F370720

General Info

Members Datasets Scaffolds Average Seq Length
261 201 522 330

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221635|2644198725
Length 358
Sequence EHAPDPHGAPDAHGAPDADGAPDHAADTLGAVGELAALARIIPRLPPSAVTELGPGDDAAVLAAPDGRFVVTTDMMIHGPDFRLAWSSMHDLGWKAAATNLSDVAAMGARPTSLVVALAAPAETPVADLEAFADGLADACAALAPGCGVVGGDLSVSHTLTIAVTAFGDLEGRPPVRRDGARPGDVVAVSGPLGLAAQGLALLFERGVDATGAPDASAAARLRSEHPVPIAAQLAPRPPIADGPAAAIAGATAMLDLSDGLALDARRVARASGVVIDLDGRALAAHGTGALALTGGEDHSLLATFPPTVPLPAGFERVGLVVALDERAGGRPAVLVDGHVVDERGGWDPFAGWSGEAD

Samples

Sample ID Description Type Environment
1 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
134 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
135 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
136 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
137 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
142 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
143 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
144 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
145 2643221546 Microbacterium sp. Root53 Isolate Unclassified
146 2643221549 Agromyces sp. Root1464 Isolate Unclassified
147 2643221566 Microbacterium sp. Root166 Isolate Unclassified
148 2643221572 Leifsonia sp. Root60 Isolate Unclassified
149 2643221575 Microbacterium sp. Root61 Isolate Unclassified
150 2643221597 Microbacterium sp. Root180 Isolate Unclassified
151 2643221616 Leifsonia sp. Root227 Isolate Unclassified
152 2643221619 Agromyces sp. Root81 Isolate Unclassified
153 2643221630 Microbacterium sp. Root322 Isolate Unclassified
154 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
155 2643221649 Leifsonia sp. Root4 Isolate Unclassified
156 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
157 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
158 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
159 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
160 2773857759 Microbacterium sp. 1294 Isolate Unclassified
161 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
162 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
163 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
164 2808606372 Agromyces sp. 23-23 Isolate Unclassified
165 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
166 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
167 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
168 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
169 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
170 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
171 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
172 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
173 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
174 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
175 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
176 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
177 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
178 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
179 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
180 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
181 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
182 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
183 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
184 2919069694 Microbacterium sp. 1154 Isolate Unclassified
185 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
186 2928153084 Leifsonia sp. 563 Isolate Unclassified
187 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
188 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
189 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
190 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
191 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
192 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
193 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
194 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
195 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
196 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
197 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
198 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
199 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
200 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
201 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.48
Metatranscriptomes 1.15
Isolates 23.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.58
Nodule 0
Rhizoplane 5.75
Rhizosphere 54.02
Stem 0
Stem Tuber 0.38
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1000778 3300002772 Bacteria 11545
2 JGI25165J46597_1000002 3300003214 Bacteria 765387
3 Ga0006562J51391_1048816 3300003578 Bacteria 1344
4 Ga0070658_10010448 3300005327 Bacteria 7445
5 Ga0070658_10031201 3300005327 Bacteria 4279
6 Ga0068869_100194836 3300005334 Bacteria 1595
7 Ga0068868_100048856 3300005338 Bacteria 3320
8 Ga0068868_100136991 3300005338 Bacteria 2007
9 Ga0070660_100002036 3300005339 Bacteria 13937
10 Ga0070668_100027547 3300005347 Bacteria 4315
11 Ga0070671_100272702 3300005355 Bacteria 1438
12 Ga0070667_100027631 3300005367 Bacteria 4721
13 Ga0070710_10020543 3300005437 Bacteria 3428
14 Ga0070685_10011808 3300005466 Bacteria 4579
15 Ga0068853_100021211 3300005539 Bacteria 5411
16 Ga0070672_100030594 3300005543 Bacteria 4046
17 Ga0068855_100013037 3300005563 Bacteria 10027
18 Ga0068855_100148457 3300005563 Bacteria 2667
19 Ga0068857_100018114 3300005577 Bacteria 6178
20 Ga0068856_100132763 3300005614 Bacteria 2495
21 Ga0068856_100221446 3300005614 Bacteria 1907
22 Ga0068852_100005756 3300005616 Bacteria 8897
23 Ga0068859_100117295 3300005617 Bacteria 2727
24 Ga0068861_100076965 3300005719 Bacteria 2601
25 Ga0068851_10000001 3300005834 Bacteria 495512
26 Ga0068863_100046416 3300005841 Bacteria 4123
27 Ga0068863_100134279 3300005841 Bacteria 2364
28 Ga0075364_10019620 3300006051 Bacteria 4244
29 Ga0075367_10000349 3300006178 Bacteria 16510
30 Ga0097620_100117295 3300006931 Bacteria 2727
31 Ga0105244_10008974 3300009036 Bacteria 6187
32 Ga0105240_10007382 3300009093 Bacteria 15989
33 Ga0105245_10005854 3300009098 Bacteria 10797
34 Ga0105245_10204260 3300009098 Bacteria 1899
35 Ga0105247_10093325 3300009101 Bacteria 1913
36 Ga0105243_10349664 3300009148 Bacteria 1357
37 Ga0105241_10000453 3300009174 Bacteria 30818
38 Ga0105248_10000326 3300009177 Bacteria 56477
39 Ga0105248_10043680 3300009177 Bacteria 5026
40 Ga0105237_10000341 3300009545 Bacteria 65672
41 Ga0157369_10189365 3300013105 Bacteria 2162
42 Ga0171462_1003 3300013250 Bacteria 853796
43 Ga0163162_10215615 3300013306 Bacteria 2050
44 Ga0157372_10315581 3300013307 Bacteria 1820
45 Ga0163163_10030359 3300014325 Bacteria 5208
46 Ga0157380_10006032 3300014326 Bacteria 8487
47 Ga0157379_10039156 3300014968 Bacteria 4229
48 Ga0157376_10373488 3300014969 Bacteria 1371
49 Ga0206354_10663781 3300020081 Bacteria 10305
50 Ga0206353_11560231 3300020082 Bacteria 22870
51 Ga0207427_100034 3300025231 Bacteria 320342
52 Ga0209437_100486 3300025233 Bacteria 29316
53 Ga0209677_100321 3300025253 Bacteria 30989
54 Ga0209148_1000608 3300025254 Bacteria 32066
55 Ga0209148_1012099 3300025254 Bacteria 1585
56 Ga0209233_1000001 3300025261 Bacteria 2992747
57 Ga0207656_10000002 3300025321 Bacteria 792178
58 Ga0207655_1002891 3300025728 Bacteria 13252
59 Ga0207655_1013383 3300025728 Bacteria 4716
60 Ga0207692_10014665 3300025898 Bacteria 3429
61 Ga0207705_10029243 3300025909 Bacteria 3928
62 Ga0207654_10000001 3300025911 Bacteria 1816198
63 Ga0207695_10003239 3300025913 Bacteria 23182
64 Ga0207695_10003445 3300025913 Bacteria 22306
65 Ga0207671_10000002 3300025914 Bacteria 1144816
66 Ga0207657_10028314 3300025919 Bacteria 5113
67 Ga0207694_10000395 3300025924 Bacteria 40665
68 Ga0207687_10033337 3300025927 Bacteria 3493
69 Ga0207687_10039017 3300025927 Bacteria 3249
70 Ga0207690_10000874 3300025932 Bacteria 19271
71 Ga0207709_10149347 3300025935 Bacteria 1616
72 Ga0207691_10048951 3300025940 Bacteria 3873
73 Ga0207711_10004685 3300025941 Bacteria 11617
74 Ga0207711_10066148 3300025941 Bacteria 3126
75 Ga0207689_10188070 3300025942 Bacteria 1703
76 Ga0207667_10000384 3300025949 Bacteria 59816
77 Ga0207667_10005731 3300025949 Bacteria 15151
78 Ga0207668_10029348 3300025972 Bacteria 3605
79 Ga0207658_10026993 3300025986 Bacteria 4031
80 Ga0207677_10099597 3300026023 Bacteria 2135
81 Ga0207703_10000982 3300026035 Bacteria 27446
82 Ga0207639_10228887 3300026041 Bacteria 1610
83 Ga0207702_10074047 3300026078 Bacteria 2938
84 Ga0207702_10331989 3300026078 Bacteria 1451
85 Ga0207702_10345397 3300026078 Bacteria 1422
86 Ga0207641_10027408 3300026088 Bacteria 4705
87 Ga0207641_10165980 3300026088 Bacteria 2011
88 Ga0207674_10005088 3300026116 Bacteria 15698
89 Ga0207674_10069526 3300026116 Bacteria 3541
90 Ga0207675_100194588 3300026118 Bacteria 1946
91 Ga0207698_10000372 3300026142 Bacteria 26230
92 Ga0207698_10045429 3300026142 Bacteria 3309
93 Ga0207698_10061871 3300026142 Bacteria 2920
94 Ga0307513_10139732 3300031456 Bacteria 2351
95 Ga0307514_10003887 3300031649 Bacteria 14003
96 Ga0307514_10068653 3300031649 Bacteria 2670
97 Ga0307406_10000217 3300031901 Bacteria 34729
98 Ga0307409_100065559 3300031995 Bacteria 2859
99 Ga0307409_100105901 3300031995 Bacteria 2346
100 Ga0307416_100079499 3300032002 Bacteria 2764
101 Ga0307416_100104765 3300032002 Bacteria 2474
102 Ga0307415_100167124 3300032126 Bacteria 1712
103 Ga0395899_0014625 3300037312 Bacteria 5990
104 Ga0395901_0030011 3300038443 Bacteria 5601
105 Ga0451791_1439961 3300041451 Bacteria 1410
106 Ga0466965_0012786 3300044683 Bacteria 3951
107 Ga0466968_0030315 3300044735 Bacteria 2240
108 Ga0495627_000401 3300046453 Bacteria 38376
109 Ga0495650_0000989 3300046471 Bacteria 32345
110 Ga0495645_0086131 3300046543 Bacteria 2248
111 Ga0495672_0004208 3300047320 Bacteria 11921
112 Ga0495686_0010659 3300047472 Bacteria 6527
113 Ga0496101_0362486 3300048904 Bacteria 1139
114 Ga0496102_0279663 3300048905 Bacteria 1573
115 Ga0496103_0002306 3300048906 Bacteria 12060
116 Ga0496104_0063521 3300048907 Bacteria 3502
117 Ga0496104_0126415 3300048907 Bacteria 2455
118 Ga0496104_0296455 3300048907 Bacteria 1529
119 Ga0496105_0008276 3300048908 Bacteria 8088
120 Ga0496105_0250510 3300048908 Bacteria 1435
121 Ga0496107_0516981 3300048910 Bacteria 885
122 Ga0496108_0025667 3300048911 Bacteria 4858
123 Ga0496112_0233622 3300048915 Bacteria 1793
124 Ga0496114_0054111 3300048917 Bacteria 3346
125 Ga0496114_0061219 3300048917 Bacteria 3148
126 Ga0496115_0086287 3300048918 Bacteria 2561
127 Ga0496117_0000053 3300048920 Bacteria 279396
128 Ga0496117_0006271 3300048920 Bacteria 12116
129 Ga0496117_0027283 3300048920 Bacteria 4452
130 Ga0496118_0004656 3300048921 Bacteria 16093
131 Ga0496118_0082056 3300048921 Bacteria 2261
132 Ga0496119_0000462 3300048922 Bacteria 55546
133 Ga0496119_0001888 3300048922 Bacteria 24099
134 Ga0496119_0005508 3300048922 Bacteria 12085
135 Ga0496119_0005568 3300048922 Bacteria 11985
136 Ga0496119_0021562 3300048922 Bacteria 4650
137 Ga0496120_0000882 3300048923 Bacteria 42252
138 Ga0496120_0004461 3300048923 Bacteria 11730
139 Ga0496120_0006705 3300048923 Bacteria 8764
140 Ga0496120_0010457 3300048923 Bacteria 6473
141 Ga0496120_0014656 3300048923 Bacteria 5214
142 Ga0496120_0089666 3300048923 Bacteria 1645
143 Ga0496122_0000031 3300048925 Bacteria 329726
144 Ga0496122_0002058 3300048925 Bacteria 29852
145 Ga0496122_0004113 3300048925 Bacteria 18414
146 Ga0496122_0046142 3300048925 Bacteria 3378
147 Ga0496122_0054084 3300048925 Bacteria 3019
148 Ga0496123_0000013 3300048926 Bacteria 439694
149 Ga0496123_0006537 3300048926 Bacteria 11257
150 Ga0496123_0020341 3300048926 Bacteria 5195
151 Ga0496123_0110977 3300048926 Bacteria 1568
152 Ga0496124_0012952 3300048927 Bacteria 8178
153 Ga0496124_0013529 3300048927 Bacteria 7958
154 Ga0496125_0000077 3300048928 Bacteria 232629
155 Ga0496125_0001794 3300048928 Bacteria 29677
156 Ga0496125_0002215 3300048928 Bacteria 25912
157 Ga0496125_0029205 3300048928 Bacteria 4960
158 Ga0496125_0064916 3300048928 Bacteria 2896
159 Ga0496125_0071923 3300048928 Bacteria 2699
160 Ga0496126_0008871 3300048929 Bacteria 10775
161 Ga0496126_0121476 3300048929 Bacteria 2264
162 Ga0496126_0193364 3300048929 Bacteria 1722
163 Ga0501032_0010368 3300049569 Bacteria 6718
164 Ga0501033_0006594 3300049570 Bacteria 9080
165 Ga0501034_0007513 3300049571 Bacteria 11594
166 Ga0501034_0011379 3300049571 Bacteria 9227
167 Ga0501036_0018848 3300049572 Bacteria 5788
168 Ga0501037_0002320 3300049573 Bacteria 13751
169 Ga0501038_0006429 3300049574 Bacteria 10874
170 Ga0501039_0066572 3300049575 Bacteria 2796
171 Ga0501042_0049144 3300049578 Bacteria 3009
172 Ga0501043_0005974 3300049579 Bacteria 9783
173 Ga0501046_0002107 3300049580 Bacteria 18856
174 Ga0501047_0055384 3300049581 Bacteria 3835
175 Ga0501048_0001960 3300049582 Bacteria 15648
176 Ga0501068_0015426 3300049584 Bacteria 4387
177 Ga0501069_0068636 3300049585 Bacteria 1984
178 Ga0501070_0000133 3300049586 Bacteria 67036
179 Ga0501070_0009644 3300049586 Bacteria 8161
180 Ga0501073_0017209 3300049589 Bacteria 5236
181 Ga0501035_0035725 3300049822 Bacteria 4509
182 Ga0501035_0044860 3300049822 Bacteria 3978
183 Ga0501044_0017141 3300049823 Bacteria 7773
184 Ga0501045_0027001 3300049824 Bacteria 4133
185 nmdc:mga06z11_4581_c1 3300050494 Bacteria 5453
186 Ga0500635_0000023 3300053080 Bacteria 108024
187 Ga0500643_000913 3300053087 Bacteria 18624
188 Ga0500651_0000170 3300053093 Bacteria 42448
189 Ga0500556_0000001 3300053104 Bacteria 1135060
190 Ga0500568_0000003 3300053139 Bacteria 863587
191 Ga0500568_0004245 3300053139 Bacteria 7702
192 Ga0500568_0010972 3300053139 Bacteria 4223
193 Ga0500573_0006616 3300053140 Bacteria 6288
194 Ga0500573_0064563 3300053140 Bacteria 2094
195 Ga0500577_0021758 3300053142 Bacteria 2117
196 Ga0500590_037923 3300053148 Bacteria 2488
197 Ga0500616_0000205 3300053153 Bacteria 96713
198 Ga0500616_0001099 3300053153 Bacteria 28063
199 Ga0500620_000289 3300053155 Bacteria 9710
200 Ga0501082_0263356 3300060353 Bacteria 1500
201 2644198725 2643221635 Bacteria 2632343
202 2587863262 2585428094 Bacteria 3604039
203 2588108938 2585428157 Bacteria 3018951
204 2643733887 2643221542 Bacteria 3563959
205 2643753288 2643221546 Bacteria 2910897
206 2643768042 2643221549 Bacteria 4042819
207 2643848610 2643221566 Bacteria 3460379
208 2643875628 2643221572 Bacteria 3614809
209 2643885683 2643221575 Bacteria 4022601
210 2643996108 2643221597 Bacteria 3347721
211 2644095703 2643221616 Bacteria 4066575
212 2644111429 2643221619 Bacteria 4158469
213 2644170468 2643221630 Bacteria 3601215
214 2644183020 2643221632 Bacteria 3406696
215 2644277153 2643221649 Bacteria 3867359
216 2644382683 2643221669 Bacteria 3611286
217 2723641731 2721755702 Bacteria 4373124
218 2758225858 2757320536 Bacteria 3629334
219 2774380164 2773857758 Bacteria 3592392
220 2774384270 2773857759 Bacteria 2963774
221 2774399282 2773857763 Bacteria 4180068
222 2808630982 2808606306 Bacteria 3608896
223 2808885826 2808606368 Bacteria 3174172
224 2808901723 2808606372 Bacteria 4649509
225 2809227613 2808606447 Bacteria 3572005
226 2812323422 2811994872 Bacteria 4121241
227 2821270215 2821268502 Bacteria 3750023
228 2833711171 2833709550 Bacteria 4008291
229 2844842086 2844841374 Bacteria 3917147
230 2852634377 2852632344 Bacteria 3463163
231 2852646052 2852643534 Bacteria 3013378
232 2852665051 2852663356 Bacteria 4090475
233 2857720116 2857720070 Bacteria 3189373
234 2857723573 2857723135 Bacteria 4217853
235 2857734012 2857733635 Bacteria 3532004
236 2857738893 2857737099 Bacteria 3104305
237 2870624308 2870622029 Bacteria 3643329
238 2870630561 2870628048 Bacteria 3696012
239 2884765075 2884763398 Bacteria 4091164
240 2895661686 2895660088 Bacteria 3782833
241 2904511782 2904509784 Bacteria 3520416
242 2908680708 2908678064 Bacteria 3482747
243 2919057726 2919055335 Bacteria 3875751
244 2919071741 2919069694 Bacteria 3622919
245 2919446523 2919443155 Bacteria 4072969
246 2928155701 2928153084 Bacteria 4020257
247 2935411140 2935409751 Bacteria 4179611
248 2939658791 2939657138 Bacteria 3740283
249 2946043958 2946041624 Bacteria 4191385
250 2974297366 2974294766 Bacteria 3767688
251 2974326396 2974324384 Bacteria 3750535
252 2977231621 2977228692 Bacteria 3450105
253 2977236976 2977236895 Bacteria 3569373
254 2977254144 2977251589 Bacteria 2952848
255 2977266844 2977264416 Bacteria 3750737
256 8004185364 8004182704 Bacteria 3391155
257 8004213905 8004212874 Bacteria 2861420
258 8016257342 8016254467 Bacteria 3797036
259 8045831794 8045830549 Bacteria 4444727
260 8046353164 8046352972 Bacteria 3613806
261 8057348132 8057345674 Bacteria 4160394
262 JGI25164J39214_1000778
263 JGI25165J46597_1000002
264 Ga0006562J51391_1048816
265 Ga0070658_10010448
266 Ga0070658_10031201
267 Ga0068869_100194836
268 Ga0068868_100048856
269 Ga0068868_100136991
270 Ga0070660_100002036
271 Ga0070668_100027547
272 Ga0070671_100272702
273 Ga0070667_100027631
274 Ga0070710_10020543
275 Ga0070685_10011808
276 Ga0068853_100021211
277 Ga0070672_100030594
278 Ga0068855_100013037
279 Ga0068855_100148457
280 Ga0068857_100018114
281 Ga0068856_100132763
282 Ga0068856_100221446
283 Ga0068852_100005756
284 Ga0068859_100117295
285 Ga0068861_100076965
286 Ga0068851_10000001
287 Ga0068863_100046416
288 Ga0068863_100134279
289 Ga0075364_10019620
290 Ga0075367_10000349
291 Ga0097620_100117295
292 Ga0105244_10008974
293 Ga0105240_10007382
294 Ga0105245_10005854
295 Ga0105245_10204260
296 Ga0105247_10093325
297 Ga0105243_10349664
298 Ga0105241_10000453
299 Ga0105248_10000326
300 Ga0105248_10043680
301 Ga0105237_10000341
302 Ga0157369_10189365
303 Ga0171462_1003
304 Ga0163162_10215615
305 Ga0157372_10315581
306 Ga0163163_10030359
307 Ga0157380_10006032
308 Ga0157379_10039156
309 Ga0157376_10373488
310 Ga0206354_10663781
311 Ga0206353_11560231
312 Ga0207427_100034
313 Ga0209437_100486
314 Ga0209677_100321
315 Ga0209148_1000608
316 Ga0209148_1012099
317 Ga0209233_1000001
318 Ga0207656_10000002
319 Ga0207655_1002891
320 Ga0207655_1013383
321 Ga0207692_10014665
322 Ga0207705_10029243
323 Ga0207654_10000001
324 Ga0207695_10003239
325 Ga0207695_10003445
326 Ga0207671_10000002
327 Ga0207657_10028314
328 Ga0207694_10000395
329 Ga0207687_10033337
330 Ga0207687_10039017
331 Ga0207690_10000874
332 Ga0207709_10149347
333 Ga0207691_10048951
334 Ga0207711_10004685
335 Ga0207711_10066148
336 Ga0207689_10188070
337 Ga0207667_10000384
338 Ga0207667_10005731
339 Ga0207668_10029348
340 Ga0207658_10026993
341 Ga0207677_10099597
342 Ga0207703_10000982
343 Ga0207639_10228887
344 Ga0207702_10074047
345 Ga0207702_10331989
346 Ga0207702_10345397
347 Ga0207641_10027408
348 Ga0207641_10165980
349 Ga0207674_10005088
350 Ga0207674_10069526
351 Ga0207675_100194588
352 Ga0207698_10000372
353 Ga0207698_10045429
354 Ga0207698_10061871
355 Ga0307513_10139732
356 Ga0307514_10003887
357 Ga0307514_10068653
358 Ga0307406_10000217
359 Ga0307409_100065559
360 Ga0307409_100105901
361 Ga0307416_100079499
362 Ga0307416_100104765
363 Ga0307415_100167124
364 Ga0395899_0014625
365 Ga0395901_0030011
366 Ga0451791_1439961
367 Ga0466965_0012786
368 Ga0466968_0030315
369 Ga0495627_000401
370 Ga0495650_0000989
371 Ga0495645_0086131
372 Ga0495672_0004208
373 Ga0495686_0010659
374 Ga0496101_0362486
375 Ga0496102_0279663
376 Ga0496103_0002306
377 Ga0496104_0063521
378 Ga0496104_0126415
379 Ga0496104_0296455
380 Ga0496105_0008276
381 Ga0496105_0250510
382 Ga0496107_0516981
383 Ga0496108_0025667
384 Ga0496112_0233622
385 Ga0496114_0054111
386 Ga0496114_0061219
387 Ga0496115_0086287
388 Ga0496117_0000053
389 Ga0496117_0006271
390 Ga0496117_0027283
391 Ga0496118_0004656
392 Ga0496118_0082056
393 Ga0496119_0000462
394 Ga0496119_0001888
395 Ga0496119_0005508
396 Ga0496119_0005568
397 Ga0496119_0021562
398 Ga0496120_0000882
399 Ga0496120_0004461
400 Ga0496120_0006705
401 Ga0496120_0010457
402 Ga0496120_0014656
403 Ga0496120_0089666
404 Ga0496122_0000031
405 Ga0496122_0002058
406 Ga0496122_0004113
407 Ga0496122_0046142
408 Ga0496122_0054084
409 Ga0496123_0000013
410 Ga0496123_0006537
411 Ga0496123_0020341
412 Ga0496123_0110977
413 Ga0496124_0012952
414 Ga0496124_0013529
415 Ga0496125_0000077
416 Ga0496125_0001794
417 Ga0496125_0002215
418 Ga0496125_0029205
419 Ga0496125_0064916
420 Ga0496125_0071923
421 Ga0496126_0008871
422 Ga0496126_0121476
423 Ga0496126_0193364
424 Ga0501032_0010368
425 Ga0501033_0006594
426 Ga0501034_0007513
427 Ga0501034_0011379
428 Ga0501036_0018848
429 Ga0501037_0002320
430 Ga0501038_0006429
431 Ga0501039_0066572
432 Ga0501042_0049144
433 Ga0501043_0005974
434 Ga0501046_0002107
435 Ga0501047_0055384
436 Ga0501048_0001960
437 Ga0501068_0015426
438 Ga0501069_0068636
439 Ga0501070_0000133
440 Ga0501070_0009644
441 Ga0501073_0017209
442 Ga0501035_0035725
443 Ga0501035_0044860
444 Ga0501044_0017141
445 Ga0501045_0027001
446 nmdc:mga06z11_4581_c1
447 Ga0500635_0000023
448 Ga0500643_000913
449 Ga0500651_0000170
450 Ga0500556_0000001
451 Ga0500568_0000003
452 Ga0500568_0004245
453 Ga0500568_0010972
454 Ga0500573_0006616
455 Ga0500573_0064563
456 Ga0500577_0021758
457 Ga0500590_037923
458 Ga0500616_0000205
459 Ga0500616_0001099
460 Ga0500620_000289
461 Ga0501082_0263356
462 2644198725
463 2587863262
464 2588108938
465 2643733887
466 2643753288
467 2643768042
468 2643848610
469 2643875628
470 2643885683
471 2643996108
472 2644095703
473 2644111429
474 2644170468
475 2644183020
476 2644277153
477 2644382683
478 2723641731
479 2758225858
480 2774380164
481 2774384270
482 2774399282
483 2808630982
484 2808885826
485 2808901723
486 2809227613
487 2812323422
488 2821270215
489 2833711171
490 2844842086
491 2852634377
492 2852646052
493 2852665051
494 2857720116
495 2857723573
496 2857734012
497 2857738893
498 2870624308
499 2870630561
500 2884765075
501 2895661686
502 2904511782
503 2908680708
504 2919057726
505 2919071741
506 2919446523
507 2928155701
508 2935411140
509 2939658791
510 2946043958
511 2974297366
512 2974326396
513 2977231621
514 2977236976
515 2977254144
516 2977266844
517 8004185364
518 8004213905
519 8016257342
520 8045831794
521 8046353164
522 8057348132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

56

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yye-assembly1.cif.gz_A crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.8254 21 242
3c9s-assembly1.cif.gz_B aathil complexed with amppcp 0.7938 7 296
2yye-assembly1.cif.gz_B crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.7891 21 242
1vqv-assembly1.cif.gz_B crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus 0.7874 12 300
2yxz-assembly2.cif.gz_D crystal structure of tt0281 from thermus thermophilus hb8 0.7855 12 298
ID Description Score Start End Superfamily
af_Q60337_1_142_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8744 16 152 3.30.1330.10
2yyeA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8589 16 160 3.30.1330.10
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8559 12 160 3.30.1330.10
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.85 12 160 3.30.1330.10
2zodA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8404 22 160 3.30.1330.10
ID Description Score Start End GO Terms
AF-X0UCJ9-F1-model_v4 PurM-like N-terminal domain-containing protein 0.9254 12 147 GO:0009030
GO:0009228
AF-A0A7X9IZ05-F1-model_v4 Thiamine-phosphate kinase 0.9173 16 169 GO:0009030
GO:0009228
AF-A0A7C5I442-F1-model_v4 Thiamine-monophosphate kinase 0.9089 16 189 GO:0009030
GO:0009228
AF-A0A6L6EH42-F1-model_v4 Thiamine-phosphate kinase 0.9067 12 148 GO:0009030
GO:0009228
AF-X0UCJ9-F1-model_v4 PurM-like N-terminal domain-containing protein 0.9061 12 147 GO:0009030
GO:0009228

Map