978
75 Ga0207700_10006260 3300025928 Bacteria 7178
76 Ga0207664_10008067 3300025929 Bacteria 7324
77 Ga0207664_10032855 3300025929 Bacteria 3981
78 Ga0207664_10142091 3300025929 Bacteria 2032
79 Ga0207690_10181929 3300025932 Bacteria 1583
80 Ga0207667_10169206 3300025949 Bacteria 2246
81 Ga0207712_10001339 3300025961 Bacteria 16877
82 Ga0207668_10021142 3300025972 Bacteria 4147
83 Ga0207658_10009938 3300025986 Bacteria 6464
84 Ga0207702_10009768 3300026078 Bacteria 8053
85 Ga0207674_10006044 3300026116 Bacteria 14320
86 Ga0207698_10115834 3300026142 Bacteria 2257
87 Ga0268265_10001491 3300028380 Bacteria 19606
88 Ga0268264_10178869 3300028381 Bacteria 1925
89 Ga0265337_1000952 3300028556 Bacteria 15138
90 Ga0265319_1000217 3300028563 Bacteria 43119
91 Ga0265318_10000748 3300028577 Bacteria 21649
92 Ga0265338_10004577 3300028800 Bacteria 18602
93 Ga0265324_10002016 3300029957 Bacteria 10818
94 Ga0265327_10006463 3300031251 Bacteria 9361
95 Ga0265316_10016540 3300031344 Bacteria 6394
96 Ga0373926_0048863 3300035083 Bacteria 1522
97 Ga0373945_0024372 3300035116 Bacteria 2096
98 Ga0373943_0001587 3300035170 Bacteria 10292
99 Ga0373943_0024172 3300035170 Bacteria 2831
100 Ga0373946_0041967 3300035171 Bacteria 1878
101 Ga0373935_0035614 3300035692 Bacteria 3107
102 Ga0373927_0026571 3300035695 Bacteria 3784
103 Ga0373947_0001682 3300035725 Bacteria 13546
104 Ga0373947_0012906 3300035725 Bacteria 4789
105 Ga0373937_0262179 3300036401 Bacteria 1630
106 Ga0373925_0018101 3300037068 Bacteria 5116
107 Ga0373925_0066686 3300037068 Bacteria 2713
108 Ga0395898_0082160 3300037466 Bacteria 3106
109 Ga0436364_0068592 3300037853 Bacteria 1598
110 Ga0436364_0757072 3300037853 Bacteria 9325
111 Ga0395901_0079464 3300038443 Bacteria 3425
112 Ga0436365_0116219 3300039437 Bacteria 10872
113 Ga0436365_0911509 3300039437 Bacteria 21390
114 Ga0436365_1158902 3300039437 Bacteria 18203
115 Ga0436365_1290693 3300039437 Bacteria 14319
116 Ga0436363_0062885 3300039450 Bacteria 7989
117 Ga0436363_0592624 3300039450 Bacteria 2494
118 Ga0436363_0812143 3300039450 Bacteria 15027
119 Ga0466966_0003309 3300044684 Bacteria 10620
120 Ga0466961_0001051 3300044693 Bacteria 17008
121 Ga0466961_0100068 3300044693 Bacteria 1827
122 Ga0466963_0000220 3300044694 Bacteria 24498
123 Ga0466963_0011095 3300044694 Bacteria 5479
124 Ga0466963_0019503 3300044694 Bacteria 4255
125 Ga0466963_0020952 3300044694 Bacteria 4119
126 Ga0466963_0021266 3300044694 Bacteria 4091
127 Ga0466963_0026094 3300044694 Bacteria 3734
128 Ga0466964_0028292 3300044706 Bacteria 2207
129 Ga0466971_0012489 3300044719 Bacteria 3724
130 Ga0466968_0022208 3300044735 Bacteria 2578
131 Ga0466957_0025823 3300044842 Bacteria 3482
132 Ga0466957_0044698 3300044842 Bacteria 2685
133 Ga0466959_0020196 3300045049 Bacteria 4904
134 Ga0466959_0085907 3300045049 Bacteria 2263
135 Ga0466958_0013873 3300045836 Bacteria 4595
136 Ga0466958_0016453 3300045836 Bacteria 4259
137 Ga0466958_0018560 3300045836 Bacteria 4039
138 Ga0466967_0000877 3300045976 Bacteria 16005
139 Ga0466967_0004825 3300045976 Bacteria 9194
140 Ga0466967_0009371 3300045976 Bacteria 7260
141 Ga0466967_0018450 3300045976 Bacteria 5576
142 Ga0466967_0033921 3300045976 Bacteria 4326
143 Ga0466967_0045660 3300045976 Bacteria 3807
144 Ga0466967_0060160 3300045976 Bacteria 3365
145 Ga0466967_0108759 3300045976 Bacteria 2544
146 Ga0466967_0132912 3300045976 Bacteria 2312
147 Ga0466967_0182625 3300045976 Bacteria 1979
148 Ga0495629_0001090 3300046459 Bacteria 21521
149 Ga0495641_0000278 3300046461 Bacteria 40927
150 Ga0495641_0000681 3300046461 Bacteria 28646
151 Ga0495651_0021156 3300046462 Bacteria 5053
152 Ga0495653_0012799 3300046463 Bacteria 6849
153 Ga0495582_0000643 3300046473 Bacteria 19225
154 Ga0495639_0004028 3300046475 Bacteria 6298
155 Ga0495639_0044673 3300046475 Unclassified 2003
156 Ga0495662_0004046 3300046476 Bacteria 7384
157 Ga0495596_0008688 3300046500 Bacteria 4503
158 Ga0495608_0005769 3300046511 Bacteria 8821
159 Ga0495608_0015842 3300046511 Bacteria 5217
160 Ga0495630_0018406 3300046517 Bacteria 5132
161 Ga0495630_0021922 3300046517 Bacteria 4718
162 Ga0495644_0004279 3300046523 Bacteria 5606
163 Ga0495652_0048142 3300046529 Bacteria 3654
164 Ga0495652_0051555 3300046529 Bacteria 3513
165 Ga0495652_0072051 3300046529 Bacteria 2881
166 Ga0495665_0078848 3300046531 Bacteria 1732
167 Ga0495587_0019825 3300046536 Bacteria 4158
168 Ga0495667_0077596 3300046559 Bacteria 2160
169 Ga0495634_0022658 3300046642 Bacteria 4424
170 Ga0495635_0045918 3300046663 Bacteria 3013
171 Ga0495657_0015152 3300046675 Bacteria 5647
172 Ga0495599_0046376 3300046678 Bacteria 2725
173 Ga0495647_0007134 3300046681 Bacteria 3731
174 Ga0495658_0001015 3300046683 Bacteria 14833
175 Ga0495658_0009396 3300046683 Bacteria 4873
176 Ga0495658_0032206 3300046683 Bacteria 2861
177 Ga0495581_0067158 3300047315 Bacteria 2073
178 Ga0495674_0142584 3300047319 Bacteria 2013
179 Ga0495676_0002253 3300047321 Bacteria 17120
180 Ga0495680_0004584 3300047322 Bacteria 13179
181 Ga0495680_0016691 3300047322 Bacteria 6300
182 Ga0495673_0009073 3300047469 Bacteria 5527
183 Ga0495684_0012130 3300047471 Bacteria 6647
184 Ga0495684_0026916 3300047471 Bacteria 4418
185 Ga0495686_0000008 3300047472 Bacteria 727479
186 Ga0495686_0008219 3300047472 Bacteria 7696
187 Ga0495593_0007614 3300047673 Bacteria 6324
188 Ga0496100_0003771 3300048903 Bacteria 7936
189 Ga0496101_0009221 3300048904 Bacteria 6479
190 Ga0496101_0025871 3300048904 Bacteria 4075
191 Ga0496101_0065725 3300048904 Bacteria 2644
192 Ga0496102_0001364 3300048905 Bacteria 21868
193 Ga0496102_0004474 3300048905 Bacteria 11794
194 Ga0496103_0004682 3300048906 Bacteria 8279
195 Ga0496104_0005235 3300048907 Bacteria 11341
196 Ga0496104_0006824 3300048907 Bacteria 10058
197 Ga0496104_0067895 3300048907 Bacteria 3387
198 Ga0496104_0214402 3300048907 Bacteria 1837
199 Ga0496105_0000566 3300048908 Bacteria 24464
200 Ga0496105_0014208 3300048908 Bacteria 6337
201 Ga0496106_0018665 3300048909 Bacteria 5134
202 Ga0496107_0006083 3300048910 Bacteria 8288
203 Ga0496107_0014032 3300048910 Bacteria 5608
204 Ga0496107_0027770 3300048910 Bacteria 4021
205 Ga0496108_0010466 3300048911 Bacteria 7535
206 Ga0496109_0006065 3300048912 Bacteria 10155
207 Ga0496111_0002185 3300048914 Bacteria 11720
208 Ga0496111_0003191 3300048914 Bacteria 10112
209 Ga0496111_0031969 3300048914 Bacteria 3751
210 Ga0496112_0037489 3300048915 Bacteria 4731
211 Ga0496112_0117813 3300048915 Bacteria 2626
212 Ga0496114_0000364 3300048917 Bacteria 33204
213 Ga0496114_0006762 3300048917 Bacteria 9034
214 Ga0496114_0029299 3300048917 Bacteria 4522
215 Ga0496114_0031206 3300048917 Bacteria 4384
216 Ga0496114_0163924 3300048917 Bacteria 1934
217 Ga0496115_0008815 3300048918 Bacteria 7473
218 Ga0496115_0024273 3300048918 Bacteria 4710
219 Ga0496115_0024411 3300048918 Bacteria 4698
220 Ga0496115_0036104 3300048918 Bacteria 3912
221 Ga0496121_0030603 3300048924 Bacteria 4940
222 Ga0501032_0019781 3300049569 Bacteria 4702
223 Ga0501032_0167102 3300049569 Bacteria 1443
224 Ga0501037_0030747 3300049573 Bacteria 3966
225 Ga0501046_0009334 3300049580 Bacteria 8486
226 Ga0501047_0000178 3300049581 Bacteria 77670
227 Ga0501047_0027160 3300049581 Bacteria 5514
228 Ga0501047_0107025 3300049581 Bacteria 2677
229 Ga0501068_0002675 3300049584 Bacteria 9438
230 Ga0501069_0003158 3300049585 Bacteria 8445
231 Ga0501070_0000096 3300049586 Bacteria 75811
232 Ga0501070_0015162 3300049586 Bacteria 6485
233 Ga0501070_0026682 3300049586 Bacteria 4846
234 Ga0501070_0067502 3300049586 Bacteria 2962
235 Ga0501071_0057056 3300049587 Bacteria 2822
236 Ga0501072_0000266 3300049588 Bacteria 38055
237 Ga0501073_0000049 3300049589 Bacteria 75259
238 Ga0501074_0000136 3300049590 Bacteria 38031
239 Ga0501074_0005011 3300049590 Bacteria 9506
240 Ga0501079_0000329 3300049741 Bacteria 29869
241 Ga0501079_0040097 3300049741 Bacteria 3612
242 Ga0501080_0000008 3300049742 Bacteria 134920
243 Ga0501080_0024119 3300049742 Bacteria 5638
244 Ga0501080_0081531 3300049742 Bacteria 3005
245 Ga0501080_0175683 3300049742 Bacteria 1973
246 Ga0501083_0000196 3300049744 Bacteria 39027
247 Ga0501035_0008475 3300049822 Bacteria 9576
248 Ga0501044_0000559 3300049823 Bacteria 45231
249 Ga0501044_0003405 3300049823 Bacteria 17914
250 nmdc:mga0a205_5874_c1 3300050515 Bacteria 11053
251 Ga0495601_0046494 3300053077 Bacteria 2732
252 Ga0495612_0023972 3300053078 Bacteria 2450
253 Ga0495595_0036070 3300053084 Bacteria 2242
254 Ga0495619_0001024 3300053085 Bacteria 18310
255 Ga0495619_0012579 3300053085 Bacteria 5327
256 Ga0495619_0051612 3300053085 Bacteria 2718
257 Ga0500616_0006663 3300053153 Bacteria 7510
258 Ga0501084_0029115 3300054114 Bacteria 4619
259 Ga0501082_0000124 3300060353 Bacteria 61918
260 Ga0466962_0000159 3300061719 Bacteria 28442
261 Ga0466962_0028346 3300061719 Bacteria 2683
262 Ga0466964_0002678
263 rootH2_10012791
264 Ga0070683_100027982
265 Ga0070680_100006974
266 Ga0070680_100018757
267 Ga0070680_100046006
268 Ga0070682_100007912
269 Ga0070682_100008022
270 Ga0070660_100020926
271 Ga0070660_100051728
272 Ga0070660_100079959
273 Ga0070660_100187256
274 Ga0070661_100033052
275 Ga0070668_100010552
276 Ga0070659_100082297
277 Ga0070667_100000192
278 Ga0070709_10010432
279 Ga0070714_100111391
280 Ga0070713_100085812
281 Ga0070711_100052472
282 Ga0070708_100008324
283 Ga0070681_10021702
284 Ga0070681_10022968
285 Ga0070681_10029115
286 Ga0070681_10122676
287 Ga0070681_10168840
288 Ga0070706_100056733
289 Ga0070707_100211144
290 Ga0070679_100018391
291 Ga0070679_100093640
292 Ga0070684_100009787
293 Ga0068853_100120063
294 Ga0068855_100222134
295 Ga0068856_100013467
296 Ga0068856_100069071
297 Ga0068856_100112961
298 Ga0068852_100026579
299 Ga0068852_100140842
300 Ga0068860_100169002
301 Ga0068862_100000050
302 Ga0070717_10006294
303 Ga0070717_10007865
304 Ga0070712_100033911
305 Ga0105245_10004769
306 Ga0105241_10178997
307 Ga0105238_10164695
308 Ga0105249_10001649
309 Ga0157370_10154006
310 Ga0157369_10006313
311 Ga0157369_10046925
312 Ga0157369_10106705
313 Ga0157369_10189646
314 Ga0157369_10213613
315 Ga0157372_10054576
316 Ga0157372_10185139
317 Ga0157379_10037383
318 Ga0206353_10703416
319 Ga0206353_12004089
320 Ga0213874_10000147
321 Ga0207707_10146230
322 Ga0207663_10061636
323 Ga0207660_10004053
324 Ga0207657_10003035
325 Ga0207657_10012499
326 Ga0207657_10032982
327 Ga0207657_10033517
328 Ga0207657_10057428
329 Ga0207657_10182743
330 Ga0207649_10069977
331 Ga0207652_10033539
332 Ga0207652_10036746
333 Ga0207652_10064519
334 Ga0207687_10057308
335 Ga0207700_10000002
336 Ga0207700_10006260
337 Ga0207664_10008067
338 Ga0207664_10032855
339 Ga0207664_10142091
340 Ga0207690_10181929
341 Ga0207667_10169206
342 Ga0207712_10001339
343 Ga0207668_10021142
344 Ga0207658_10009938
345 Ga0207702_10009768
346 Ga0207674_10006044
347 Ga0207698_10115834
348 Ga0268265_10001491
349 Ga0268264_10178869
350 Ga0265337_1000952
351 Ga0265319_1000217
352 Ga0265318_10000748
353 Ga0265338_10004577
354 Ga0265324_10002016
355 Ga0265327_10006463
356 Ga0265316_10016540
357 Ga0373926_0048863
358 Ga0373945_0024372
359 Ga0373943_0001587
360 Ga0373943_0024172
361 Ga0373946_0041967
362 Ga0373935_0035614
363 Ga0373927_0026571
364 Ga0373947_0001682
365 Ga0373947_0012906
366 Ga0373937_0262179
367 Ga0373925_0018101
368 Ga0373925_0066686
369 Ga0395898_0082160
370 Ga0436364_0068592
371 Ga0436364_0757072
372 Ga0395901_0079464
373 Ga0436365_0116219
374 Ga0436365_0911509
375 Ga0436365_1158902
376 Ga0436365_1290693
377 Ga0436363_0062885
378 Ga0436363_0592624
379 Ga0436363_0812143
380 Ga0466966_0003309
381 Ga0466961_0001051
382 Ga0466961_0100068
383 Ga0466963_0000220
384 Ga0466963_0011095
385 Ga0466963_0019503
386 Ga0466963_0020952
387 Ga0466963_0021266
388 Ga0466963_0026094
389 Ga0466964_0028292
390 Ga0466971_0012489
391 Ga0466968_0022208
392 Ga0466957_0025823
393 Ga0466957_0044698
394 Ga0466959_0020196
395 Ga0466959_0085907
396 Ga0466958_0013873
397 Ga0466958_0016453
398 Ga0466958_0018560
399 Ga0466967_0000877
400 Ga0466967_0004825
401 Ga0466967_0009371
402 Ga0466967_0018450
403 Ga0466967_0033921
404 Ga0466967_0045660
405 Ga0466967_0060160
406 Ga0466967_0108759
407 Ga0466967_0132912
408 Ga0466967_0182625
409 Ga0495629_0001090
410 Ga0495641_0000278
411 Ga0495641_0000681
412 Ga0495651_0021156
413 Ga0495653_0012799
414 Ga0495582_0000643
415 Ga0495639_0004028
416 Ga0495639_0044673
417 Ga0495662_0004046
418 Ga0495596_0008688
419 Ga0495608_0005769
420 Ga0495608_0015842
421 Ga0495630_0018406
422 Ga0495630_0021922
423 Ga0495644_0004279
424 Ga0495652_0048142
425 Ga0495652_0051555
426 Ga0495652_0072051
427 Ga0495665_0078848
428 Ga0495587_0019825
429 Ga0495667_0077596
430 Ga0495634_0022658
431 Ga0495635_0045918
432 Ga0495657_0015152
433 Ga0495599_0046376
434 Ga0495647_0007134
435 Ga0495658_0001015
436 Ga0495658_0009396
437 Ga0495658_0032206
438 Ga0495581_0067158
439 Ga0495674_0142584
440 Ga0495676_0002253
441 Ga0495680_0004584
442 Ga0495680_0016691
443 Ga0495673_0009073
444 Ga0495684_0012130
445 Ga0495684_0026916
446 Ga0495686_0000008
447 Ga0495686_0008219
448 Ga0495593_0007614
449 Ga0496100_0003771
450 Ga0496101_0009221
451 Ga0496101_0025871
452 Ga0496101_0065725
453 Ga0496102_0001364
454 Ga0496102_0004474
455 Ga0496103_0004682
456 Ga0496104_0005235
457 Ga0496104_0006824
458 Ga0496104_0067895
459 Ga0496104_0214402
460 Ga0496105_0000566
461 Ga0496105_0014208
462 Ga0496106_0018665
463 Ga0496107_0006083
464 Ga0496107_0014032
465 Ga0496107_0027770
466 Ga0496108_0010466
467 Ga0496109_0006065
468 Ga0496111_0002185
469 Ga0496111_0003191
470 Ga0496111_0031969
471 Ga0496112_0037489
472 Ga0496112_0117813
473 Ga0496114_0000364
474 Ga0496114_0006762
475 Ga0496114_0029299
476 Ga0496114_0031206
477 Ga0496114_0163924
478 Ga0496115_0008815
479 Ga0496115_0024273
480 Ga0496115_0024411
481 Ga0496115_0036104
482 Ga0496121_0030603
483 Ga0501032_0019781
484 Ga0501032_0167102
485 Ga0501037_0030747
486 Ga0501046_0009334
487 Ga0501047_0000178
488 Ga0501047_0027160
489 Ga0501047_0107025
490 Ga0501068_0002675
491 Ga0501069_0003158
492 Ga0501070_0000096
493 Ga0501070_0015162
494 Ga0501070_0026682
495 Ga0501070_0067502
496 Ga0501071_0057056
497 Ga0501072_0000266
498 Ga0501073_0000049
499 Ga0501074_0000136
500 Ga0501074_0005011
501 Ga0501079_0000329
502 Ga0501079_0040097
503 Ga0501080_0000008
504 Ga0501080_0024119
505 Ga0501080_0081531
506 Ga0501080_0175683
507 Ga0501083_0000196
508 Ga0501035_0008475
509 Ga0501044_0000559
510 Ga0501044_0003405
511 nmdc:mga0a205_5874_c1
512 Ga0495601_0046494
513 Ga0495612_0023972
514 Ga0495595_0036070
515 Ga0495619_0001024
516 Ga0495619_0012579
517 Ga0495619_0051612
518 Ga0500616_0006663
519 Ga0501084_0029115
520 Ga0501082_0000124
521 Ga0466962_0000159
522 Ga0466962_0028346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

16

411

0.85

PF06609

TRI12

Fungal trichothecene efflux pump (TRI12)

8

296

0.79

PF07690

MFS_1

Major Facilitator Superfamily

267

483

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7735 1 381
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7521 1 381
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.7383 5 378
8pnl-assembly2.cif.gz_C outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.7195 5 378
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.7064 5 378
ID Description Score Start End Superfamily
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9069 5 166 1.20.1250.20
af_A0A1D8PCL5_75_277_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8951 11 171 1.20.1250.20
af_P33335_10_275_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.889 10 224 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8878 10 225 1.20.1250.20
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8841 12 233 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A538CTW0-F1-model_v4 MFS transporter 0.9249 1 196 GO:0005886
GO:0022857
AF-A0A4Q3WQQ0-F1-model_v4 MFS transporter 0.9112 6 239 GO:0005886
GO:0022857
AF-A0A4Y9VE53-F1-model_v4 deleted 0.908 2 389
AF-A0A3B8PDS0-F1-model_v4 deleted 0.904 6 243
AF-A0A5C8X8R8-F1-model_v4 deleted 0.903 6 211

Map