F371035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 262 | 143 | 262 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10540138|Ga0111539_105401382 |
| Length | 223 |
| Sequence | MKKDNDIQYTVMKITTCIKHVLSAFFLFISVCSSCQRTESNIEADTTVDATKVLIVYLSRTNNTKTIAEIIHRNVGGTLVALELEKPYPENYMATVQQVVRENETGYLPPLKTKIDSIQNYDMVFVGFPTWGMKLPPPMKSFLKQYDLSGKTIVPFNTNDGYGIGSSFETVKELCLNSKIMEGFTTRGGVDKDGKAFLTKDENRKEAEKKVKQWLEKIKLTKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 3 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 125 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 126 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 127 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 128 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 129 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 140 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 141 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.91 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 97.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c002505 | 3300000043 | Unclassified | 1904 |
| 2 | Ga0055536_1000012 | 3300003781 | Bacteria | 263217 |
| 3 | Ga0055530_10002752 | 3300003791 | Bacteria | 10879 |
| 4 | Ga0065712_10007304 | 3300005290 | Bacteria | 4331 |
| 5 | Ga0065712_10073039 | 3300005290 | Bacteria | 4516 |
| 6 | Ga0065712_10097184 | 3300005290 | Unclassified | 2133 |
| 7 | Ga0065712_10141896 | 3300005290 | Unclassified | 1424 |
| 8 | Ga0065707_10122890 | 3300005295 | Unclassified | 2046 |
| 9 | Ga0070676_10033642 | 3300005328 | Unclassified | 2941 |
| 10 | Ga0070676_10382259 | 3300005328 | Bacteria | 975 |
| 11 | Ga0070683_100096553 | 3300005329 | Bacteria | 2780 |
| 12 | Ga0070683_100114140 | 3300005329 | Bacteria | 2550 |
| 13 | Ga0070690_100015222 | 3300005330 | Bacteria | 4584 |
| 14 | Ga0068869_100002274 | 3300005334 | Bacteria | 11565 |
| 15 | Ga0068869_100119684 | 3300005334 | Bacteria | 2012 |
| 16 | Ga0068869_100319549 | 3300005334 | Bacteria | 1259 |
| 17 | Ga0068869_101023032 | 3300005334 | Bacteria | 720 |
| 18 | Ga0070666_10027939 | 3300005335 | Bacteria | 3699 |
| 19 | Ga0070666_10087124 | 3300005335 | Unclassified | 2140 |
| 20 | Ga0068868_100515267 | 3300005338 | Bacteria | 1049 |
| 21 | Ga0070689_100002991 | 3300005340 | Bacteria | 11115 |
| 22 | Ga0070689_100087995 | 3300005340 | Bacteria | 2444 |
| 23 | Ga0070689_100178657 | 3300005340 | Bacteria | 1723 |
| 24 | Ga0070661_100111150 | 3300005344 | Unclassified | 2046 |
| 25 | Ga0070661_100298821 | 3300005344 | Unclassified | 1253 |
| 26 | Ga0070669_100004917 | 3300005353 | Bacteria | 9652 |
| 27 | Ga0070669_100047501 | 3300005353 | Bacteria | 3131 |
| 28 | Ga0070669_100249706 | 3300005353 | Bacteria | 1412 |
| 29 | Ga0070675_100002773 | 3300005354 | Bacteria | 13182 |
| 30 | Ga0070675_100457646 | 3300005354 | Bacteria | 1145 |
| 31 | Ga0070671_100144481 | 3300005355 | Unclassified | 2008 |
| 32 | Ga0070674_100066847 | 3300005356 | Bacteria | 2527 |
| 33 | Ga0070673_100049843 | 3300005364 | Bacteria | 3271 |
| 34 | Ga0070673_100093956 | 3300005364 | Bacteria | 2457 |
| 35 | Ga0070673_100262023 | 3300005364 | Unclassified | 1510 |
| 36 | Ga0070688_100002642 | 3300005365 | Bacteria | 9093 |
| 37 | Ga0070688_100017614 | 3300005365 | Bacteria | 4103 |
| 38 | Ga0070688_100157529 | 3300005365 | Bacteria | 1558 |
| 39 | Ga0070659_100283260 | 3300005366 | Bacteria | 1379 |
| 40 | Ga0070667_100291532 | 3300005367 | Bacteria | 1467 |
| 41 | Ga0070700_100195124 | 3300005441 | Unclassified | 1418 |
| 42 | Ga0070700_100620698 | 3300005441 | Bacteria | 850 |
| 43 | Ga0070678_100046760 | 3300005456 | Bacteria | 3105 |
| 44 | Ga0070662_100020521 | 3300005457 | Bacteria | 4499 |
| 45 | Ga0070662_100037763 | 3300005457 | Bacteria | 3426 |
| 46 | Ga0070662_100052822 | 3300005457 | Bacteria | 2940 |
| 47 | Ga0070662_100148556 | 3300005457 | Unclassified | 1822 |
| 48 | Ga0068867_100030739 | 3300005459 | Bacteria | 3874 |
| 49 | Ga0068867_100062230 | 3300005459 | Bacteria | 2772 |
| 50 | Ga0070685_10071894 | 3300005466 | Bacteria | 2052 |
| 51 | Ga0070685_10080859 | 3300005466 | Unclassified | 1948 |
| 52 | Ga0070684_100325530 | 3300005535 | Bacteria | 1412 |
| 53 | Ga0070684_100357006 | 3300005535 | Bacteria | 1345 |
| 54 | Ga0070672_100250456 | 3300005543 | Bacteria | 1492 |
| 55 | Ga0070686_100250254 | 3300005544 | Unclassified | 1294 |
| 56 | Ga0070686_100302672 | 3300005544 | Unclassified | 1186 |
| 57 | Ga0070693_100029513 | 3300005547 | Bacteria | 2992 |
| 58 | Ga0070665_100252631 | 3300005548 | Bacteria | 1764 |
| 59 | Ga0070664_100205252 | 3300005564 | Unclassified | 1760 |
| 60 | Ga0070664_100259107 | 3300005564 | Bacteria | 1565 |
| 61 | Ga0070664_100851538 | 3300005564 | Unclassified | 854 |
| 62 | Ga0068857_100164555 | 3300005577 | Bacteria | 2014 |
| 63 | Ga0068857_100274568 | 3300005577 | Bacteria | 1550 |
| 64 | Ga0068854_100311382 | 3300005578 | Unclassified | 1277 |
| 65 | Ga0068854_100600913 | 3300005578 | Unclassified | 939 |
| 66 | Ga0068852_100225277 | 3300005616 | Bacteria | 1785 |
| 67 | Ga0068852_100264458 | 3300005616 | Unclassified | 1653 |
| 68 | Ga0068859_100009409 | 3300005617 | Bacteria | 9870 |
| 69 | Ga0068859_100014604 | 3300005617 | Bacteria | 7888 |
| 70 | Ga0068859_100329252 | 3300005617 | Bacteria | 1622 |
| 71 | Ga0068864_100004501 | 3300005618 | Bacteria | 11462 |
| 72 | Ga0068864_100401274 | 3300005618 | Bacteria | 1303 |
| 73 | Ga0068861_100052042 | 3300005719 | Bacteria | 3111 |
| 74 | Ga0068870_10130473 | 3300005840 | Bacteria | 1459 |
| 75 | Ga0068858_100103156 | 3300005842 | Unclassified | 2660 |
| 76 | Ga0068858_100490613 | 3300005842 | Bacteria | 1186 |
| 77 | Ga0068860_100188994 | 3300005843 | Unclassified | 1993 |
| 78 | Ga0068860_100412914 | 3300005843 | Unclassified | 1337 |
| 79 | Ga0068860_100928505 | 3300005843 | Bacteria | 887 |
| 80 | Ga0068862_100464537 | 3300005844 | Bacteria | 1195 |
| 81 | Ga0070715_10159487 | 3300006163 | Unclassified | 1113 |
| 82 | Ga0097621_100040438 | 3300006237 | Bacteria | 3749 |
| 83 | Ga0068871_100049744 | 3300006358 | Bacteria | 3389 |
| 84 | Ga0068871_100870965 | 3300006358 | Unclassified | 833 |
| 85 | Ga0075428_100054272 | 3300006844 | Bacteria | 4392 |
| 86 | Ga0075428_100062436 | 3300006844 | Bacteria | 4079 |
| 87 | Ga0075428_100324219 | 3300006844 | Unclassified | 1655 |
| 88 | Ga0075434_100396622 | 3300006871 | Bacteria | 1401 |
| 89 | Ga0075429_100043405 | 3300006880 | Bacteria | 3913 |
| 90 | Ga0075429_100480755 | 3300006880 | Bacteria | 1088 |
| 91 | Ga0097620_100009409 | 3300006931 | Bacteria | 9870 |
| 92 | Ga0097620_100014602 | 3300006931 | Bacteria | 7888 |
| 93 | Ga0097620_100329225 | 3300006931 | Bacteria | 1622 |
| 94 | Ga0105244_10000004 | 3300009036 | Bacteria | 492478 |
| 95 | Ga0111539_10039605 | 3300009094 | Bacteria | 5678 |
| 96 | Ga0111539_10060617 | 3300009094 | Unclassified | 4484 |
| 97 | Ga0111539_10540138 | 3300009094 | Unclassified | 1358 |
| 98 | Ga0105241_10142814 | 3300009174 | Bacteria | 1951 |
| 99 | Ga0105242_10004134 | 3300009176 | Bacteria | 11294 |
| 100 | Ga0105242_10063643 | 3300009176 | Bacteria | 3038 |
| 101 | Ga0105242_10495560 | 3300009176 | Unclassified | 1161 |
| 102 | Ga0105242_10986871 | 3300009176 | Unclassified | 849 |
| 103 | Ga0105242_11839776 | 3300009176 | Unclassified | 645 |
| 104 | Ga0105248_10228604 | 3300009177 | Unclassified | 2094 |
| 105 | Ga0105237_10000113 | 3300009545 | Bacteria | 114034 |
| 106 | Ga0105237_10086918 | 3300009545 | Bacteria | 3117 |
| 107 | Ga0105249_10456929 | 3300009553 | Bacteria | 1317 |
| 108 | Ga0105239_10277120 | 3300010375 | Unclassified | 1887 |
| 109 | Ga0105239_10487317 | 3300010375 | Bacteria | 1401 |
| 110 | Ga0105246_10062087 | 3300011119 | Bacteria | 2602 |
| 111 | Ga0157370_10217850 | 3300013104 | Bacteria | 1768 |
| 112 | Ga0157374_10000955 | 3300013296 | Bacteria | 25080 |
| 113 | Ga0157374_10034553 | 3300013296 | Bacteria | 4619 |
| 114 | Ga0157374_10072746 | 3300013296 | Bacteria | 3244 |
| 115 | Ga0157378_10015370 | 3300013297 | Bacteria | 6702 |
| 116 | Ga0157378_10075376 | 3300013297 | Bacteria | 3037 |
| 117 | Ga0157378_11226040 | 3300013297 | Unclassified | 790 |
| 118 | Ga0163162_10090745 | 3300013306 | Bacteria | 3137 |
| 119 | Ga0163162_10162439 | 3300013306 | Bacteria | 2356 |
| 120 | Ga0163162_10287125 | 3300013306 | Bacteria | 1777 |
| 121 | Ga0163162_10303015 | 3300013306 | Bacteria | 1730 |
| 122 | Ga0163162_10471422 | 3300013306 | Bacteria | 1387 |
| 123 | Ga0157372_10241969 | 3300013307 | Bacteria | 2094 |
| 124 | Ga0157372_10243075 | 3300013307 | Bacteria | 2089 |
| 125 | Ga0157375_10003853 | 3300013308 | Bacteria | 13019 |
| 126 | Ga0157375_10010304 | 3300013308 | Bacteria | 8227 |
| 127 | Ga0157375_10077909 | 3300013308 | Bacteria | 3346 |
| 128 | Ga0157375_10175632 | 3300013308 | Bacteria | 2291 |
| 129 | Ga0157375_10290249 | 3300013308 | Bacteria | 1799 |
| 130 | Ga0157375_10387378 | 3300013308 | Bacteria | 1564 |
| 131 | Ga0163163_10000075 | 3300014325 | Bacteria | 109545 |
| 132 | Ga0163163_10145136 | 3300014325 | Unclassified | 2417 |
| 133 | Ga0163163_10718365 | 3300014325 | Bacteria | 1063 |
| 134 | Ga0157380_10014300 | 3300014326 | Bacteria | 5805 |
| 135 | Ga0157380_10044739 | 3300014326 | Bacteria | 3470 |
| 136 | Ga0157380_10186590 | 3300014326 | Bacteria | 1827 |
| 137 | Ga0157380_10355676 | 3300014326 | Bacteria | 1372 |
| 138 | Ga0157380_10370262 | 3300014326 | Bacteria | 1348 |
| 139 | Ga0157380_10656513 | 3300014326 | Unclassified | 1047 |
| 140 | Ga0157377_10002046 | 3300014745 | Bacteria | 8847 |
| 141 | Ga0157377_10009980 | 3300014745 | Bacteria | 4684 |
| 142 | Ga0157377_10018730 | 3300014745 | Bacteria | 3604 |
| 143 | Ga0157377_10062067 | 3300014745 | Unclassified | 2137 |
| 144 | Ga0157379_10126454 | 3300014968 | Unclassified | 2300 |
| 145 | Ga0157379_11509110 | 3300014968 | Bacteria | 654 |
| 146 | Ga0157376_10003083 | 3300014969 | Bacteria | 11443 |
| 147 | Ga0157376_10906222 | 3300014969 | Bacteria | 900 |
| 148 | Ga0163161_10005489 | 3300017792 | Bacteria | 8793 |
| 149 | Ga0163161_10110317 | 3300017792 | Unclassified | 2056 |
| 150 | Ga0163161_10132310 | 3300017792 | Bacteria | 1883 |
| 151 | Ga0163161_10196173 | 3300017792 | Unclassified | 1554 |
| 152 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 153 | Ga0209050_1000018 | 3300025298 | Bacteria | 723263 |
| 154 | Ga0207697_10054014 | 3300025315 | Bacteria | 1664 |
| 155 | Ga0207655_1000008 | 3300025728 | Bacteria | 734289 |
| 156 | Ga0207680_10082944 | 3300025903 | Unclassified | 2019 |
| 157 | Ga0207647_10193187 | 3300025904 | Bacteria | 1179 |
| 158 | Ga0207645_10010286 | 3300025907 | Bacteria | 6426 |
| 159 | Ga0207645_10042973 | 3300025907 | Unclassified | 2892 |
| 160 | Ga0207643_10100454 | 3300025908 | Unclassified | 1696 |
| 161 | Ga0207654_10727679 | 3300025911 | Bacteria | 714 |
| 162 | Ga0207695_10720127 | 3300025913 | Bacteria | 878 |
| 163 | Ga0207671_10002020 | 3300025914 | Bacteria | 22320 |
| 164 | Ga0207662_10232713 | 3300025918 | Unclassified | 1204 |
| 165 | Ga0207649_10077583 | 3300025920 | Bacteria | 2141 |
| 166 | Ga0207649_10554681 | 3300025920 | Unclassified | 879 |
| 167 | Ga0207646_10213058 | 3300025922 | Unclassified | 1745 |
| 168 | Ga0207681_10005212 | 3300025923 | Bacteria | 7981 |
| 169 | Ga0207650_10413883 | 3300025925 | Bacteria | 1117 |
| 170 | Ga0207659_10011304 | 3300025926 | Bacteria | 5638 |
| 171 | Ga0207659_10164219 | 3300025926 | Bacteria | 1746 |
| 172 | Ga0207659_10405727 | 3300025926 | Bacteria | 1141 |
| 173 | Ga0207690_10308191 | 3300025932 | Bacteria | 1241 |
| 174 | Ga0207706_10008620 | 3300025933 | Bacteria | 9397 |
| 175 | Ga0207706_10016444 | 3300025933 | Bacteria | 6679 |
| 176 | Ga0207686_10286595 | 3300025934 | Bacteria | 1218 |
| 177 | Ga0207686_10689029 | 3300025934 | Unclassified | 811 |
| 178 | Ga0207670_10005318 | 3300025936 | Bacteria | 7053 |
| 179 | Ga0207670_10038597 | 3300025936 | Bacteria | 3121 |
| 180 | Ga0207670_10112283 | 3300025936 | Bacteria | 1966 |
| 181 | Ga0207670_10430373 | 3300025936 | Unclassified | 1060 |
| 182 | Ga0207669_10080349 | 3300025937 | Unclassified | 2085 |
| 183 | Ga0207669_10465852 | 3300025937 | Unclassified | 1004 |
| 184 | Ga0207704_10278683 | 3300025938 | Unclassified | 1270 |
| 185 | Ga0207704_10699882 | 3300025938 | Bacteria | 839 |
| 186 | Ga0207691_10017098 | 3300025940 | Bacteria | 6881 |
| 187 | Ga0207691_10148906 | 3300025940 | Unclassified | 2059 |
| 188 | Ga0207691_10248752 | 3300025940 | Bacteria | 1535 |
| 189 | Ga0207689_10040266 | 3300025942 | Bacteria | 3868 |
| 190 | Ga0207689_10045663 | 3300025942 | Bacteria | 3621 |
| 191 | Ga0207689_10092589 | 3300025942 | Unclassified | 2483 |
| 192 | Ga0207689_10199558 | 3300025942 | Bacteria | 1651 |
| 193 | Ga0207689_10898279 | 3300025942 | Bacteria | 747 |
| 194 | Ga0207679_10154902 | 3300025945 | Bacteria | 1870 |
| 195 | Ga0207679_10232110 | 3300025945 | Unclassified | 1558 |
| 196 | Ga0207667_10895545 | 3300025949 | Bacteria | 879 |
| 197 | Ga0207651_10011171 | 3300025960 | Bacteria | 5013 |
| 198 | Ga0207651_10055626 | 3300025960 | Bacteria | 2719 |
| 199 | Ga0207651_10097049 | 3300025960 | Bacteria | 2175 |
| 200 | Ga0207712_10239622 | 3300025961 | Bacteria | 1460 |
| 201 | Ga0207712_10495870 | 3300025961 | Unclassified | 1043 |
| 202 | Ga0207668_11079060 | 3300025972 | Bacteria | 719 |
| 203 | Ga0207640_10062104 | 3300025981 | Bacteria | 2477 |
| 204 | Ga0207677_10093677 | 3300026023 | Bacteria | 2191 |
| 205 | Ga0207639_10103291 | 3300026041 | Unclassified | 2309 |
| 206 | Ga0207678_10371727 | 3300026067 | Bacteria | 1235 |
| 207 | Ga0207708_10223162 | 3300026075 | Unclassified | 1510 |
| 208 | Ga0207708_10272857 | 3300026075 | Unclassified | 1368 |
| 209 | Ga0207702_10462889 | 3300026078 | Bacteria | 1232 |
| 210 | Ga0207641_10557738 | 3300026088 | Bacteria | 1118 |
| 211 | Ga0207648_10031067 | 3300026089 | Bacteria | 4724 |
| 212 | Ga0207648_10272395 | 3300026089 | Bacteria | 1512 |
| 213 | Ga0207648_10711372 | 3300026089 | Bacteria | 931 |
| 214 | Ga0207676_10001466 | 3300026095 | Bacteria | 17524 |
| 215 | Ga0207676_10286393 | 3300026095 | Bacteria | 1498 |
| 216 | Ga0207674_10275478 | 3300026116 | Bacteria | 1630 |
| 217 | Ga0207674_10402778 | 3300026116 | Bacteria | 1322 |
| 218 | Ga0207675_100017188 | 3300026118 | Bacteria | 6756 |
| 219 | Ga0207675_100499146 | 3300026118 | Bacteria | 1211 |
| 220 | Ga0207683_10249750 | 3300026121 | Bacteria | 1619 |
| 221 | Ga0207683_10682337 | 3300026121 | Bacteria | 952 |
| 222 | Ga0207698_10133521 | 3300026142 | Bacteria | 2125 |
| 223 | Ga0207428_10050505 | 3300027907 | Bacteria | 3327 |
| 224 | Ga0268266_10116866 | 3300028379 | Bacteria | 2370 |
| 225 | Ga0268266_10231482 | 3300028379 | Bacteria | 1702 |
| 226 | Ga0268265_10004707 | 3300028380 | Bacteria | 9419 |
| 227 | Ga0268265_10174994 | 3300028380 | Unclassified | 1838 |
| 228 | Ga0268265_10509682 | 3300028380 | Bacteria | 1135 |
| 229 | Ga0268265_10520103 | 3300028380 | Unclassified | 1125 |
| 230 | Ga0268264_10146374 | 3300028381 | Unclassified | 2113 |
| 231 | Ga0307515_10000479 | 3300028794 | Bacteria | 95197 |
| 232 | Ga0307413_10427741 | 3300031824 | Bacteria | 1045 |
| 233 | Ga0307414_10042047 | 3300032004 | Unclassified | 3102 |
| 234 | Ga0307414_10280770 | 3300032004 | Bacteria | 1399 |
| 235 | Ga0307414_10471950 | 3300032004 | Bacteria | 1105 |
| 236 | Ga0373933_0239517 | 3300035724 | Bacteria | 1167 |
| 237 | Ga0373947_0521861 | 3300035725 | Unclassified | 808 |
| 238 | Ga0373937_0123782 | 3300036401 | Bacteria | 2411 |
| 239 | Ga0395905_0530292 | 3300037471 | Bacteria | 1078 |
| 240 | Ga0439435_0157751 | 3300042436 | Bacteria | 731 |
| 241 | Ga0451577_0019948 | 3300042876 | Bacteria | 6158 |
| 242 | Ga0453684_0013408 | 3300044712 | Bacteria | 13313 |
| 243 | Ga0451576_0481151 | 3300045051 | Unclassified | 1304 |
| 244 | Ga0495627_022531 | 3300046453 | Bacteria | 2072 |
| 245 | Ga0495650_0168013 | 3300046471 | Bacteria | 778 |
| 246 | Ga0495606_0000919 | 3300046507 | Bacteria | 43453 |
| 247 | Ga0495630_0566426 | 3300046517 | Bacteria | 871 |
| 248 | Ga0495598_0219412 | 3300046537 | Unclassified | 694 |
| 249 | Ga0495621_0269848 | 3300046539 | Bacteria | 699 |
| 250 | Ga0495633_0000199 | 3300046558 | Bacteria | 76789 |
| 251 | Ga0495669_0210331 | 3300046684 | Bacteria | 931 |
| 252 | Ga0495670_0156548 | 3300046691 | Unclassified | 1196 |
| 253 | Ga0495660_0005922 | 3300046810 | Bacteria | 7284 |
| 254 | Ga0501250_020207 | 3300049680 | Bacteria | 857 |
| 255 | Ga0501271_038233 | 3300049768 | Bacteria | 617 |
| 256 | nmdc:mga09592_115407_c1 | 3300050508 | Unclassified | 2305 |
| 257 | nmdc:mga09592_383035_c1 | 3300050508 | Unclassified | 1216 |
| 258 | nmdc:mga09592_3957_c1 | 3300050508 | Bacteria | 11937 |
| 259 | nmdc:mga08y16_109275_c1 | 3300050511 | Unclassified | 2879 |
| 260 | nmdc:mga08y16_228928_c1 | 3300050511 | Unclassified | 1923 |
| 261 | nmdc:mga08y16_815266_c1 | 3300050511 | Bacteria | 925 |
| 262 | Ga0500642_0123839 | 3300053130 | Bacteria | 1210 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_11509110 | Ga0157379_115091101 | 177 |
| 2 | 3300005365 | Ga0070688_100002642 | Ga0070688_1000026423 | 181 |
| 3 | 3300014745 | Ga0157377_10009980 | Ga0157377_100099803 | 181 |
| 4 | 3300025908 | Ga0207643_10100454 | Ga0207643_101004543 | 181 |
| 5 | 3300025926 | Ga0207659_10164219 | Ga0207659_101642193 | 181 |
| 6 | 3300046471 | Ga0495650_0168013 | Ga0495650_0168013_50_601 | 182 |
| 7 | 3300046453 | Ga0495627_022531 | Ga0495627_022531_1101_1661 | 184 |
| 8 | 3300046558 | Ga0495633_0000199 | Ga0495633_0000199_46074_46634 | 184 |
| 9 | 3300005344 | Ga0070661_100111150 | Ga0070661_1001111502 | 185 |
| 10 | 3300005364 | Ga0070673_100262023 | Ga0070673_1002620233 | 185 |
| 11 | 3300005544 | Ga0070686_100302672 | Ga0070686_1003026721 | 185 |
| 12 | 3300005578 | Ga0068854_100311382 | Ga0068854_1003113823 | 185 |
| 13 | 3300009176 | Ga0105242_11839776 | Ga0105242_118397761 | 185 |
| 14 | 3300026118 | Ga0207675_100499146 | Ga0207675_1004991462 | 185 |
| 15 | 3300005340 | Ga0070689_100087995 | Ga0070689_1000879952 | 186 |
| 16 | 3300005441 | Ga0070700_100620698 | Ga0070700_1006206981 | 186 |
| 17 | 3300005457 | Ga0070662_100037763 | Ga0070662_1000377633 | 186 |
| 18 | 3300005535 | Ga0070684_100357006 | Ga0070684_1003570061 | 186 |
| 19 | 3300005543 | Ga0070672_100250456 | Ga0070672_1002504562 | 186 |
| 20 | 3300013296 | Ga0157374_10000955 | Ga0157374_1000095525 | 186 |
| 21 | 3300013306 | Ga0163162_10162439 | Ga0163162_101624393 | 186 |
| 22 | 3300013308 | Ga0157375_10003853 | Ga0157375_100038535 | 186 |
| 23 | 3300014325 | Ga0163163_10000075 | Ga0163163_1000007556 | 186 |
| 24 | 3300025926 | Ga0207659_10405727 | Ga0207659_104057272 | 186 |
| 25 | 3300025936 | Ga0207670_10038597 | Ga0207670_100385973 | 186 |
| 26 | 3300025940 | Ga0207691_10017098 | Ga0207691_100170984 | 186 |
| 27 | 3300025942 | Ga0207689_10040266 | Ga0207689_100402663 | 186 |
| 28 | 3300026023 | Ga0207677_10093677 | Ga0207677_100936772 | 186 |
| 29 | 3300026095 | Ga0207676_10001466 | Ga0207676_1000146611 | 186 |
| 30 | 3300035725 | Ga0373947_0521861 | Ga0373947_0521861_211_771 | 186 |
| 31 | 3300046537 | Ga0495598_0219412 | Ga0495598_0219412_17_577 | 186 |
| 32 | 3300028380 | Ga0268265_10520103 | Ga0268265_105201031 | 188 |
| 33 | 3300005328 | Ga0070676_10382259 | Ga0070676_103822592 | 189 |
| 34 | 3300005344 | Ga0070661_100298821 | Ga0070661_1002988212 | 189 |
| 35 | 3300005842 | Ga0068858_100103156 | Ga0068858_1001031562 | 189 |
| 36 | 3300013308 | Ga0157375_10290249 | Ga0157375_102902492 | 189 |
| 37 | 3300014325 | Ga0163163_10718365 | Ga0163163_107183652 | 189 |
| 38 | 3300014326 | Ga0157380_10370262 | Ga0157380_103702622 | 189 |
| 39 | 3300025925 | Ga0207650_10413883 | Ga0207650_104138832 | 189 |
| 40 | 3300025972 | Ga0207668_11079060 | Ga0207668_110790601 | 189 |
| 41 | 3300026078 | Ga0207702_10462889 | Ga0207702_104628892 | 189 |
| 42 | 3300049768 | Ga0501271_038233 | Ga0501271_038233_29_607 | 189 |
| 43 | 3300009036 | Ga0105244_10000004 | Ga0105244_10000004118 | 190 |
| 44 | 3300049680 | Ga0501250_020207 | Ga0501250_020207_135_770 | 190 |
| 45 | 3300005329 | Ga0070683_100096553 | Ga0070683_1000965533 | 193 |
| 46 | 3300005334 | Ga0068869_100319549 | Ga0068869_1003195492 | 193 |
| 47 | 3300005335 | Ga0070666_10087124 | Ga0070666_100871243 | 193 |
| 48 | 3300005340 | Ga0070689_100178657 | Ga0070689_1001786572 | 193 |
| 49 | 3300005365 | Ga0070688_100157529 | Ga0070688_1001575292 | 193 |
| 50 | 3300005466 | Ga0070685_10080859 | Ga0070685_100808593 | 193 |
| 51 | 3300005544 | Ga0070686_100250254 | Ga0070686_1002502542 | 193 |
| 52 | 3300005548 | Ga0070665_100252631 | Ga0070665_1002526312 | 193 |
| 53 | 3300005564 | Ga0070664_100259107 | Ga0070664_1002591072 | 193 |
| 54 | 3300005616 | Ga0068852_100264458 | Ga0068852_1002644582 | 193 |
| 55 | 3300006237 | Ga0097621_100040438 | Ga0097621_1000404382 | 193 |
| 56 | 3300013307 | Ga0157372_10243075 | Ga0157372_102430751 | 193 |
| 57 | 3300025936 | Ga0207670_10112283 | Ga0207670_101122832 | 193 |
| 58 | 3300025938 | Ga0207704_10699882 | Ga0207704_106998822 | 193 |
| 59 | 3300025945 | Ga0207679_10232110 | Ga0207679_102321101 | 193 |
| 60 | 3300026041 | Ga0207639_10103291 | Ga0207639_101032912 | 193 |
| 61 | 3300026142 | Ga0207698_10133521 | Ga0207698_101335212 | 193 |
| 62 | 3300028379 | Ga0268266_10231482 | Ga0268266_102314822 | 193 |
| 63 | 3300005330 | Ga0070690_100015222 | Ga0070690_1000152224 | 195 |
| 64 | 3300005334 | Ga0068869_100002274 | Ga0068869_1000022747 | 195 |
| 65 | 3300005335 | Ga0070666_10027939 | Ga0070666_100279394 | 195 |
| 66 | 3300005355 | Ga0070671_100144481 | Ga0070671_1001444813 | 195 |
| 67 | 3300005456 | Ga0070678_100046760 | Ga0070678_1000467603 | 195 |
| 68 | 3300005457 | Ga0070662_100020521 | Ga0070662_1000205213 | 195 |
| 69 | 3300005547 | Ga0070693_100029513 | Ga0070693_1000295133 | 195 |
| 70 | 3300005840 | Ga0068870_10130473 | Ga0068870_101304732 | 195 |
| 71 | 3300006163 | Ga0070715_10159487 | Ga0070715_101594872 | 195 |
| 72 | 3300006358 | Ga0068871_100049744 | Ga0068871_1000497442 | 195 |
| 73 | 3300009174 | Ga0105241_10142814 | Ga0105241_101428142 | 195 |
| 74 | 3300009176 | Ga0105242_10004134 | Ga0105242_100041348 | 195 |
| 75 | 3300009177 | Ga0105248_10228604 | Ga0105248_102286043 | 195 |
| 76 | 3300009545 | Ga0105237_10086918 | Ga0105237_100869184 | 195 |
| 77 | 3300010375 | Ga0105239_10277120 | Ga0105239_102771202 | 195 |
| 78 | 3300011119 | Ga0105246_10062087 | Ga0105246_100620873 | 195 |
| 79 | 3300013296 | Ga0157374_10034553 | Ga0157374_100345533 | 195 |
| 80 | 3300013297 | Ga0157378_10075376 | Ga0157378_100753762 | 195 |
| 81 | 3300013306 | Ga0163162_10090745 | Ga0163162_100907452 | 195 |
| 82 | 3300013308 | Ga0157375_10010304 | Ga0157375_100103044 | 195 |
| 83 | 3300014325 | Ga0163163_10145136 | Ga0163163_101451362 | 195 |
| 84 | 3300014745 | Ga0157377_10062067 | Ga0157377_100620673 | 195 |
| 85 | 3300014968 | Ga0157379_10126454 | Ga0157379_101264543 | 195 |
| 86 | 3300014969 | Ga0157376_10003083 | Ga0157376_100030835 | 195 |
| 87 | 3300017792 | Ga0163161_10196173 | Ga0163161_101961733 | 195 |
| 88 | 3300025903 | Ga0207680_10082944 | Ga0207680_100829442 | 195 |
| 89 | 3300025911 | Ga0207654_10727679 | Ga0207654_107276791 | 195 |
| 90 | 3300025913 | Ga0207695_10720127 | Ga0207695_107201272 | 195 |
| 91 | 3300025933 | Ga0207706_10008620 | Ga0207706_100086206 | 195 |
| 92 | 3300025936 | Ga0207670_10430373 | Ga0207670_104303732 | 195 |
| 93 | 3300025937 | Ga0207669_10465852 | Ga0207669_104658522 | 195 |
| 94 | 3300025942 | Ga0207689_10045663 | Ga0207689_100456633 | 195 |
| 95 | 3300025949 | Ga0207667_10895545 | Ga0207667_108955452 | 195 |
| 96 | 3300025960 | Ga0207651_10055626 | Ga0207651_100556263 | 195 |
| 97 | 3300025981 | Ga0207640_10062104 | Ga0207640_100621042 | 195 |
| 98 | 3300026121 | Ga0207683_10249750 | Ga0207683_102497502 | 195 |
| 99 | 3300032004 | Ga0307414_10042047 | Ga0307414_100420471 | 195 |
| 100 | 3300042436 | Ga0439435_0157751 | Ga0439435_0157751_14_601 | 195 |
| 101 | 3300046507 | Ga0495606_0000919 | Ga0495606_0000919_15498_16097 | 195 |
| 102 | 3300046684 | Ga0495669_0210331 | Ga0495669_0210331_122_721 | 195 |
| 103 | 3300009545 | Ga0105237_10000113 | Ga0105237_1000011379 | 196 |
| 104 | 3300010375 | Ga0105239_10487317 | Ga0105239_104873171 | 196 |
| 105 | 3300013104 | Ga0157370_10217850 | Ga0157370_102178502 | 196 |
| 106 | 3300025914 | Ga0207671_10002020 | Ga0207671_1000202012 | 196 |
| 107 | 3300046810 | Ga0495660_0005922 | Ga0495660_0005922_6435_7037 | 196 |
| 108 | 3300005329 | Ga0070683_100114140 | Ga0070683_1001141402 | 198 |
| 109 | 3300005354 | Ga0070675_100457646 | Ga0070675_1004576462 | 198 |
| 110 | 3300005367 | Ga0070667_100291532 | Ga0070667_1002915322 | 198 |
| 111 | 3300005466 | Ga0070685_10071894 | Ga0070685_100718942 | 198 |
| 112 | 3300005535 | Ga0070684_100325530 | Ga0070684_1003255301 | 198 |
| 113 | 3300005618 | Ga0068864_100004501 | Ga0068864_1000045012 | 198 |
| 114 | 3300005842 | Ga0068858_100490613 | Ga0068858_1004906131 | 198 |
| 115 | 3300005843 | Ga0068860_100412914 | Ga0068860_1004129142 | 198 |
| 116 | 3300005843 | Ga0068860_100928505 | Ga0068860_1009285051 | 198 |
| 117 | 3300006844 | Ga0075428_100054272 | Ga0075428_1000542723 | 198 |
| 118 | 3300006880 | Ga0075429_100480755 | Ga0075429_1004807552 | 198 |
| 119 | 3300013297 | Ga0157378_10015370 | Ga0157378_100153706 | 198 |
| 120 | 3300013306 | Ga0163162_10287125 | Ga0163162_102871252 | 198 |
| 121 | 3300013308 | Ga0157375_10387378 | Ga0157375_103873783 | 198 |
| 122 | 3300017792 | Ga0163161_10110317 | Ga0163161_101103172 | 198 |
| 123 | 3300017792 | Ga0163161_10132310 | Ga0163161_101323102 | 198 |
| 124 | 3300025904 | Ga0207647_10193187 | Ga0207647_101931872 | 198 |
| 125 | 3300025920 | Ga0207649_10077583 | Ga0207649_100775832 | 198 |
| 126 | 3300025920 | Ga0207649_10554681 | Ga0207649_105546811 | 198 |
| 127 | 3300025934 | Ga0207686_10286595 | Ga0207686_102865951 | 198 |
| 128 | 3300025940 | Ga0207691_10148906 | Ga0207691_101489063 | 198 |
| 129 | 3300025940 | Ga0207691_10248752 | Ga0207691_102487521 | 198 |
| 130 | 3300053130 | Ga0500642_0123839 | Ga0500642_0123839_84_713 | 198 |
| 131 | 3300005356 | Ga0070674_100066847 | Ga0070674_1000668472 | 199 |
| 132 | 3300014326 | Ga0157380_10044739 | Ga0157380_100447392 | 199 |
| 133 | 3300025937 | Ga0207669_10080349 | Ga0207669_100803492 | 199 |
| 134 | 3300025728 | Ga0207655_1000008 | Ga0207655_1000008470 | 200 |
| 135 | 3300028794 | Ga0307515_10000479 | Ga0307515_1000047923 | 201 |
| 136 | 3300005843 | Ga0068860_100188994 | Ga0068860_1001889942 | 202 |
| 137 | 3300006844 | Ga0075428_100062436 | Ga0075428_1000624362 | 202 |
| 138 | 3300006880 | Ga0075429_100043405 | Ga0075429_1000434052 | 202 |
| 139 | 3300050508 | nmdc:mga09592_3957_c1 | nmdc:mga09592_3957_c1_2116_2724 | 202 |
| 140 | 3300003781 | Ga0055536_1000012 | Ga0055536_100001232 | 203 |
| 141 | 3300003791 | Ga0055530_10002752 | Ga0055530_100027523 | 203 |
| 142 | 3300005564 | Ga0070664_100205252 | Ga0070664_1002052522 | 203 |
| 143 | 3300025292 | Ga0209676_1000001 | Ga0209676_10000011551 | 203 |
| 144 | 3300025298 | Ga0209050_1000018 | Ga0209050_100001830 | 203 |
| 145 | 3300025945 | Ga0207679_10154902 | Ga0207679_101549022 | 203 |
| 146 | 3300005338 | Ga0068868_100515267 | Ga0068868_1005152672 | 204 |
| 147 | 3300005844 | Ga0068862_100464537 | Ga0068862_1004645371 | 204 |
| 148 | 3300009176 | Ga0105242_10063643 | Ga0105242_100636435 | 204 |
| 149 | 3300009553 | Ga0105249_10456929 | Ga0105249_104569292 | 204 |
| 150 | 3300013306 | Ga0163162_10471422 | Ga0163162_104714221 | 204 |
| 151 | 3300025961 | Ga0207712_10239622 | Ga0207712_102396222 | 204 |
| 152 | 3300028380 | Ga0268265_10509682 | Ga0268265_105096822 | 204 |
| 153 | 3300046517 | Ga0495630_0566426 | Ga0495630_0566426_83_697 | 204 |
| 154 | 3300005295 | Ga0065707_10122890 | Ga0065707_101228901 | 205 |
| 155 | 3300005328 | Ga0070676_10033642 | Ga0070676_100336421 | 205 |
| 156 | 3300005353 | Ga0070669_100004917 | Ga0070669_1000049178 | 205 |
| 157 | 3300005354 | Ga0070675_100002773 | Ga0070675_10000277311 | 205 |
| 158 | 3300005364 | Ga0070673_100093956 | Ga0070673_1000939564 | 205 |
| 159 | 3300005365 | Ga0070688_100017614 | Ga0070688_1000176145 | 205 |
| 160 | 3300005441 | Ga0070700_100195124 | Ga0070700_1001951242 | 205 |
| 161 | 3300005457 | Ga0070662_100148556 | Ga0070662_1001485564 | 205 |
| 162 | 3300005459 | Ga0068867_100030739 | Ga0068867_1000307393 | 205 |
| 163 | 3300005577 | Ga0068857_100164555 | Ga0068857_1001645552 | 205 |
| 164 | 3300005617 | Ga0068859_100009409 | Ga0068859_1000094095 | 205 |
| 165 | 3300005719 | Ga0068861_100052042 | Ga0068861_1000520422 | 205 |
| 166 | 3300006931 | Ga0097620_100009409 | Ga0097620_1000094099 | 205 |
| 167 | 3300009094 | Ga0111539_10039605 | Ga0111539_100396055 | 205 |
| 168 | 3300014326 | Ga0157380_10014300 | Ga0157380_100143005 | 205 |
| 169 | 3300014326 | Ga0157380_10355676 | Ga0157380_103556762 | 205 |
| 170 | 3300014745 | Ga0157377_10002046 | Ga0157377_100020466 | 205 |
| 171 | 3300025907 | Ga0207645_10042973 | Ga0207645_100429732 | 205 |
| 172 | 3300025918 | Ga0207662_10232713 | Ga0207662_102327132 | 205 |
| 173 | 3300025923 | Ga0207681_10005212 | Ga0207681_100052126 | 205 |
| 174 | 3300025926 | Ga0207659_10011304 | Ga0207659_100113045 | 205 |
| 175 | 3300025934 | Ga0207686_10689029 | Ga0207686_106890291 | 205 |
| 176 | 3300025938 | Ga0207704_10278683 | Ga0207704_102786833 | 205 |
| 177 | 3300025960 | Ga0207651_10097049 | Ga0207651_100970492 | 205 |
| 178 | 3300026075 | Ga0207708_10223162 | Ga0207708_102231621 | 205 |
| 179 | 3300026075 | Ga0207708_10272857 | Ga0207708_102728573 | 205 |
| 180 | 3300026088 | Ga0207641_10557738 | Ga0207641_105577381 | 205 |
| 181 | 3300026116 | Ga0207674_10275478 | Ga0207674_102754783 | 205 |
| 182 | 3300026118 | Ga0207675_100017188 | Ga0207675_1000171884 | 205 |
| 183 | 3300027907 | Ga0207428_10050505 | Ga0207428_100505054 | 205 |
| 184 | 3300028380 | Ga0268265_10004707 | Ga0268265_100047074 | 205 |
| 185 | 3300028381 | Ga0268264_10146374 | Ga0268264_101463742 | 205 |
| 186 | 3300031824 | Ga0307413_10427741 | Ga0307413_104277412 | 205 |
| 187 | 3300032004 | Ga0307414_10471950 | Ga0307414_104719502 | 205 |
| 188 | 3300035724 | Ga0373933_0239517 | Ga0373933_0239517_540_1157 | 205 |
| 189 | 3300046539 | Ga0495621_0269848 | Ga0495621_0269848_44_661 | 205 |
| 190 | 3300050508 | nmdc:mga09592_383035_c1 | nmdc:mga09592_383035_c1_77_694 | 205 |
| 191 | 3300050511 | nmdc:mga08y16_228928_c1 | nmdc:mga08y16_228928_c1_1061_1678 | 205 |
| 192 | 3300005578 | Ga0068854_100600913 | Ga0068854_1006009131 | 206 |
| 193 | 3300025922 | Ga0207646_10213058 | Ga0207646_102130582 | 206 |
| 194 | 3300028379 | Ga0268266_10116866 | Ga0268266_101168662 | 206 |
| 195 | 3300042876 | Ga0451577_0019948 | Ga0451577_0019948_4929_5561 | 206 |
| 196 | 3300044712 | Ga0453684_0013408 | Ga0453684_0013408_2328_2960 | 206 |
| 197 | 3300045051 | Ga0451576_0481151 | Ga0451576_0481151_479_1111 | 206 |
| 198 | 3300005290 | Ga0065712_10007304 | Ga0065712_100073044 | 207 |
| 199 | 3300005290 | Ga0065712_10097184 | Ga0065712_100971841 | 207 |
| 200 | 3300005290 | Ga0065712_10141896 | Ga0065712_101418962 | 207 |
| 201 | 3300009094 | Ga0111539_10060617 | Ga0111539_100606172 | 207 |
| 202 | 3300050511 | nmdc:mga08y16_109275_c1 | nmdc:mga08y16_109275_c1_1884_2510 | 207 |
| 203 | 3300005290 | Ga0065712_10073039 | Ga0065712_100730393 | 208 |
| 204 | 3300005334 | Ga0068869_100119684 | Ga0068869_1001196843 | 208 |
| 205 | 3300005340 | Ga0070689_100002991 | Ga0070689_1000029918 | 208 |
| 206 | 3300005353 | Ga0070669_100047501 | Ga0070669_1000475013 | 208 |
| 207 | 3300005364 | Ga0070673_100049843 | Ga0070673_1000498435 | 208 |
| 208 | 3300005366 | Ga0070659_100283260 | Ga0070659_1002832602 | 208 |
| 209 | 3300005457 | Ga0070662_100052822 | Ga0070662_1000528223 | 208 |
| 210 | 3300005459 | Ga0068867_100062230 | Ga0068867_1000622304 | 208 |
| 211 | 3300005564 | Ga0070664_100851538 | Ga0070664_1008515381 | 208 |
| 212 | 3300005577 | Ga0068857_100274568 | Ga0068857_1002745682 | 208 |
| 213 | 3300005616 | Ga0068852_100225277 | Ga0068852_1002252772 | 208 |
| 214 | 3300005617 | Ga0068859_100014604 | Ga0068859_1000146043 | 208 |
| 215 | 3300005617 | Ga0068859_100329252 | Ga0068859_1003292522 | 208 |
| 216 | 3300005618 | Ga0068864_100401274 | Ga0068864_1004012743 | 208 |
| 217 | 3300006358 | Ga0068871_100870965 | Ga0068871_1008709651 | 208 |
| 218 | 3300006844 | Ga0075428_100324219 | Ga0075428_1003242192 | 208 |
| 219 | 3300006931 | Ga0097620_100014602 | Ga0097620_1000146028 | 208 |
| 220 | 3300006931 | Ga0097620_100329225 | Ga0097620_1003292252 | 208 |
| 221 | 3300009176 | Ga0105242_10495560 | Ga0105242_104955601 | 208 |
| 222 | 3300009176 | Ga0105242_10986871 | Ga0105242_109868711 | 208 |
| 223 | 3300013296 | Ga0157374_10072746 | Ga0157374_100727461 | 208 |
| 224 | 3300013297 | Ga0157378_11226040 | Ga0157378_112260401 | 208 |
| 225 | 3300013306 | Ga0163162_10303015 | Ga0163162_103030152 | 208 |
| 226 | 3300013307 | Ga0157372_10241969 | Ga0157372_102419691 | 208 |
| 227 | 3300013308 | Ga0157375_10077909 | Ga0157375_100779092 | 208 |
| 228 | 3300014745 | Ga0157377_10018730 | Ga0157377_100187301 | 208 |
| 229 | 3300017792 | Ga0163161_10005489 | Ga0163161_100054893 | 208 |
| 230 | 3300025315 | Ga0207697_10054014 | Ga0207697_100540143 | 208 |
| 231 | 3300025907 | Ga0207645_10010286 | Ga0207645_100102866 | 208 |
| 232 | 3300025932 | Ga0207690_10308191 | Ga0207690_103081911 | 208 |
| 233 | 3300025933 | Ga0207706_10016444 | Ga0207706_100164447 | 208 |
| 234 | 3300025936 | Ga0207670_10005318 | Ga0207670_100053187 | 208 |
| 235 | 3300025942 | Ga0207689_10092589 | Ga0207689_100925891 | 208 |
| 236 | 3300025942 | Ga0207689_10199558 | Ga0207689_101995583 | 208 |
| 237 | 3300025960 | Ga0207651_10011171 | Ga0207651_100111713 | 208 |
| 238 | 3300025961 | Ga0207712_10495870 | Ga0207712_104958702 | 208 |
| 239 | 3300026067 | Ga0207678_10371727 | Ga0207678_103717272 | 208 |
| 240 | 3300026089 | Ga0207648_10031067 | Ga0207648_100310673 | 208 |
| 241 | 3300026089 | Ga0207648_10272395 | Ga0207648_102723951 | 208 |
| 242 | 3300026095 | Ga0207676_10286393 | Ga0207676_102863932 | 208 |
| 243 | 3300026116 | Ga0207674_10402778 | Ga0207674_104027781 | 208 |
| 244 | 3300026121 | Ga0207683_10682337 | Ga0207683_106823372 | 208 |
| 245 | 3300028380 | Ga0268265_10174994 | Ga0268265_101749942 | 208 |
| 246 | 3300014326 | Ga0157380_10656513 | Ga0157380_106565132 | 210 |
| 247 | 3300032004 | Ga0307414_10280770 | Ga0307414_102807702 | 210 |
| 248 | 3300005334 | Ga0068869_101023032 | Ga0068869_1010230321 | 211 |
| 249 | 3300025942 | Ga0207689_10898279 | Ga0207689_108982791 | 211 |
| 250 | 3300036401 | Ga0373937_0123782 | Ga0373937_0123782_38_700 | 211 |
| 251 | 3300050511 | nmdc:mga08y16_815266_c1 | nmdc:mga08y16_815266_c1_208_843 | 211 |
| 252 | 3300005353 | Ga0070669_100249706 | Ga0070669_1002497062 | 212 |
| 253 | 3300009094 | Ga0111539_10540138 | Ga0111539_105401382 | 212 |
| 254 | 3300014326 | Ga0157380_10186590 | Ga0157380_101865901 | 212 |
| 255 | 3300026089 | Ga0207648_10711372 | Ga0207648_107113721 | 212 |
| 256 | 3300046691 | Ga0495670_0156548 | Ga0495670_0156548_42_680 | 212 |
| 257 | 3300000043 | ARcpr5yngRDRAFT_c002505 | ARcpr5yngRDRAFT_0025052 | 214 |
| 258 | 3300006871 | Ga0075434_100396622 | Ga0075434_1003966222 | 214 |
| 259 | 3300013308 | Ga0157375_10175632 | Ga0157375_101756321 | 214 |
| 260 | 3300014969 | Ga0157376_10906222 | Ga0157376_109062221 | 214 |
| 261 | 3300037471 | Ga0395905_0530292 | Ga0395905_0530292_232_876 | 214 |
| 262 | 3300050508 | nmdc:mga09592_115407_c1 | nmdc:mga09592_115407_c1_573_1217 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3edo-assembly2.cif.gz_B | crystal structure of flavoprotein in complex with fmn (yp_193882.1) from lactobacillus acidophilus ncfm at 1.20 a resolution | 0.8722 | 40 | 174 |
| 4ici-assembly1.cif.gz_A | crystal structure of a putative flavoprotein (bacegg_01620) from bacteroides eggerthii dsm 20697 at 1.40 a resolution | 0.8541 | 41 | 207 |
| 4j8p-assembly1.cif.gz_A | crystal structure of a putative flavoprotein (bacuni_04544) from bacteroides uniformis atcc 8492 at 1.50 a resolution | 0.8488 | 40 | 201 |
| 3klb-assembly1.cif.gz_A | crystal structure of putative flavoprotein in complex with fmn (yp_213683.1) from bacteroides fragilis nctc 9343 at 1.75 a resolution | 0.8473 | 41 | 207 |
| 4j8p-assembly1.cif.gz_A | crystal structure of a putative flavoprotein (bacuni_04544) from bacteroides uniformis atcc 8492 at 1.50 a resolution | 0.8287 | 40 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4j8pA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8538 | 40 | 201 | 3.40.50.360 |
| 4j8pA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8335 | 40 | 201 | 3.40.50.360 |
| 2n1mA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.7738 | 40 | 174 | 3.40.50.360 |
| af_Q57746_4_148_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.7156 | 43 | 201 | 3.40.50.360 |
| af_Q57746_4_148_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.6981 | 43 | 201 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C6IJR3-F1-model_v4 | deleted | 0.9705 | 43 | 176 |
|
| AF-A0A316N5F5-F1-model_v4 | Flavodoxin | 0.9689 | 43 | 150 |
GO:0009055
GO:0010181 |
| AF-S3ZCU8-F1-model_v4 | Flavodoxin-like domain-containing protein | 0.967 | 69 | 176 |
GO:0010181
|
| AF-G5IEN0-F1-model_v4 | Flavodoxin-like domain-containing protein | 0.9638 | 40 | 206 |
GO:0009055
GO:0010181 GO:0016651 |
| AF-D1Y6R0-F1-model_v4 | deleted | 0.9632 | 41 | 173 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar