F370930

General Info

Members Datasets Scaffolds Average Seq Length
262 166 205 376

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100060663|Ga0070679_1000606633
Length 382
Sequence MSATLALAEQLISRRSVTPEDAGCQALLAGRLAPIGFDCTHLPFGPDGARVSNLWALKRGAASEGKLLVFAGHTDVVPTGPLSAWRSDPFVPTRRDGVLYGRGAADMKSSIAAMAVACAEFVAARPRHAGSIALLITSDEEGPSLHGTRRVCDWLAERGTALDYCVVGEPTSVAKLGDTIKNGRRGTLSGKLTVRGVQGHIAYPHLARNPIHLAAPLLAELATVEWDRGNAHFPPTSWQMSNIHAGTGAGNVIPGELTVDFNFRFSSESTPESLRDRFEQVVRRHGVEHAIEWTLGGEPFLTAPGALSDALARAIRAHAGVETELSTTGGTSDGRFIARICREVVEFGPVNASIHKIDERIEIASLDVLKDVYLATLEQLVA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221593 Lysobacter sp. Root690 Isolate Unclassified
10 2643221612 Lysobacter sp. Root76 Isolate Unclassified
11 2643221695 Lysobacter sp. Root494 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
16 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
17 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
18 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
19 2818991457 Xanthomonas translucens 569 Isolate Unclassified
20 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
21 2842733646 Variovorax sp. R-72446 Isolate Unclassified
22 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
23 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
24 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
25 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
26 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
27 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
28 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
29 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
30 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
31 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
32 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
33 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
34 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
35 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
36 2919513703 Luteimonas sp. 3794 Isolate Unclassified
37 2919675420 Luteimonas terrae 4099 Isolate Unclassified
38 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
39 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
40 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
41 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
42 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
43 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
44 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
45 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
46 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
47 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
48 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
49 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
50 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
51 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
52 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
53 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
54 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
55 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
116 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
117 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
118 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
121 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
125 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
126 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
160 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
163 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
164 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
165 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
166 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.24
Metatranscriptomes 0
Isolates 21.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 21.37
Nodule 0.38
Rhizoplane 2.67
Rhizosphere 41.6
Stem 0
Stem Tuber 0
Unclassified 33.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_45537 2162886007 Bacteria 3892
2 JGI25152J39213_1000018 3300002773 Bacteria 109715
3 JGI25150J39212_1000578 3300002774 Bacteria 14562
4 JGI25151J46595_10000111 3300003187 Bacteria 111802
5 JGI25153J46596_10000085 3300003215 Bacteria 111802
6 Ga0055526_1000036 3300003771 Bacteria 135235
7 Ga0055526_1000328 3300003771 Bacteria 39221
8 Ga0055537_1000083 3300003773 Bacteria 68713
9 Ga0055537_1000695 3300003773 Bacteria 17497
10 Ga0055524_1000359 3300003775 Bacteria 41002
11 Ga0055536_1000690 3300003781 Bacteria 22652
12 Ga0055536_1001443 3300003781 Bacteria 14353
13 Ga0055536_1001487 3300003781 Bacteria 14092
14 Ga0055534_1000089 3300003784 Bacteria 71523
15 Ga0055534_1000103 3300003784 Bacteria 65838
16 Ga0055528_1000004 3300003790 Bacteria 285772
17 Ga0055528_1000585 3300003790 Bacteria 27488
18 Ga0055530_10000996 3300003791 Bacteria 22669
19 Ga0055530_10001891 3300003791 Bacteria 14362
20 Ga0055531_10017726 3300003794 Bacteria 2987
21 Ga0058692_1000002 3300003856 Bacteria 508401
22 Ga0058692_1000020 3300003856 Bacteria 250589
23 Ga0065704_10077265 3300005289 Bacteria 4796
24 Ga0070670_100002284 3300005331 Bacteria 15790
25 Ga0070668_100008907 3300005347 Bacteria 7450
26 Ga0070668_100016377 3300005347 Bacteria 5543
27 Ga0070659_100085409 3300005366 Bacteria 2524
28 Ga0070685_10026008 3300005466 Bacteria 3224
29 Ga0070679_100035870 3300005530 Bacteria 4920
30 Ga0070679_100060663 3300005530 Bacteria 3769
31 Ga0070672_100098904 3300005543 Bacteria 2363
32 Ga0068854_100201397 3300005578 Bacteria 1565
33 Ga0075365_10008515 3300006038 Bacteria 5831
34 Ga0075364_10008033 3300006051 Bacteria 6293
35 Ga0105251_10000010 3300009011 Bacteria 186242
36 Ga0105251_10003806 3300009011 Bacteria 10765
37 Ga0105243_10006355 3300009148 Bacteria 9126
38 Ga0105243_10020640 3300009148 Bacteria 4995
39 Ga0157373_10046551 3300013100 Bacteria 3095
40 Ga0157373_10051579 3300013100 Bacteria 2930
41 Ga0157373_10199434 3300013100 Bacteria 1411
42 Ga0157371_10001165 3300013102 Bacteria 28235
43 Ga0157371_10007919 3300013102 Bacteria 8525
44 Ga0157371_10182389 3300013102 Bacteria 1501
45 Ga0157369_10031626 3300013105 Bacteria 5826
46 Ga0182008_10000136 3300014497 Bacteria 55863
47 Ga0182008_10000727 3300014497 Bacteria 23423
48 Ga0182006_1003628 3300015261 Bacteria 7841
49 Ga0182006_1015091 3300015261 Bacteria 3318
50 Ga0182007_10000184 3300015262 Bacteria 42443
51 Ga0182005_1002478 3300015265 Bacteria 6567
52 Ga0182005_1005941 3300015265 Bacteria 3777
53 Ga0163161_10030729 3300017792 Bacteria 3825
54 Ga0163161_10063958 3300017792 Bacteria 2683
55 Ga0207425_1000028 3300025245 Bacteria 286333
56 Ga0207425_1003689 3300025245 Bacteria 4818
57 Ga0209129_1000065 3300025258 Bacteria 232568
58 Ga0209565_1000001 3300025263 Bacteria 2950419
59 Ga0209565_1000014 3300025263 Bacteria 530302
60 Ga0209565_1000081 3300025263 Bacteria 155639
61 Ga0209673_1000001 3300025273 Bacteria 3176258
62 Ga0209673_1000904 3300025273 Bacteria 37938
63 Ga0209675_1000001 3300025291 Bacteria 2950293
64 Ga0209675_1000021 3300025291 Bacteria 334833
65 Ga0209676_1000024 3300025292 Bacteria 578839
66 Ga0209676_1000047 3300025292 Bacteria 408645
67 Ga0209676_1000203 3300025292 Bacteria 132949
68 Ga0209676_1001141 3300025292 Bacteria 29048
69 Ga0209025_1000002 3300025294 Bacteria 1393142
70 Ga0209025_1000015 3300025294 Bacteria 808120
71 Ga0209564_1000001 3300025295 Bacteria 3176258
72 Ga0209564_1000263 3300025295 Bacteria 112148
73 Ga0209758_1000003 3300025297 Bacteria 1398533
74 Ga0209758_1008172 3300025297 Bacteria 6864
75 Ga0209050_1000894 3300025298 Bacteria 39568
76 Ga0209050_1001262 3300025298 Bacteria 29205
77 Ga0209050_1013380 3300025298 Bacteria 3649
78 Ga0209050_1036998 3300025298 Bacteria 1416
79 Ga0209256_1000002 3300025299 Bacteria 1906740
80 Ga0209256_1012736 3300025299 Bacteria 3185
81 Ga0209256_1013844 3300025299 Bacteria 2962
82 Ga0209051_1026924 3300025303 Bacteria 2304
83 Ga0209257_1000180 3300025304 Bacteria 158090
84 Ga0209257_1000204 3300025304 Bacteria 143800
85 Ga0209257_1003198 3300025304 Bacteria 14522
86 Ga0209257_1011237 3300025304 Bacteria 4345
87 Ga0207713_1000292 3300025735 Bacteria 57738
88 Ga0207652_10078118 3300025921 Bacteria 2889
89 Ga0207650_10017366 3300025925 Bacteria 5038
90 Ga0207659_10109139 3300025926 Bacteria 2100
91 Ga0207709_10003032 3300025935 Bacteria 10197
92 Ga0207709_10010972 3300025935 Bacteria 4995
93 Ga0207691_10017313 3300025940 Bacteria 6835
94 Ga0207676_10226284 3300026095 Bacteria 1669
95 Ga0209371_1000004 3300027312 Bacteria 1098197
96 Ga0209371_1000011 3300027312 Bacteria 848456
97 Ga0209999_1002838 3300027543 Bacteria 3070
98 Ga0209974_10003051 3300027876 Bacteria 6058
99 Ga0268266_10096360 3300028379 Bacteria 2600
100 Ga0268256_1000005 3300030500 Bacteria 1082342
101 Ga0268256_1000011 3300030500 Bacteria 848625
102 Ga0307412_10010252 3300031911 Bacteria 5394
103 Ga0307414_10005212 3300032004 Bacteria 7139
104 Ga0307414_10013474 3300032004 Bacteria 4870
105 Ga0307414_10036014 3300032004 Bacteria 3299
106 Ga0307414_10038331 3300032004 Bacteria 3217
107 Ga0307411_10123101 3300032005 Bacteria 1881
108 Ga0237819_00047 3300038705 Bacteria 41634
109 Ga0439436_0021100 3300041404 Bacteria 1938
110 Ga0439436_0040708 3300041404 Bacteria 1331
111 Ga0439439_0021481 3300041406 Bacteria 1608
112 Ga0439447_005122 3300041407 Bacteria 4398
113 Ga0439465_0003871 3300041413 Bacteria 4883
114 Ga0451793_0432264 3300041452 Bacteria 1210
115 Ga0451800_0377454 3300041459 Bacteria 9861
116 Ga0451807_0728605 3300041486 Bacteria 3223
117 Ga0451837_0261469 3300041494 Bacteria 1461
118 Ga0451843_1069758 3300041509 Bacteria 1838
119 Ga0439445_0007911 3300042004 Bacteria 2478
120 Ga0439432_007758 3300042006 Bacteria 3788
121 Ga0439432_042215 3300042006 Bacteria 1442
122 Ga0439449_0001611 3300042007 Bacteria 8843
123 Ga0439449_0006137 3300042007 Bacteria 4591
124 Ga0451577_0165749 3300042876 Bacteria 1990
125 Ga0453684_0176631 3300044712 Bacteria 2511
126 Ga0495627_009698 3300046453 Bacteria 3533
127 Ga0495638_0002377 3300046460 Bacteria 15412
128 Ga0495638_0031640 3300046460 Bacteria 3399
129 Ga0495607_0012851 3300046501 Bacteria 5506
130 Ga0495610_0061048 3300046512 Bacteria 1792
131 Ga0495631_0013112 3300046518 Bacteria 4030
132 Ga0495643_0002788 3300046522 Bacteria 13352
133 Ga0495663_0003133 3300046525 Bacteria 4830
134 Ga0495633_0004720 3300046558 Bacteria 8564
135 Ga0495656_0029373 3300046615 Bacteria 2213
136 Ga0495668_0007213 3300046616 Bacteria 7139
137 Ga0495660_0008944 3300046810 Bacteria 5851
138 Ga0495636_0002105 3300047318 Bacteria 7655
139 Ga0495636_0011101 3300047318 Bacteria 3563
140 Ga0495636_0012196 3300047318 Bacteria 3403
141 Ga0495672_0000308 3300047320 Bacteria 65628
142 Ga0496105_0287849 3300048908 Bacteria 1323
143 Ga0496107_0197547 3300048910 Bacteria 1495
144 Ga0496111_0031975 3300048914 Bacteria 3750
145 Ga0496114_0087877 3300048917 Bacteria 2636
146 Ga0496116_0003743 3300048919 Bacteria 14871
147 Ga0496116_0092495 3300048919 Bacteria 1834
148 Ga0496117_0000921 3300048920 Bacteria 45010
149 Ga0496117_0001552 3300048920 Bacteria 32622
150 Ga0496117_0003973 3300048920 Bacteria 16712
151 Ga0496117_0004978 3300048920 Bacteria 14251
152 Ga0496117_0059077 3300048920 Bacteria 2652
153 Ga0496117_0173180 3300048920 Bacteria 1250
154 Ga0496118_0000681 3300048921 Bacteria 55339
155 Ga0496118_0004401 3300048921 Bacteria 16734
156 Ga0496118_0005500 3300048921 Bacteria 14377
157 Ga0496118_0015060 3300048921 Bacteria 7189
158 Ga0496118_0045909 3300048921 Bacteria 3403
159 Ga0496118_0123136 3300048921 Bacteria 1685
160 Ga0496119_0000320 3300048922 Bacteria 67229
161 Ga0496119_0000902 3300048922 Bacteria 38716
162 Ga0496119_0062318 3300048922 Bacteria 2223
163 Ga0496120_0000424 3300048923 Bacteria 67451
164 Ga0496120_0000605 3300048923 Bacteria 54408
165 Ga0496121_0007368 3300048924 Bacteria 13299
166 Ga0496121_0138566 3300048924 Bacteria 1809
167 Ga0496121_0165765 3300048924 Bacteria 1610
168 Ga0496122_0000220 3300048925 Bacteria 127065
169 Ga0496122_0000680 3300048925 Bacteria 68089
170 Ga0496122_0007784 3300048925 Bacteria 11783
171 Ga0496122_0016260 3300048925 Bacteria 7057
172 Ga0496122_0016396 3300048925 Bacteria 7012
173 Ga0496122_0021689 3300048925 Bacteria 5739
174 Ga0496123_0000151 3300048926 Bacteria 141062
175 Ga0496123_0000226 3300048926 Bacteria 113889
176 Ga0496123_0009240 3300048926 Bacteria 8910
177 Ga0496123_0013874 3300048926 Bacteria 6718
178 Ga0496123_0029024 3300048926 Bacteria 4083
179 Ga0496123_0037288 3300048926 Bacteria 3434
180 Ga0496124_0000032 3300048927 Bacteria 332524
181 Ga0496124_0000705 3300048927 Bacteria 54667
182 Ga0496124_0005178 3300048927 Bacteria 14826
183 Ga0496124_0007797 3300048927 Bacteria 11308
184 Ga0496124_0029605 3300048927 Bacteria 4875
185 Ga0496124_0044109 3300048927 Bacteria 3828
186 Ga0496124_0045657 3300048927 Bacteria 3755
187 Ga0496124_0080970 3300048927 Bacteria 2670
188 Ga0496125_0002787 3300048928 Bacteria 22098
189 Ga0496125_0005900 3300048928 Bacteria 13426
190 Ga0496125_0008225 3300048928 Bacteria 10967
191 Ga0496125_0017331 3300048928 Bacteria 6875
192 Ga0496125_0019919 3300048928 Bacteria 6309
193 Ga0496125_0097852 3300048928 Bacteria 2172
194 Ga0496125_0109519 3300048928 Bacteria 2005
195 Ga0496125_0174752 3300048928 Bacteria 1439
196 Ga0496126_0003747 3300048929 Bacteria 18906
197 Ga0496126_0332633 3300048929 Bacteria 1246
198 Ga0501034_0000822 3300049571 Bacteria 46209
199 Ga0501034_0001322 3300049571 Bacteria 33524
200 Ga0501034_0009330 3300049571 Bacteria 10281
201 Ga0501265_002337 3300049762 Bacteria 2152
202 Ga0501275_000781 3300049772 Bacteria 3480
203 nmdc:mga00v17_1308_c1 3300050491 Bacteria 13041
204 nmdc:mga00v17_2953_c1 3300050491 Bacteria 8728
205 Ga0500634_0000101 3300053161 Bacteria 33679

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_10226284 Ga0207676_102262842 324
2 3300005466 Ga0070685_10026008 Ga0070685_100260082 348
3 3300048928 Ga0496125_0097852 Ga0496125_0097852_939_2039 360
4 3300041486 Ga0451807_0728605 Ga0451807_0728605_77_1204 371
5 iso_pu_bacteria 2547132130 2547500586 371
6 iso_pu_bacteria 2547132130 2547501563 371
7 iso_pu_bacteria 2571042365 2572253428 371
8 iso_pu_bacteria 2576861471 2578459021 371
9 iso_pu_bacteria 2643221573 2643879531 371
10 iso_pu_bacteria 2643221579 2643905682 371
11 iso_pu_bacteria 2643221695 2644528772 371
12 iso_pu_bacteria 2643221720 2644662858 371
13 iso_pu_bacteria 2643221728 2644698187 371
14 iso_pu_bacteria 2747842428 2747950043 371
15 iso_pu_bacteria 2747842501 2748015930 371
16 iso_pu_bacteria 2765235840 2765578354 371
17 iso_pu_bacteria 2816332141 2816516379 371
18 iso_pu_bacteria 2818991457 2819663633 371
19 iso_pu_bacteria 2842391507 2842392910 371
20 iso_pu_bacteria 2842757796 2842758693 371
21 iso_pu_bacteria 2852649853 2852651360 371
22 iso_pu_bacteria 2852684882 2852686327 371
23 iso_pu_bacteria 2857442823 2857446555 371
24 iso_pu_bacteria 2874220319 2874220980 371
25 iso_pu_bacteria 2894414249 2894415932 371
26 iso_pu_bacteria 2895498888 2895499233 371
27 iso_pu_bacteria 2895511927 2895512254 371
28 iso_pu_bacteria 2895522137 2895522264 371
29 iso_pu_bacteria 2895525241 2895527292 371
30 iso_pu_bacteria 2919089067 2919091189 371
31 iso_pu_bacteria 2919134579 2919136775 371
32 iso_pu_bacteria 2919513703 2919516679 371
33 iso_pu_bacteria 2919675420 2919677193 371
34 iso_pu_bacteria 2923516293 2923517784 371
35 iso_pu_bacteria 2928496128 2928497822 371
36 iso_pu_bacteria 2931380184 2931381376 371
37 iso_pu_bacteria 2937610967 2937611801 371
38 iso_pu_bacteria 2939589442 2939590488 371
39 iso_pu_bacteria 2939622612 2939622646 371
40 iso_pu_bacteria 2939626828 2939627740 371
41 iso_pu_bacteria 2941475908 2941477707 371
42 iso_pu_bacteria 2961047084 2961047745 371
43 iso_pu_bacteria 2961064222 2961067087 371
44 iso_pu_bacteria 2974307012 2974309469 371
45 iso_pu_bacteria 2977247770 2977250188 371
46 iso_pu_bacteria 2984514374 2984515320 371
47 iso_pu_bacteria 2987605356 2987608233 371
48 iso_pu_bacteria 8002869464 8002871654 371
49 iso_pu_bacteria 2842733646 2842736749 372
50 iso_pu_bacteria 2919130084 2919132444 372
51 iso_pu_bacteria 2929195423 2929197088 372
52 iso_pu_bacteria 2945972063 2945977192 372
53 iso_pu_bacteria 8021622325 8021624727 372
54 iso_pu_bacteria 8021626552 8021630382 372
55 iso_pu_bacteria 8021648035 8021648587 372
56 3300032005 Ga0307411_10123101 Ga0307411_101231013 373
57 3300005366 Ga0070659_100085409 Ga0070659_1000854092 374
58 3300038705 Ga0237819_00047 Ga0237819_00047_6320_7444 374
59 3300002773 JGI25152J39213_1000018 JGI25152J39213_100001898 375
60 3300002774 JGI25150J39212_1000578 JGI25150J39212_10005783 375
61 3300003187 JGI25151J46595_10000111 JGI25151J46595_1000011199 375
62 3300003215 JGI25153J46596_10000085 JGI25153J46596_100000853 375
63 3300003771 Ga0055526_1000036 Ga0055526_100003696 375
64 3300003771 Ga0055526_1000328 Ga0055526_100032825 375
65 3300003773 Ga0055537_1000083 Ga0055537_100008331 375
66 3300003773 Ga0055537_1000695 Ga0055537_100069512 375
67 3300003775 Ga0055524_1000359 Ga0055524_10003599 375
68 3300003781 Ga0055536_1000690 Ga0055536_100069010 375
69 3300003781 Ga0055536_1001443 Ga0055536_10014432 375
70 3300003781 Ga0055536_1001487 Ga0055536_10014871 375
71 3300003784 Ga0055534_1000089 Ga0055534_100008962 375
72 3300003784 Ga0055534_1000103 Ga0055534_100010332 375
73 3300003790 Ga0055528_1000004 Ga0055528_1000004241 375
74 3300003790 Ga0055528_1000585 Ga0055528_10005859 375
75 3300003791 Ga0055530_10000996 Ga0055530_100009967 375
76 3300003791 Ga0055530_10001891 Ga0055530_100018911 375
77 3300003794 Ga0055531_10017726 Ga0055531_100177262 375
78 3300003856 Ga0058692_1000002 Ga0058692_1000002346 375
79 3300003856 Ga0058692_1000020 Ga0058692_100002097 375
80 3300005347 Ga0070668_100008907 Ga0070668_1000089073 375
81 3300005347 Ga0070668_100016377 Ga0070668_1000163774 375
82 3300005530 Ga0070679_100035870 Ga0070679_1000358704 375
83 3300005543 Ga0070672_100098904 Ga0070672_1000989043 375
84 3300005578 Ga0068854_100201397 Ga0068854_1002013972 375
85 3300006038 Ga0075365_10008515 Ga0075365_100085154 375
86 3300006051 Ga0075364_10008033 Ga0075364_100080334 375
87 3300009011 Ga0105251_10003806 Ga0105251_100038062 375
88 3300009148 Ga0105243_10006355 Ga0105243_100063555 375
89 3300009148 Ga0105243_10020640 Ga0105243_100206402 375
90 3300013100 Ga0157373_10046551 Ga0157373_100465513 375
91 3300013100 Ga0157373_10051579 Ga0157373_100515792 375
92 3300013100 Ga0157373_10199434 Ga0157373_101994342 375
93 3300013102 Ga0157371_10001165 Ga0157371_1000116510 375
94 3300013102 Ga0157371_10007919 Ga0157371_100079192 375
95 3300013102 Ga0157371_10182389 Ga0157371_101823892 375
96 3300013105 Ga0157369_10031626 Ga0157369_100316264 375
97 3300014497 Ga0182008_10000727 Ga0182008_100007275 375
98 3300015261 Ga0182006_1003628 Ga0182006_10036286 375
99 3300015261 Ga0182006_1015091 Ga0182006_10150914 375
100 3300015262 Ga0182007_10000184 Ga0182007_1000018434 375
101 3300015265 Ga0182005_1002478 Ga0182005_10024782 375
102 3300015265 Ga0182005_1005941 Ga0182005_10059412 375
103 3300017792 Ga0163161_10030729 Ga0163161_100307293 375
104 3300017792 Ga0163161_10063958 Ga0163161_100639581 375
105 3300025245 Ga0207425_1000028 Ga0207425_1000028268 375
106 3300025245 Ga0207425_1003689 Ga0207425_10036896 375
107 3300025258 Ga0209129_1000065 Ga0209129_1000065216 375
108 3300025263 Ga0209565_1000001 Ga0209565_10000011541 375
109 3300025263 Ga0209565_1000014 Ga0209565_1000014369 375
110 3300025263 Ga0209565_1000081 Ga0209565_1000081122 375
111 3300025273 Ga0209673_1000001 Ga0209673_10000011541 375
112 3300025273 Ga0209673_1000904 Ga0209673_100090413 375
113 3300025291 Ga0209675_1000001 Ga0209675_1000001993 375
114 3300025291 Ga0209675_1000021 Ga0209675_1000021120 375
115 3300025292 Ga0209676_1000024 Ga0209676_1000024503 375
116 3300025292 Ga0209676_1000047 Ga0209676_1000047325 375
117 3300025292 Ga0209676_1000203 Ga0209676_1000203108 375
118 3300025292 Ga0209676_1001141 Ga0209676_100114112 375
119 3300025294 Ga0209025_1000002 Ga0209025_10000024 375
120 3300025294 Ga0209025_1000015 Ga0209025_1000015155 375
121 3300025295 Ga0209564_1000001 Ga0209564_10000011155 375
122 3300025295 Ga0209564_1000263 Ga0209564_1000263102 375
123 3300025297 Ga0209758_1000003 Ga0209758_100000311 375
124 3300025297 Ga0209758_1008172 Ga0209758_10081726 375
125 3300025298 Ga0209050_1000894 Ga0209050_10008942 375
126 3300025298 Ga0209050_1001262 Ga0209050_100126213 375
127 3300025298 Ga0209050_1013380 Ga0209050_10133804 375
128 3300025298 Ga0209050_1036998 Ga0209050_10369982 375
129 3300025299 Ga0209256_1000002 Ga0209256_1000002399 375
130 3300025299 Ga0209256_1012736 Ga0209256_10127362 375
131 3300025299 Ga0209256_1013844 Ga0209256_10138443 375
132 3300025303 Ga0209051_1026924 Ga0209051_10269243 375
133 3300025304 Ga0209257_1000180 Ga0209257_10001804 375
134 3300025304 Ga0209257_1000204 Ga0209257_1000204113 375
135 3300025304 Ga0209257_1003198 Ga0209257_10031982 375
136 3300025304 Ga0209257_1011237 Ga0209257_10112374 375
137 3300025926 Ga0207659_10109139 Ga0207659_101091392 375
138 3300025935 Ga0207709_10003032 Ga0207709_100030325 375
139 3300025935 Ga0207709_10010972 Ga0207709_100109726 375
140 3300025940 Ga0207691_10017313 Ga0207691_100173133 375
141 3300027312 Ga0209371_1000004 Ga0209371_1000004555 375
142 3300027312 Ga0209371_1000011 Ga0209371_1000011362 375
143 3300027543 Ga0209999_1002838 Ga0209999_10028382 375
144 3300027876 Ga0209974_10003051 Ga0209974_100030515 375
145 3300028379 Ga0268266_10096360 Ga0268266_100963603 375
146 3300030500 Ga0268256_1000005 Ga0268256_1000005491 375
147 3300030500 Ga0268256_1000011 Ga0268256_1000011362 375
148 3300031911 Ga0307412_10010252 Ga0307412_100102521 375
149 3300032004 Ga0307414_10005212 Ga0307414_100052124 375
150 3300032004 Ga0307414_10013474 Ga0307414_100134742 375
151 3300032004 Ga0307414_10036014 Ga0307414_100360143 375
152 3300032004 Ga0307414_10038331 Ga0307414_100383314 375
153 3300041404 Ga0439436_0021100 Ga0439436_0021100_141_1295 375
154 3300041404 Ga0439436_0040708 Ga0439436_0040708_66_1193 375
155 3300041406 Ga0439439_0021481 Ga0439439_0021481_443_1597 375
156 3300041407 Ga0439447_005122 Ga0439447_005122_22_1173 375
157 3300041413 Ga0439465_0003871 Ga0439465_0003871_2021_3163 375
158 3300041452 Ga0451793_0432264 Ga0451793_0432264_53_1180 375
159 3300041459 Ga0451800_0377454 Ga0451800_0377454_5841_6968 375
160 3300041494 Ga0451837_0261469 Ga0451837_0261469_51_1184 375
161 3300041509 Ga0451843_1069758 Ga0451843_1069758_62_1195 375
162 3300042004 Ga0439445_0007911 Ga0439445_0007911_702_1835 375
163 3300042006 Ga0439432_007758 Ga0439432_007758_41_1186 375
164 3300042006 Ga0439432_042215 Ga0439432_042215_16_1158 375
165 3300042007 Ga0439449_0001611 Ga0439449_0001611_3792_4943 375
166 3300042007 Ga0439449_0006137 Ga0439449_0006137_854_1981 375
167 3300042876 Ga0451577_0165749 Ga0451577_0165749_524_1657 375
168 3300044712 Ga0453684_0176631 Ga0453684_0176631_840_1973 375
169 3300046453 Ga0495627_009698 Ga0495627_009698_933_2060 375
170 3300046460 Ga0495638_0002377 Ga0495638_0002377_2647_3774 375
171 3300046460 Ga0495638_0031640 Ga0495638_0031640_285_1412 375
172 3300046501 Ga0495607_0012851 Ga0495607_0012851_1772_2914 375
173 3300046512 Ga0495610_0061048 Ga0495610_0061048_440_1567 375
174 3300046518 Ga0495631_0013112 Ga0495631_0013112_2607_3734 375
175 3300046522 Ga0495643_0002788 Ga0495643_0002788_2643_3770 375
176 3300046525 Ga0495663_0003133 Ga0495663_0003133_470_1597 375
177 3300046558 Ga0495633_0004720 Ga0495633_0004720_4358_5485 375
178 3300046615 Ga0495656_0029373 Ga0495656_0029373_736_1887 375
179 3300046616 Ga0495668_0007213 Ga0495668_0007213_1797_2951 375
180 3300046810 Ga0495660_0008944 Ga0495660_0008944_1019_2146 375
181 3300047318 Ga0495636_0002105 Ga0495636_0002105_4641_5783 375
182 3300047318 Ga0495636_0011101 Ga0495636_0011101_2416_3543 375
183 3300047318 Ga0495636_0012196 Ga0495636_0012196_2252_3379 375
184 3300047320 Ga0495672_0000308 Ga0495672_0000308_24139_25266 375
185 3300048908 Ga0496105_0287849 Ga0496105_0287849_100_1227 375
186 3300048910 Ga0496107_0197547 Ga0496107_0197547_215_1342 375
187 3300048914 Ga0496111_0031975 Ga0496111_0031975_2247_3374 375
188 3300048917 Ga0496114_0087877 Ga0496114_0087877_646_1788 375
189 3300048919 Ga0496116_0003743 Ga0496116_0003743_4083_5210 375
190 3300048919 Ga0496116_0092495 Ga0496116_0092495_132_1259 375
191 3300048920 Ga0496117_0001552 Ga0496117_0001552_19260_20387 375
192 3300048920 Ga0496117_0003973 Ga0496117_0003973_4241_5368 375
193 3300048920 Ga0496117_0004978 Ga0496117_0004978_3396_4523 375
194 3300048920 Ga0496117_0059077 Ga0496117_0059077_239_1366 375
195 3300048920 Ga0496117_0173180 Ga0496117_0173180_49_1176 375
196 3300048921 Ga0496118_0000681 Ga0496118_0000681_41831_42958 375
197 3300048921 Ga0496118_0004401 Ga0496118_0004401_11367_12494 375
198 3300048921 Ga0496118_0005500 Ga0496118_0005500_4365_5564 375
199 3300048921 Ga0496118_0015060 Ga0496118_0015060_3950_5077 375
200 3300048921 Ga0496118_0045909 Ga0496118_0045909_1313_2440 375
201 3300048921 Ga0496118_0123136 Ga0496118_0123136_514_1647 375
202 3300048922 Ga0496119_0000902 Ga0496119_0000902_20872_21999 375
203 3300048922 Ga0496119_0062318 Ga0496119_0062318_1080_2207 375
204 3300048923 Ga0496120_0000605 Ga0496120_0000605_42620_43747 375
205 3300048924 Ga0496121_0007368 Ga0496121_0007368_922_2049 375
206 3300048924 Ga0496121_0138566 Ga0496121_0138566_164_1291 375
207 3300048924 Ga0496121_0165765 Ga0496121_0165765_437_1564 375
208 3300048925 Ga0496122_0000220 Ga0496122_0000220_125060_126187 375
209 3300048925 Ga0496122_0007784 Ga0496122_0007784_1446_2573 375
210 3300048925 Ga0496122_0016260 Ga0496122_0016260_4149_5276 375
211 3300048925 Ga0496122_0016396 Ga0496122_0016396_4149_5276 375
212 3300048925 Ga0496122_0021689 Ga0496122_0021689_3968_5095 375
213 3300048926 Ga0496123_0000151 Ga0496123_0000151_868_1995 375
214 3300048926 Ga0496123_0009240 Ga0496123_0009240_5123_6250 375
215 3300048926 Ga0496123_0013874 Ga0496123_0013874_847_1974 375
216 3300048926 Ga0496123_0029024 Ga0496123_0029024_1573_2700 375
217 3300048926 Ga0496123_0037288 Ga0496123_0037288_630_1757 375
218 3300048927 Ga0496124_0000032 Ga0496124_0000032_244369_245496 375
219 3300048927 Ga0496124_0005178 Ga0496124_0005178_612_1742 375
220 3300048927 Ga0496124_0007797 Ga0496124_0007797_2450_3577 375
221 3300048927 Ga0496124_0029605 Ga0496124_0029605_2223_3350 375
222 3300048927 Ga0496124_0044109 Ga0496124_0044109_1834_2961 375
223 3300048927 Ga0496124_0045657 Ga0496124_0045657_501_1628 375
224 3300048927 Ga0496124_0080970 Ga0496124_0080970_1202_2329 375
225 3300048928 Ga0496125_0002787 Ga0496125_0002787_16704_17831 375
226 3300048928 Ga0496125_0005900 Ga0496125_0005900_3562_4689 375
227 3300048928 Ga0496125_0008225 Ga0496125_0008225_849_1976 375
228 3300048928 Ga0496125_0017331 Ga0496125_0017331_4089_5216 375
229 3300048928 Ga0496125_0019919 Ga0496125_0019919_277_1404 375
230 3300048928 Ga0496125_0109519 Ga0496125_0109519_733_1860 375
231 3300048928 Ga0496125_0174752 Ga0496125_0174752_268_1395 375
232 3300048929 Ga0496126_0003747 Ga0496126_0003747_7128_8255 375
233 3300048929 Ga0496126_0332633 Ga0496126_0332633_29_1156 375
234 3300049571 Ga0501034_0000822 Ga0501034_0000822_38678_39805 375
235 3300049571 Ga0501034_0001322 Ga0501034_0001322_25161_26303 375
236 3300049571 Ga0501034_0009330 Ga0501034_0009330_9000_10127 375
237 3300049762 Ga0501265_002337 Ga0501265_002337_364_1512 375
238 3300049772 Ga0501275_000781 Ga0501275_000781_424_1572 375
239 3300050491 nmdc:mga00v17_1308_c1 nmdc:mga00v17_1308_c1_10004_11134 375
240 3300050491 nmdc:mga00v17_2953_c1 nmdc:mga00v17_2953_c1_6465_7601 375
241 3300053161 Ga0500634_0000101 Ga0500634_0000101_26925_28052 375
242 iso_pu_bacteria 2643221559 2643819013 375
243 iso_pu_bacteria 2643221586 2643941318 375
244 iso_pu_bacteria 2643221593 2643974418 375
245 iso_pu_bacteria 2643221612 2644080437 375
246 iso_pu_bacteria 2643221727 2644697050 375
247 iso_pu_bacteria 2842780639 2842783541 375
248 2162886007 SwRhRL2b_contig_45537 SwRhRL2b_1000.00005440 376
249 3300005289 Ga0065704_10077265 Ga0065704_100772652 376
250 3300005331 Ga0070670_100002284 Ga0070670_1000022842 376
251 3300005530 Ga0070679_100060663 Ga0070679_1000606633 376
252 3300009011 Ga0105251_10000010 Ga0105251_10000010123 376
253 3300014497 Ga0182008_10000136 Ga0182008_100001363 376
254 3300025735 Ga0207713_1000292 Ga0207713_100029246 376
255 3300025921 Ga0207652_10078118 Ga0207652_100781182 376
256 3300025925 Ga0207650_10017366 Ga0207650_100173662 376
257 3300048920 Ga0496117_0000921 Ga0496117_0000921_30856_31986 376
258 3300048922 Ga0496119_0000320 Ga0496119_0000320_35375_36505 376
259 3300048923 Ga0496120_0000424 Ga0496120_0000424_35466_36596 376
260 3300048925 Ga0496122_0000680 Ga0496122_0000680_30844_31974 376
261 3300048926 Ga0496123_0000226 Ga0496123_0000226_30904_32034 376
262 3300048927 Ga0496124_0000705 Ga0496124_0000705_22761_23891 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

182

290

0.98

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

69

379

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h2k-assembly1.cif.gz_A crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.9429 3 375
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.9417 3 376
7lgp-assembly1.cif.gz_A dape enzyme from shigella flexneri 0.9359 1 376
7lgp-assembly1.cif.gz_A dape enzyme from shigella flexneri 0.9335 1 376
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.9274 3 376
ID Description Score Start End Superfamily
1vgyB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9291 1 375 3.40.630.10
1vgyB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9222 1 375 3.40.630.10
af_P0AED7_3_244_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.901 3 245 3.40.630.10
af_P0AED7_3_244_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8941 3 245 3.40.630.10
af_Q18621_173_267_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8775 185 282 3.30.70.360
ID Description Score Start End GO Terms
AF-Q12C18-F1-model_v4 Succinyl-diaminopimelate desuccinylase (SDAP desuccinylase) (EC 3.5.1.18) (N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase) 0.9329 1 374 GO:0006526
GO:0008270
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0050897
AF-Q12C18-F1-model_v4 Succinyl-diaminopimelate desuccinylase (SDAP desuccinylase) (EC 3.5.1.18) (N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase) 0.9257 1 374 GO:0006526
GO:0008270
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0050897
AF-A0A3T0L106-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9242 4 372 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0046872
AF-Q470C3-F1-model_v4 Succinyl-diaminopimelate desuccinylase (SDAP desuccinylase) (EC 3.5.1.18) (N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase) 0.9206 1 376 GO:0006526
GO:0008270
GO:0008777
GO:0009014
GO:0009089
GO:0019877
GO:0050897
AF-A0A154UBX6-F1-model_v4 deleted 0.9205 1 376

Feature Viewer

pLDDT pTM Quality
91.25 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map