F370930
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 262 | 166 | 205 | 376 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100060663|Ga0070679_1000606633 |
| Length | 382 |
| Sequence | MSATLALAEQLISRRSVTPEDAGCQALLAGRLAPIGFDCTHLPFGPDGARVSNLWALKRGAASEGKLLVFAGHTDVVPTGPLSAWRSDPFVPTRRDGVLYGRGAADMKSSIAAMAVACAEFVAARPRHAGSIALLITSDEEGPSLHGTRRVCDWLAERGTALDYCVVGEPTSVAKLGDTIKNGRRGTLSGKLTVRGVQGHIAYPHLARNPIHLAAPLLAELATVEWDRGNAHFPPTSWQMSNIHAGTGAGNVIPGELTVDFNFRFSSESTPESLRDRFEQVVRRHGVEHAIEWTLGGEPFLTAPGALSDALARAIRAHAGVETELSTTGGTSDGRFIARICREVVEFGPVNASIHKIDERIEIASLDVLKDVYLATLEQLVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 4 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 5 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 6 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 7 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 8 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 9 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 10 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 11 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 12 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 13 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 14 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 15 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 16 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 17 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 18 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 19 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 20 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 21 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 22 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 23 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 24 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 25 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 26 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 27 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 28 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 29 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 30 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 31 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 32 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 33 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 34 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 35 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 36 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 37 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 38 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 39 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 40 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 41 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 42 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 43 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 44 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 45 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 46 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 47 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 48 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 49 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 50 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 51 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 52 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 53 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 54 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 55 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 56 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 57 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 58 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 63 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 65 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 67 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 116 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 117 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 118 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 119 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 120 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 124 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 125 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 126 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 127 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 130 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 144 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 145 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 148 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 149 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 150 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 151 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 152 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 153 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 154 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 155 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 156 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 157 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 158 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 160 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 161 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 162 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 163 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 164 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 165 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 166 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.24 |
| Metatranscriptomes | 0 |
| Isolates | 21.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.38 |
| Bulb | 0 |
| Endosphere | 21.37 |
| Nodule | 0.38 |
| Rhizoplane | 2.67 |
| Rhizosphere | 41.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_45537 | 2162886007 | Bacteria | 3892 |
| 2 | JGI25152J39213_1000018 | 3300002773 | Bacteria | 109715 |
| 3 | JGI25150J39212_1000578 | 3300002774 | Bacteria | 14562 |
| 4 | JGI25151J46595_10000111 | 3300003187 | Bacteria | 111802 |
| 5 | JGI25153J46596_10000085 | 3300003215 | Bacteria | 111802 |
| 6 | Ga0055526_1000036 | 3300003771 | Bacteria | 135235 |
| 7 | Ga0055526_1000328 | 3300003771 | Bacteria | 39221 |
| 8 | Ga0055537_1000083 | 3300003773 | Bacteria | 68713 |
| 9 | Ga0055537_1000695 | 3300003773 | Bacteria | 17497 |
| 10 | Ga0055524_1000359 | 3300003775 | Bacteria | 41002 |
| 11 | Ga0055536_1000690 | 3300003781 | Bacteria | 22652 |
| 12 | Ga0055536_1001443 | 3300003781 | Bacteria | 14353 |
| 13 | Ga0055536_1001487 | 3300003781 | Bacteria | 14092 |
| 14 | Ga0055534_1000089 | 3300003784 | Bacteria | 71523 |
| 15 | Ga0055534_1000103 | 3300003784 | Bacteria | 65838 |
| 16 | Ga0055528_1000004 | 3300003790 | Bacteria | 285772 |
| 17 | Ga0055528_1000585 | 3300003790 | Bacteria | 27488 |
| 18 | Ga0055530_10000996 | 3300003791 | Bacteria | 22669 |
| 19 | Ga0055530_10001891 | 3300003791 | Bacteria | 14362 |
| 20 | Ga0055531_10017726 | 3300003794 | Bacteria | 2987 |
| 21 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 22 | Ga0058692_1000020 | 3300003856 | Bacteria | 250589 |
| 23 | Ga0065704_10077265 | 3300005289 | Bacteria | 4796 |
| 24 | Ga0070670_100002284 | 3300005331 | Bacteria | 15790 |
| 25 | Ga0070668_100008907 | 3300005347 | Bacteria | 7450 |
| 26 | Ga0070668_100016377 | 3300005347 | Bacteria | 5543 |
| 27 | Ga0070659_100085409 | 3300005366 | Bacteria | 2524 |
| 28 | Ga0070685_10026008 | 3300005466 | Bacteria | 3224 |
| 29 | Ga0070679_100035870 | 3300005530 | Bacteria | 4920 |
| 30 | Ga0070679_100060663 | 3300005530 | Bacteria | 3769 |
| 31 | Ga0070672_100098904 | 3300005543 | Bacteria | 2363 |
| 32 | Ga0068854_100201397 | 3300005578 | Bacteria | 1565 |
| 33 | Ga0075365_10008515 | 3300006038 | Bacteria | 5831 |
| 34 | Ga0075364_10008033 | 3300006051 | Bacteria | 6293 |
| 35 | Ga0105251_10000010 | 3300009011 | Bacteria | 186242 |
| 36 | Ga0105251_10003806 | 3300009011 | Bacteria | 10765 |
| 37 | Ga0105243_10006355 | 3300009148 | Bacteria | 9126 |
| 38 | Ga0105243_10020640 | 3300009148 | Bacteria | 4995 |
| 39 | Ga0157373_10046551 | 3300013100 | Bacteria | 3095 |
| 40 | Ga0157373_10051579 | 3300013100 | Bacteria | 2930 |
| 41 | Ga0157373_10199434 | 3300013100 | Bacteria | 1411 |
| 42 | Ga0157371_10001165 | 3300013102 | Bacteria | 28235 |
| 43 | Ga0157371_10007919 | 3300013102 | Bacteria | 8525 |
| 44 | Ga0157371_10182389 | 3300013102 | Bacteria | 1501 |
| 45 | Ga0157369_10031626 | 3300013105 | Bacteria | 5826 |
| 46 | Ga0182008_10000136 | 3300014497 | Bacteria | 55863 |
| 47 | Ga0182008_10000727 | 3300014497 | Bacteria | 23423 |
| 48 | Ga0182006_1003628 | 3300015261 | Bacteria | 7841 |
| 49 | Ga0182006_1015091 | 3300015261 | Bacteria | 3318 |
| 50 | Ga0182007_10000184 | 3300015262 | Bacteria | 42443 |
| 51 | Ga0182005_1002478 | 3300015265 | Bacteria | 6567 |
| 52 | Ga0182005_1005941 | 3300015265 | Bacteria | 3777 |
| 53 | Ga0163161_10030729 | 3300017792 | Bacteria | 3825 |
| 54 | Ga0163161_10063958 | 3300017792 | Bacteria | 2683 |
| 55 | Ga0207425_1000028 | 3300025245 | Bacteria | 286333 |
| 56 | Ga0207425_1003689 | 3300025245 | Bacteria | 4818 |
| 57 | Ga0209129_1000065 | 3300025258 | Bacteria | 232568 |
| 58 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 59 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 60 | Ga0209565_1000081 | 3300025263 | Bacteria | 155639 |
| 61 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 62 | Ga0209673_1000904 | 3300025273 | Bacteria | 37938 |
| 63 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 64 | Ga0209675_1000021 | 3300025291 | Bacteria | 334833 |
| 65 | Ga0209676_1000024 | 3300025292 | Bacteria | 578839 |
| 66 | Ga0209676_1000047 | 3300025292 | Bacteria | 408645 |
| 67 | Ga0209676_1000203 | 3300025292 | Bacteria | 132949 |
| 68 | Ga0209676_1001141 | 3300025292 | Bacteria | 29048 |
| 69 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 70 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 71 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 72 | Ga0209564_1000263 | 3300025295 | Bacteria | 112148 |
| 73 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 74 | Ga0209758_1008172 | 3300025297 | Bacteria | 6864 |
| 75 | Ga0209050_1000894 | 3300025298 | Bacteria | 39568 |
| 76 | Ga0209050_1001262 | 3300025298 | Bacteria | 29205 |
| 77 | Ga0209050_1013380 | 3300025298 | Bacteria | 3649 |
| 78 | Ga0209050_1036998 | 3300025298 | Bacteria | 1416 |
| 79 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 80 | Ga0209256_1012736 | 3300025299 | Bacteria | 3185 |
| 81 | Ga0209256_1013844 | 3300025299 | Bacteria | 2962 |
| 82 | Ga0209051_1026924 | 3300025303 | Bacteria | 2304 |
| 83 | Ga0209257_1000180 | 3300025304 | Bacteria | 158090 |
| 84 | Ga0209257_1000204 | 3300025304 | Bacteria | 143800 |
| 85 | Ga0209257_1003198 | 3300025304 | Bacteria | 14522 |
| 86 | Ga0209257_1011237 | 3300025304 | Bacteria | 4345 |
| 87 | Ga0207713_1000292 | 3300025735 | Bacteria | 57738 |
| 88 | Ga0207652_10078118 | 3300025921 | Bacteria | 2889 |
| 89 | Ga0207650_10017366 | 3300025925 | Bacteria | 5038 |
| 90 | Ga0207659_10109139 | 3300025926 | Bacteria | 2100 |
| 91 | Ga0207709_10003032 | 3300025935 | Bacteria | 10197 |
| 92 | Ga0207709_10010972 | 3300025935 | Bacteria | 4995 |
| 93 | Ga0207691_10017313 | 3300025940 | Bacteria | 6835 |
| 94 | Ga0207676_10226284 | 3300026095 | Bacteria | 1669 |
| 95 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 96 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 97 | Ga0209999_1002838 | 3300027543 | Bacteria | 3070 |
| 98 | Ga0209974_10003051 | 3300027876 | Bacteria | 6058 |
| 99 | Ga0268266_10096360 | 3300028379 | Bacteria | 2600 |
| 100 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 101 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 102 | Ga0307412_10010252 | 3300031911 | Bacteria | 5394 |
| 103 | Ga0307414_10005212 | 3300032004 | Bacteria | 7139 |
| 104 | Ga0307414_10013474 | 3300032004 | Bacteria | 4870 |
| 105 | Ga0307414_10036014 | 3300032004 | Bacteria | 3299 |
| 106 | Ga0307414_10038331 | 3300032004 | Bacteria | 3217 |
| 107 | Ga0307411_10123101 | 3300032005 | Bacteria | 1881 |
| 108 | Ga0237819_00047 | 3300038705 | Bacteria | 41634 |
| 109 | Ga0439436_0021100 | 3300041404 | Bacteria | 1938 |
| 110 | Ga0439436_0040708 | 3300041404 | Bacteria | 1331 |
| 111 | Ga0439439_0021481 | 3300041406 | Bacteria | 1608 |
| 112 | Ga0439447_005122 | 3300041407 | Bacteria | 4398 |
| 113 | Ga0439465_0003871 | 3300041413 | Bacteria | 4883 |
| 114 | Ga0451793_0432264 | 3300041452 | Bacteria | 1210 |
| 115 | Ga0451800_0377454 | 3300041459 | Bacteria | 9861 |
| 116 | Ga0451807_0728605 | 3300041486 | Bacteria | 3223 |
| 117 | Ga0451837_0261469 | 3300041494 | Bacteria | 1461 |
| 118 | Ga0451843_1069758 | 3300041509 | Bacteria | 1838 |
| 119 | Ga0439445_0007911 | 3300042004 | Bacteria | 2478 |
| 120 | Ga0439432_007758 | 3300042006 | Bacteria | 3788 |
| 121 | Ga0439432_042215 | 3300042006 | Bacteria | 1442 |
| 122 | Ga0439449_0001611 | 3300042007 | Bacteria | 8843 |
| 123 | Ga0439449_0006137 | 3300042007 | Bacteria | 4591 |
| 124 | Ga0451577_0165749 | 3300042876 | Bacteria | 1990 |
| 125 | Ga0453684_0176631 | 3300044712 | Bacteria | 2511 |
| 126 | Ga0495627_009698 | 3300046453 | Bacteria | 3533 |
| 127 | Ga0495638_0002377 | 3300046460 | Bacteria | 15412 |
| 128 | Ga0495638_0031640 | 3300046460 | Bacteria | 3399 |
| 129 | Ga0495607_0012851 | 3300046501 | Bacteria | 5506 |
| 130 | Ga0495610_0061048 | 3300046512 | Bacteria | 1792 |
| 131 | Ga0495631_0013112 | 3300046518 | Bacteria | 4030 |
| 132 | Ga0495643_0002788 | 3300046522 | Bacteria | 13352 |
| 133 | Ga0495663_0003133 | 3300046525 | Bacteria | 4830 |
| 134 | Ga0495633_0004720 | 3300046558 | Bacteria | 8564 |
| 135 | Ga0495656_0029373 | 3300046615 | Bacteria | 2213 |
| 136 | Ga0495668_0007213 | 3300046616 | Bacteria | 7139 |
| 137 | Ga0495660_0008944 | 3300046810 | Bacteria | 5851 |
| 138 | Ga0495636_0002105 | 3300047318 | Bacteria | 7655 |
| 139 | Ga0495636_0011101 | 3300047318 | Bacteria | 3563 |
| 140 | Ga0495636_0012196 | 3300047318 | Bacteria | 3403 |
| 141 | Ga0495672_0000308 | 3300047320 | Bacteria | 65628 |
| 142 | Ga0496105_0287849 | 3300048908 | Bacteria | 1323 |
| 143 | Ga0496107_0197547 | 3300048910 | Bacteria | 1495 |
| 144 | Ga0496111_0031975 | 3300048914 | Bacteria | 3750 |
| 145 | Ga0496114_0087877 | 3300048917 | Bacteria | 2636 |
| 146 | Ga0496116_0003743 | 3300048919 | Bacteria | 14871 |
| 147 | Ga0496116_0092495 | 3300048919 | Bacteria | 1834 |
| 148 | Ga0496117_0000921 | 3300048920 | Bacteria | 45010 |
| 149 | Ga0496117_0001552 | 3300048920 | Bacteria | 32622 |
| 150 | Ga0496117_0003973 | 3300048920 | Bacteria | 16712 |
| 151 | Ga0496117_0004978 | 3300048920 | Bacteria | 14251 |
| 152 | Ga0496117_0059077 | 3300048920 | Bacteria | 2652 |
| 153 | Ga0496117_0173180 | 3300048920 | Bacteria | 1250 |
| 154 | Ga0496118_0000681 | 3300048921 | Bacteria | 55339 |
| 155 | Ga0496118_0004401 | 3300048921 | Bacteria | 16734 |
| 156 | Ga0496118_0005500 | 3300048921 | Bacteria | 14377 |
| 157 | Ga0496118_0015060 | 3300048921 | Bacteria | 7189 |
| 158 | Ga0496118_0045909 | 3300048921 | Bacteria | 3403 |
| 159 | Ga0496118_0123136 | 3300048921 | Bacteria | 1685 |
| 160 | Ga0496119_0000320 | 3300048922 | Bacteria | 67229 |
| 161 | Ga0496119_0000902 | 3300048922 | Bacteria | 38716 |
| 162 | Ga0496119_0062318 | 3300048922 | Bacteria | 2223 |
| 163 | Ga0496120_0000424 | 3300048923 | Bacteria | 67451 |
| 164 | Ga0496120_0000605 | 3300048923 | Bacteria | 54408 |
| 165 | Ga0496121_0007368 | 3300048924 | Bacteria | 13299 |
| 166 | Ga0496121_0138566 | 3300048924 | Bacteria | 1809 |
| 167 | Ga0496121_0165765 | 3300048924 | Bacteria | 1610 |
| 168 | Ga0496122_0000220 | 3300048925 | Bacteria | 127065 |
| 169 | Ga0496122_0000680 | 3300048925 | Bacteria | 68089 |
| 170 | Ga0496122_0007784 | 3300048925 | Bacteria | 11783 |
| 171 | Ga0496122_0016260 | 3300048925 | Bacteria | 7057 |
| 172 | Ga0496122_0016396 | 3300048925 | Bacteria | 7012 |
| 173 | Ga0496122_0021689 | 3300048925 | Bacteria | 5739 |
| 174 | Ga0496123_0000151 | 3300048926 | Bacteria | 141062 |
| 175 | Ga0496123_0000226 | 3300048926 | Bacteria | 113889 |
| 176 | Ga0496123_0009240 | 3300048926 | Bacteria | 8910 |
| 177 | Ga0496123_0013874 | 3300048926 | Bacteria | 6718 |
| 178 | Ga0496123_0029024 | 3300048926 | Bacteria | 4083 |
| 179 | Ga0496123_0037288 | 3300048926 | Bacteria | 3434 |
| 180 | Ga0496124_0000032 | 3300048927 | Bacteria | 332524 |
| 181 | Ga0496124_0000705 | 3300048927 | Bacteria | 54667 |
| 182 | Ga0496124_0005178 | 3300048927 | Bacteria | 14826 |
| 183 | Ga0496124_0007797 | 3300048927 | Bacteria | 11308 |
| 184 | Ga0496124_0029605 | 3300048927 | Bacteria | 4875 |
| 185 | Ga0496124_0044109 | 3300048927 | Bacteria | 3828 |
| 186 | Ga0496124_0045657 | 3300048927 | Bacteria | 3755 |
| 187 | Ga0496124_0080970 | 3300048927 | Bacteria | 2670 |
| 188 | Ga0496125_0002787 | 3300048928 | Bacteria | 22098 |
| 189 | Ga0496125_0005900 | 3300048928 | Bacteria | 13426 |
| 190 | Ga0496125_0008225 | 3300048928 | Bacteria | 10967 |
| 191 | Ga0496125_0017331 | 3300048928 | Bacteria | 6875 |
| 192 | Ga0496125_0019919 | 3300048928 | Bacteria | 6309 |
| 193 | Ga0496125_0097852 | 3300048928 | Bacteria | 2172 |
| 194 | Ga0496125_0109519 | 3300048928 | Bacteria | 2005 |
| 195 | Ga0496125_0174752 | 3300048928 | Bacteria | 1439 |
| 196 | Ga0496126_0003747 | 3300048929 | Bacteria | 18906 |
| 197 | Ga0496126_0332633 | 3300048929 | Bacteria | 1246 |
| 198 | Ga0501034_0000822 | 3300049571 | Bacteria | 46209 |
| 199 | Ga0501034_0001322 | 3300049571 | Bacteria | 33524 |
| 200 | Ga0501034_0009330 | 3300049571 | Bacteria | 10281 |
| 201 | Ga0501265_002337 | 3300049762 | Bacteria | 2152 |
| 202 | Ga0501275_000781 | 3300049772 | Bacteria | 3480 |
| 203 | nmdc:mga00v17_1308_c1 | 3300050491 | Bacteria | 13041 |
| 204 | nmdc:mga00v17_2953_c1 | 3300050491 | Bacteria | 8728 |
| 205 | Ga0500634_0000101 | 3300053161 | Bacteria | 33679 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026095 | Ga0207676_10226284 | Ga0207676_102262842 | 324 |
| 2 | 3300005466 | Ga0070685_10026008 | Ga0070685_100260082 | 348 |
| 3 | 3300048928 | Ga0496125_0097852 | Ga0496125_0097852_939_2039 | 360 |
| 4 | 3300041486 | Ga0451807_0728605 | Ga0451807_0728605_77_1204 | 371 |
| 5 | iso_pu_bacteria | 2547132130 | 2547500586 | 371 |
| 6 | iso_pu_bacteria | 2547132130 | 2547501563 | 371 |
| 7 | iso_pu_bacteria | 2571042365 | 2572253428 | 371 |
| 8 | iso_pu_bacteria | 2576861471 | 2578459021 | 371 |
| 9 | iso_pu_bacteria | 2643221573 | 2643879531 | 371 |
| 10 | iso_pu_bacteria | 2643221579 | 2643905682 | 371 |
| 11 | iso_pu_bacteria | 2643221695 | 2644528772 | 371 |
| 12 | iso_pu_bacteria | 2643221720 | 2644662858 | 371 |
| 13 | iso_pu_bacteria | 2643221728 | 2644698187 | 371 |
| 14 | iso_pu_bacteria | 2747842428 | 2747950043 | 371 |
| 15 | iso_pu_bacteria | 2747842501 | 2748015930 | 371 |
| 16 | iso_pu_bacteria | 2765235840 | 2765578354 | 371 |
| 17 | iso_pu_bacteria | 2816332141 | 2816516379 | 371 |
| 18 | iso_pu_bacteria | 2818991457 | 2819663633 | 371 |
| 19 | iso_pu_bacteria | 2842391507 | 2842392910 | 371 |
| 20 | iso_pu_bacteria | 2842757796 | 2842758693 | 371 |
| 21 | iso_pu_bacteria | 2852649853 | 2852651360 | 371 |
| 22 | iso_pu_bacteria | 2852684882 | 2852686327 | 371 |
| 23 | iso_pu_bacteria | 2857442823 | 2857446555 | 371 |
| 24 | iso_pu_bacteria | 2874220319 | 2874220980 | 371 |
| 25 | iso_pu_bacteria | 2894414249 | 2894415932 | 371 |
| 26 | iso_pu_bacteria | 2895498888 | 2895499233 | 371 |
| 27 | iso_pu_bacteria | 2895511927 | 2895512254 | 371 |
| 28 | iso_pu_bacteria | 2895522137 | 2895522264 | 371 |
| 29 | iso_pu_bacteria | 2895525241 | 2895527292 | 371 |
| 30 | iso_pu_bacteria | 2919089067 | 2919091189 | 371 |
| 31 | iso_pu_bacteria | 2919134579 | 2919136775 | 371 |
| 32 | iso_pu_bacteria | 2919513703 | 2919516679 | 371 |
| 33 | iso_pu_bacteria | 2919675420 | 2919677193 | 371 |
| 34 | iso_pu_bacteria | 2923516293 | 2923517784 | 371 |
| 35 | iso_pu_bacteria | 2928496128 | 2928497822 | 371 |
| 36 | iso_pu_bacteria | 2931380184 | 2931381376 | 371 |
| 37 | iso_pu_bacteria | 2937610967 | 2937611801 | 371 |
| 38 | iso_pu_bacteria | 2939589442 | 2939590488 | 371 |
| 39 | iso_pu_bacteria | 2939622612 | 2939622646 | 371 |
| 40 | iso_pu_bacteria | 2939626828 | 2939627740 | 371 |
| 41 | iso_pu_bacteria | 2941475908 | 2941477707 | 371 |
| 42 | iso_pu_bacteria | 2961047084 | 2961047745 | 371 |
| 43 | iso_pu_bacteria | 2961064222 | 2961067087 | 371 |
| 44 | iso_pu_bacteria | 2974307012 | 2974309469 | 371 |
| 45 | iso_pu_bacteria | 2977247770 | 2977250188 | 371 |
| 46 | iso_pu_bacteria | 2984514374 | 2984515320 | 371 |
| 47 | iso_pu_bacteria | 2987605356 | 2987608233 | 371 |
| 48 | iso_pu_bacteria | 8002869464 | 8002871654 | 371 |
| 49 | iso_pu_bacteria | 2842733646 | 2842736749 | 372 |
| 50 | iso_pu_bacteria | 2919130084 | 2919132444 | 372 |
| 51 | iso_pu_bacteria | 2929195423 | 2929197088 | 372 |
| 52 | iso_pu_bacteria | 2945972063 | 2945977192 | 372 |
| 53 | iso_pu_bacteria | 8021622325 | 8021624727 | 372 |
| 54 | iso_pu_bacteria | 8021626552 | 8021630382 | 372 |
| 55 | iso_pu_bacteria | 8021648035 | 8021648587 | 372 |
| 56 | 3300032005 | Ga0307411_10123101 | Ga0307411_101231013 | 373 |
| 57 | 3300005366 | Ga0070659_100085409 | Ga0070659_1000854092 | 374 |
| 58 | 3300038705 | Ga0237819_00047 | Ga0237819_00047_6320_7444 | 374 |
| 59 | 3300002773 | JGI25152J39213_1000018 | JGI25152J39213_100001898 | 375 |
| 60 | 3300002774 | JGI25150J39212_1000578 | JGI25150J39212_10005783 | 375 |
| 61 | 3300003187 | JGI25151J46595_10000111 | JGI25151J46595_1000011199 | 375 |
| 62 | 3300003215 | JGI25153J46596_10000085 | JGI25153J46596_100000853 | 375 |
| 63 | 3300003771 | Ga0055526_1000036 | Ga0055526_100003696 | 375 |
| 64 | 3300003771 | Ga0055526_1000328 | Ga0055526_100032825 | 375 |
| 65 | 3300003773 | Ga0055537_1000083 | Ga0055537_100008331 | 375 |
| 66 | 3300003773 | Ga0055537_1000695 | Ga0055537_100069512 | 375 |
| 67 | 3300003775 | Ga0055524_1000359 | Ga0055524_10003599 | 375 |
| 68 | 3300003781 | Ga0055536_1000690 | Ga0055536_100069010 | 375 |
| 69 | 3300003781 | Ga0055536_1001443 | Ga0055536_10014432 | 375 |
| 70 | 3300003781 | Ga0055536_1001487 | Ga0055536_10014871 | 375 |
| 71 | 3300003784 | Ga0055534_1000089 | Ga0055534_100008962 | 375 |
| 72 | 3300003784 | Ga0055534_1000103 | Ga0055534_100010332 | 375 |
| 73 | 3300003790 | Ga0055528_1000004 | Ga0055528_1000004241 | 375 |
| 74 | 3300003790 | Ga0055528_1000585 | Ga0055528_10005859 | 375 |
| 75 | 3300003791 | Ga0055530_10000996 | Ga0055530_100009967 | 375 |
| 76 | 3300003791 | Ga0055530_10001891 | Ga0055530_100018911 | 375 |
| 77 | 3300003794 | Ga0055531_10017726 | Ga0055531_100177262 | 375 |
| 78 | 3300003856 | Ga0058692_1000002 | Ga0058692_1000002346 | 375 |
| 79 | 3300003856 | Ga0058692_1000020 | Ga0058692_100002097 | 375 |
| 80 | 3300005347 | Ga0070668_100008907 | Ga0070668_1000089073 | 375 |
| 81 | 3300005347 | Ga0070668_100016377 | Ga0070668_1000163774 | 375 |
| 82 | 3300005530 | Ga0070679_100035870 | Ga0070679_1000358704 | 375 |
| 83 | 3300005543 | Ga0070672_100098904 | Ga0070672_1000989043 | 375 |
| 84 | 3300005578 | Ga0068854_100201397 | Ga0068854_1002013972 | 375 |
| 85 | 3300006038 | Ga0075365_10008515 | Ga0075365_100085154 | 375 |
| 86 | 3300006051 | Ga0075364_10008033 | Ga0075364_100080334 | 375 |
| 87 | 3300009011 | Ga0105251_10003806 | Ga0105251_100038062 | 375 |
| 88 | 3300009148 | Ga0105243_10006355 | Ga0105243_100063555 | 375 |
| 89 | 3300009148 | Ga0105243_10020640 | Ga0105243_100206402 | 375 |
| 90 | 3300013100 | Ga0157373_10046551 | Ga0157373_100465513 | 375 |
| 91 | 3300013100 | Ga0157373_10051579 | Ga0157373_100515792 | 375 |
| 92 | 3300013100 | Ga0157373_10199434 | Ga0157373_101994342 | 375 |
| 93 | 3300013102 | Ga0157371_10001165 | Ga0157371_1000116510 | 375 |
| 94 | 3300013102 | Ga0157371_10007919 | Ga0157371_100079192 | 375 |
| 95 | 3300013102 | Ga0157371_10182389 | Ga0157371_101823892 | 375 |
| 96 | 3300013105 | Ga0157369_10031626 | Ga0157369_100316264 | 375 |
| 97 | 3300014497 | Ga0182008_10000727 | Ga0182008_100007275 | 375 |
| 98 | 3300015261 | Ga0182006_1003628 | Ga0182006_10036286 | 375 |
| 99 | 3300015261 | Ga0182006_1015091 | Ga0182006_10150914 | 375 |
| 100 | 3300015262 | Ga0182007_10000184 | Ga0182007_1000018434 | 375 |
| 101 | 3300015265 | Ga0182005_1002478 | Ga0182005_10024782 | 375 |
| 102 | 3300015265 | Ga0182005_1005941 | Ga0182005_10059412 | 375 |
| 103 | 3300017792 | Ga0163161_10030729 | Ga0163161_100307293 | 375 |
| 104 | 3300017792 | Ga0163161_10063958 | Ga0163161_100639581 | 375 |
| 105 | 3300025245 | Ga0207425_1000028 | Ga0207425_1000028268 | 375 |
| 106 | 3300025245 | Ga0207425_1003689 | Ga0207425_10036896 | 375 |
| 107 | 3300025258 | Ga0209129_1000065 | Ga0209129_1000065216 | 375 |
| 108 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011541 | 375 |
| 109 | 3300025263 | Ga0209565_1000014 | Ga0209565_1000014369 | 375 |
| 110 | 3300025263 | Ga0209565_1000081 | Ga0209565_1000081122 | 375 |
| 111 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011541 | 375 |
| 112 | 3300025273 | Ga0209673_1000904 | Ga0209673_100090413 | 375 |
| 113 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001993 | 375 |
| 114 | 3300025291 | Ga0209675_1000021 | Ga0209675_1000021120 | 375 |
| 115 | 3300025292 | Ga0209676_1000024 | Ga0209676_1000024503 | 375 |
| 116 | 3300025292 | Ga0209676_1000047 | Ga0209676_1000047325 | 375 |
| 117 | 3300025292 | Ga0209676_1000203 | Ga0209676_1000203108 | 375 |
| 118 | 3300025292 | Ga0209676_1001141 | Ga0209676_100114112 | 375 |
| 119 | 3300025294 | Ga0209025_1000002 | Ga0209025_10000024 | 375 |
| 120 | 3300025294 | Ga0209025_1000015 | Ga0209025_1000015155 | 375 |
| 121 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000011155 | 375 |
| 122 | 3300025295 | Ga0209564_1000263 | Ga0209564_1000263102 | 375 |
| 123 | 3300025297 | Ga0209758_1000003 | Ga0209758_100000311 | 375 |
| 124 | 3300025297 | Ga0209758_1008172 | Ga0209758_10081726 | 375 |
| 125 | 3300025298 | Ga0209050_1000894 | Ga0209050_10008942 | 375 |
| 126 | 3300025298 | Ga0209050_1001262 | Ga0209050_100126213 | 375 |
| 127 | 3300025298 | Ga0209050_1013380 | Ga0209050_10133804 | 375 |
| 128 | 3300025298 | Ga0209050_1036998 | Ga0209050_10369982 | 375 |
| 129 | 3300025299 | Ga0209256_1000002 | Ga0209256_1000002399 | 375 |
| 130 | 3300025299 | Ga0209256_1012736 | Ga0209256_10127362 | 375 |
| 131 | 3300025299 | Ga0209256_1013844 | Ga0209256_10138443 | 375 |
| 132 | 3300025303 | Ga0209051_1026924 | Ga0209051_10269243 | 375 |
| 133 | 3300025304 | Ga0209257_1000180 | Ga0209257_10001804 | 375 |
| 134 | 3300025304 | Ga0209257_1000204 | Ga0209257_1000204113 | 375 |
| 135 | 3300025304 | Ga0209257_1003198 | Ga0209257_10031982 | 375 |
| 136 | 3300025304 | Ga0209257_1011237 | Ga0209257_10112374 | 375 |
| 137 | 3300025926 | Ga0207659_10109139 | Ga0207659_101091392 | 375 |
| 138 | 3300025935 | Ga0207709_10003032 | Ga0207709_100030325 | 375 |
| 139 | 3300025935 | Ga0207709_10010972 | Ga0207709_100109726 | 375 |
| 140 | 3300025940 | Ga0207691_10017313 | Ga0207691_100173133 | 375 |
| 141 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004555 | 375 |
| 142 | 3300027312 | Ga0209371_1000011 | Ga0209371_1000011362 | 375 |
| 143 | 3300027543 | Ga0209999_1002838 | Ga0209999_10028382 | 375 |
| 144 | 3300027876 | Ga0209974_10003051 | Ga0209974_100030515 | 375 |
| 145 | 3300028379 | Ga0268266_10096360 | Ga0268266_100963603 | 375 |
| 146 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005491 | 375 |
| 147 | 3300030500 | Ga0268256_1000011 | Ga0268256_1000011362 | 375 |
| 148 | 3300031911 | Ga0307412_10010252 | Ga0307412_100102521 | 375 |
| 149 | 3300032004 | Ga0307414_10005212 | Ga0307414_100052124 | 375 |
| 150 | 3300032004 | Ga0307414_10013474 | Ga0307414_100134742 | 375 |
| 151 | 3300032004 | Ga0307414_10036014 | Ga0307414_100360143 | 375 |
| 152 | 3300032004 | Ga0307414_10038331 | Ga0307414_100383314 | 375 |
| 153 | 3300041404 | Ga0439436_0021100 | Ga0439436_0021100_141_1295 | 375 |
| 154 | 3300041404 | Ga0439436_0040708 | Ga0439436_0040708_66_1193 | 375 |
| 155 | 3300041406 | Ga0439439_0021481 | Ga0439439_0021481_443_1597 | 375 |
| 156 | 3300041407 | Ga0439447_005122 | Ga0439447_005122_22_1173 | 375 |
| 157 | 3300041413 | Ga0439465_0003871 | Ga0439465_0003871_2021_3163 | 375 |
| 158 | 3300041452 | Ga0451793_0432264 | Ga0451793_0432264_53_1180 | 375 |
| 159 | 3300041459 | Ga0451800_0377454 | Ga0451800_0377454_5841_6968 | 375 |
| 160 | 3300041494 | Ga0451837_0261469 | Ga0451837_0261469_51_1184 | 375 |
| 161 | 3300041509 | Ga0451843_1069758 | Ga0451843_1069758_62_1195 | 375 |
| 162 | 3300042004 | Ga0439445_0007911 | Ga0439445_0007911_702_1835 | 375 |
| 163 | 3300042006 | Ga0439432_007758 | Ga0439432_007758_41_1186 | 375 |
| 164 | 3300042006 | Ga0439432_042215 | Ga0439432_042215_16_1158 | 375 |
| 165 | 3300042007 | Ga0439449_0001611 | Ga0439449_0001611_3792_4943 | 375 |
| 166 | 3300042007 | Ga0439449_0006137 | Ga0439449_0006137_854_1981 | 375 |
| 167 | 3300042876 | Ga0451577_0165749 | Ga0451577_0165749_524_1657 | 375 |
| 168 | 3300044712 | Ga0453684_0176631 | Ga0453684_0176631_840_1973 | 375 |
| 169 | 3300046453 | Ga0495627_009698 | Ga0495627_009698_933_2060 | 375 |
| 170 | 3300046460 | Ga0495638_0002377 | Ga0495638_0002377_2647_3774 | 375 |
| 171 | 3300046460 | Ga0495638_0031640 | Ga0495638_0031640_285_1412 | 375 |
| 172 | 3300046501 | Ga0495607_0012851 | Ga0495607_0012851_1772_2914 | 375 |
| 173 | 3300046512 | Ga0495610_0061048 | Ga0495610_0061048_440_1567 | 375 |
| 174 | 3300046518 | Ga0495631_0013112 | Ga0495631_0013112_2607_3734 | 375 |
| 175 | 3300046522 | Ga0495643_0002788 | Ga0495643_0002788_2643_3770 | 375 |
| 176 | 3300046525 | Ga0495663_0003133 | Ga0495663_0003133_470_1597 | 375 |
| 177 | 3300046558 | Ga0495633_0004720 | Ga0495633_0004720_4358_5485 | 375 |
| 178 | 3300046615 | Ga0495656_0029373 | Ga0495656_0029373_736_1887 | 375 |
| 179 | 3300046616 | Ga0495668_0007213 | Ga0495668_0007213_1797_2951 | 375 |
| 180 | 3300046810 | Ga0495660_0008944 | Ga0495660_0008944_1019_2146 | 375 |
| 181 | 3300047318 | Ga0495636_0002105 | Ga0495636_0002105_4641_5783 | 375 |
| 182 | 3300047318 | Ga0495636_0011101 | Ga0495636_0011101_2416_3543 | 375 |
| 183 | 3300047318 | Ga0495636_0012196 | Ga0495636_0012196_2252_3379 | 375 |
| 184 | 3300047320 | Ga0495672_0000308 | Ga0495672_0000308_24139_25266 | 375 |
| 185 | 3300048908 | Ga0496105_0287849 | Ga0496105_0287849_100_1227 | 375 |
| 186 | 3300048910 | Ga0496107_0197547 | Ga0496107_0197547_215_1342 | 375 |
| 187 | 3300048914 | Ga0496111_0031975 | Ga0496111_0031975_2247_3374 | 375 |
| 188 | 3300048917 | Ga0496114_0087877 | Ga0496114_0087877_646_1788 | 375 |
| 189 | 3300048919 | Ga0496116_0003743 | Ga0496116_0003743_4083_5210 | 375 |
| 190 | 3300048919 | Ga0496116_0092495 | Ga0496116_0092495_132_1259 | 375 |
| 191 | 3300048920 | Ga0496117_0001552 | Ga0496117_0001552_19260_20387 | 375 |
| 192 | 3300048920 | Ga0496117_0003973 | Ga0496117_0003973_4241_5368 | 375 |
| 193 | 3300048920 | Ga0496117_0004978 | Ga0496117_0004978_3396_4523 | 375 |
| 194 | 3300048920 | Ga0496117_0059077 | Ga0496117_0059077_239_1366 | 375 |
| 195 | 3300048920 | Ga0496117_0173180 | Ga0496117_0173180_49_1176 | 375 |
| 196 | 3300048921 | Ga0496118_0000681 | Ga0496118_0000681_41831_42958 | 375 |
| 197 | 3300048921 | Ga0496118_0004401 | Ga0496118_0004401_11367_12494 | 375 |
| 198 | 3300048921 | Ga0496118_0005500 | Ga0496118_0005500_4365_5564 | 375 |
| 199 | 3300048921 | Ga0496118_0015060 | Ga0496118_0015060_3950_5077 | 375 |
| 200 | 3300048921 | Ga0496118_0045909 | Ga0496118_0045909_1313_2440 | 375 |
| 201 | 3300048921 | Ga0496118_0123136 | Ga0496118_0123136_514_1647 | 375 |
| 202 | 3300048922 | Ga0496119_0000902 | Ga0496119_0000902_20872_21999 | 375 |
| 203 | 3300048922 | Ga0496119_0062318 | Ga0496119_0062318_1080_2207 | 375 |
| 204 | 3300048923 | Ga0496120_0000605 | Ga0496120_0000605_42620_43747 | 375 |
| 205 | 3300048924 | Ga0496121_0007368 | Ga0496121_0007368_922_2049 | 375 |
| 206 | 3300048924 | Ga0496121_0138566 | Ga0496121_0138566_164_1291 | 375 |
| 207 | 3300048924 | Ga0496121_0165765 | Ga0496121_0165765_437_1564 | 375 |
| 208 | 3300048925 | Ga0496122_0000220 | Ga0496122_0000220_125060_126187 | 375 |
| 209 | 3300048925 | Ga0496122_0007784 | Ga0496122_0007784_1446_2573 | 375 |
| 210 | 3300048925 | Ga0496122_0016260 | Ga0496122_0016260_4149_5276 | 375 |
| 211 | 3300048925 | Ga0496122_0016396 | Ga0496122_0016396_4149_5276 | 375 |
| 212 | 3300048925 | Ga0496122_0021689 | Ga0496122_0021689_3968_5095 | 375 |
| 213 | 3300048926 | Ga0496123_0000151 | Ga0496123_0000151_868_1995 | 375 |
| 214 | 3300048926 | Ga0496123_0009240 | Ga0496123_0009240_5123_6250 | 375 |
| 215 | 3300048926 | Ga0496123_0013874 | Ga0496123_0013874_847_1974 | 375 |
| 216 | 3300048926 | Ga0496123_0029024 | Ga0496123_0029024_1573_2700 | 375 |
| 217 | 3300048926 | Ga0496123_0037288 | Ga0496123_0037288_630_1757 | 375 |
| 218 | 3300048927 | Ga0496124_0000032 | Ga0496124_0000032_244369_245496 | 375 |
| 219 | 3300048927 | Ga0496124_0005178 | Ga0496124_0005178_612_1742 | 375 |
| 220 | 3300048927 | Ga0496124_0007797 | Ga0496124_0007797_2450_3577 | 375 |
| 221 | 3300048927 | Ga0496124_0029605 | Ga0496124_0029605_2223_3350 | 375 |
| 222 | 3300048927 | Ga0496124_0044109 | Ga0496124_0044109_1834_2961 | 375 |
| 223 | 3300048927 | Ga0496124_0045657 | Ga0496124_0045657_501_1628 | 375 |
| 224 | 3300048927 | Ga0496124_0080970 | Ga0496124_0080970_1202_2329 | 375 |
| 225 | 3300048928 | Ga0496125_0002787 | Ga0496125_0002787_16704_17831 | 375 |
| 226 | 3300048928 | Ga0496125_0005900 | Ga0496125_0005900_3562_4689 | 375 |
| 227 | 3300048928 | Ga0496125_0008225 | Ga0496125_0008225_849_1976 | 375 |
| 228 | 3300048928 | Ga0496125_0017331 | Ga0496125_0017331_4089_5216 | 375 |
| 229 | 3300048928 | Ga0496125_0019919 | Ga0496125_0019919_277_1404 | 375 |
| 230 | 3300048928 | Ga0496125_0109519 | Ga0496125_0109519_733_1860 | 375 |
| 231 | 3300048928 | Ga0496125_0174752 | Ga0496125_0174752_268_1395 | 375 |
| 232 | 3300048929 | Ga0496126_0003747 | Ga0496126_0003747_7128_8255 | 375 |
| 233 | 3300048929 | Ga0496126_0332633 | Ga0496126_0332633_29_1156 | 375 |
| 234 | 3300049571 | Ga0501034_0000822 | Ga0501034_0000822_38678_39805 | 375 |
| 235 | 3300049571 | Ga0501034_0001322 | Ga0501034_0001322_25161_26303 | 375 |
| 236 | 3300049571 | Ga0501034_0009330 | Ga0501034_0009330_9000_10127 | 375 |
| 237 | 3300049762 | Ga0501265_002337 | Ga0501265_002337_364_1512 | 375 |
| 238 | 3300049772 | Ga0501275_000781 | Ga0501275_000781_424_1572 | 375 |
| 239 | 3300050491 | nmdc:mga00v17_1308_c1 | nmdc:mga00v17_1308_c1_10004_11134 | 375 |
| 240 | 3300050491 | nmdc:mga00v17_2953_c1 | nmdc:mga00v17_2953_c1_6465_7601 | 375 |
| 241 | 3300053161 | Ga0500634_0000101 | Ga0500634_0000101_26925_28052 | 375 |
| 242 | iso_pu_bacteria | 2643221559 | 2643819013 | 375 |
| 243 | iso_pu_bacteria | 2643221586 | 2643941318 | 375 |
| 244 | iso_pu_bacteria | 2643221593 | 2643974418 | 375 |
| 245 | iso_pu_bacteria | 2643221612 | 2644080437 | 375 |
| 246 | iso_pu_bacteria | 2643221727 | 2644697050 | 375 |
| 247 | iso_pu_bacteria | 2842780639 | 2842783541 | 375 |
| 248 | 2162886007 | SwRhRL2b_contig_45537 | SwRhRL2b_1000.00005440 | 376 |
| 249 | 3300005289 | Ga0065704_10077265 | Ga0065704_100772652 | 376 |
| 250 | 3300005331 | Ga0070670_100002284 | Ga0070670_1000022842 | 376 |
| 251 | 3300005530 | Ga0070679_100060663 | Ga0070679_1000606633 | 376 |
| 252 | 3300009011 | Ga0105251_10000010 | Ga0105251_10000010123 | 376 |
| 253 | 3300014497 | Ga0182008_10000136 | Ga0182008_100001363 | 376 |
| 254 | 3300025735 | Ga0207713_1000292 | Ga0207713_100029246 | 376 |
| 255 | 3300025921 | Ga0207652_10078118 | Ga0207652_100781182 | 376 |
| 256 | 3300025925 | Ga0207650_10017366 | Ga0207650_100173662 | 376 |
| 257 | 3300048920 | Ga0496117_0000921 | Ga0496117_0000921_30856_31986 | 376 |
| 258 | 3300048922 | Ga0496119_0000320 | Ga0496119_0000320_35375_36505 | 376 |
| 259 | 3300048923 | Ga0496120_0000424 | Ga0496120_0000424_35466_36596 | 376 |
| 260 | 3300048925 | Ga0496122_0000680 | Ga0496122_0000680_30844_31974 | 376 |
| 261 | 3300048926 | Ga0496123_0000226 | Ga0496123_0000226_30904_32034 | 376 |
| 262 | 3300048927 | Ga0496124_0000705 | Ga0496124_0000705_22761_23891 | 376 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4h2k-assembly1.cif.gz_A | crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae | 0.9429 | 3 | 375 |
| 4h2k-assembly2.cif.gz_B | crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae | 0.9417 | 3 | 376 |
| 7lgp-assembly1.cif.gz_A | dape enzyme from shigella flexneri | 0.9359 | 1 | 376 |
| 7lgp-assembly1.cif.gz_A | dape enzyme from shigella flexneri | 0.9335 | 1 | 376 |
| 4h2k-assembly2.cif.gz_B | crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae | 0.9274 | 3 | 376 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vgyB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9291 | 1 | 375 | 3.40.630.10 |
| 1vgyB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9222 | 1 | 375 | 3.40.630.10 |
| af_P0AED7_3_244_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.901 | 3 | 245 | 3.40.630.10 |
| af_P0AED7_3_244_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.8941 | 3 | 245 | 3.40.630.10 |
| af_Q18621_173_267_3.30.70.360 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8775 | 185 | 282 | 3.30.70.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q12C18-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (SDAP desuccinylase) (EC 3.5.1.18) (N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase) | 0.9329 | 1 | 374 |
GO:0006526
GO:0008270 GO:0008777 GO:0009014 GO:0009089 GO:0019877 GO:0050897 |
| AF-Q12C18-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (SDAP desuccinylase) (EC 3.5.1.18) (N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase) | 0.9257 | 1 | 374 |
GO:0006526
GO:0008270 GO:0008777 GO:0009014 GO:0009089 GO:0019877 GO:0050897 |
| AF-A0A3T0L106-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) | 0.9242 | 4 | 372 |
GO:0006526
GO:0008777 GO:0009014 GO:0009089 GO:0019877 GO:0046872 |
| AF-Q470C3-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (SDAP desuccinylase) (EC 3.5.1.18) (N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase) | 0.9206 | 1 | 376 |
GO:0006526
GO:0008270 GO:0008777 GO:0009014 GO:0009089 GO:0019877 GO:0050897 |
| AF-A0A154UBX6-F1-model_v4 | deleted | 0.9205 | 1 | 376 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar