F371933

General Info

Members Datasets Scaffolds Average Seq Length
263 154 526 249

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10428835|Ga0207712_104288351
Length 292
Sequence VSLKNLLFKKTPPPSIRHELLKIDGRLLEVRVRLNPRARRMIVKVNPATGEISVTAPSRRGLAHALDFARGEKEWIAGQLAKAPGPVLMTPGAALPFRGKLHEIRAAASGPAPVWLDEGVIWVSGHAAHAPRRVLDFLKSEARKAFEIRALEHAEKLGVKPSRITVRDTASRWGSCSSARSLSFSWRLILAPDFVLDYVVAHEVAHLREMNHSPRFWAHVKNLIADKIPDVACERLHRKRHVAHEGDFHRHQPRSPSAQVRNASASSRVAFILSVSDRAIGGPISVLLASTT

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
150 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
151 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
152 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.6
Nodule 0
Rhizoplane 0
Rhizosphere 91.25
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10428835 3300025961 Bacteria 1117
2 Ga0070658_10013783 3300005327 Bacteria 6487
3 Ga0070658_10177805 3300005327 Unclassified 1790
4 Ga0070658_10363043 3300005327 Bacteria 1241
5 Ga0070676_10001376 3300005328 Bacteria 12257
6 Ga0070683_100176571 3300005329 Bacteria 2028
7 Ga0070690_100062948 3300005330 Bacteria 2393
8 Ga0068869_100002394 3300005334 Bacteria 11301
9 Ga0070666_10001350 3300005335 Bacteria 14890
10 Ga0070666_10006536 3300005335 Bacteria 7162
11 Ga0070680_100019997 3300005336 Bacteria 5308
12 Ga0070680_100252931 3300005336 Bacteria 1490
13 Ga0068868_100075321 3300005338 Bacteria 2697
14 Ga0068868_100248891 3300005338 Bacteria 1495
15 Ga0070660_100026293 3300005339 Bacteria 4332
16 Ga0070671_100071315 3300005355 Bacteria 2899
17 Ga0070659_100018711 3300005366 Bacteria 5229
18 Ga0070667_100003377 3300005367 Bacteria 13615
19 Ga0070667_100012865 3300005367 Bacteria 6914
20 Ga0070714_100188412 3300005435 Bacteria 1881
21 Ga0070713_100129822 3300005436 Bacteria 2221
22 Ga0070713_100232736 3300005436 Bacteria 1675
23 Ga0070711_100170334 3300005439 Bacteria 1659
24 Ga0070681_10030628 3300005458 Bacteria 5400
25 Ga0070681_10151923 3300005458 Bacteria 2242
26 Ga0070685_10173039 3300005466 Bacteria 1385
27 Ga0070679_100266819 3300005530 Bacteria 1667
28 Ga0070679_100315465 3300005530 Bacteria 1513
29 Ga0070684_100041676 3300005535 Bacteria 3960
30 Ga0070684_100464665 3300005535 Bacteria 1170
31 Ga0068853_100070770 3300005539 Bacteria 3037
32 Ga0068853_100108211 3300005539 Bacteria 2466
33 Ga0068853_100118853 3300005539 Bacteria 2355
34 Ga0070672_100367225 3300005543 Bacteria 1229
35 Ga0070696_100028174 3300005546 Bacteria 3832
36 Ga0070665_100002597 3300005548 Bacteria 19721
37 Ga0070665_100064387 3300005548 Bacteria 3676
38 Ga0068855_100022613 3300005563 Bacteria 7533
39 Ga0068855_100027939 3300005563 Bacteria 6749
40 Ga0068855_100201419 3300005563 Bacteria 2241
41 Ga0068855_100337213 3300005563 Bacteria 1663
42 Ga0068855_100641253 3300005563 Unclassified 1142
43 Ga0068852_100005013 3300005616 Bacteria 9416
44 Ga0068859_101051634 3300005617 Bacteria 895
45 Ga0075368_10020865 3300006042 Bacteria 2484
46 Ga0075363_100052615 3300006048 Bacteria 2174
47 Ga0070712_100336093 3300006175 Bacteria 1232
48 Ga0075362_10120287 3300006177 Bacteria 1242
49 Ga0075367_10017280 3300006178 Bacteria 3956
50 Ga0075369_10007114 3300006186 Bacteria 4252
51 Ga0097621_100002964 3300006237 Bacteria 11650
52 Ga0097621_100019884 3300006237 Bacteria 5164
53 Ga0068871_100001250 3300006358 Bacteria 16986
54 Ga0075428_100134682 3300006844 Bacteria 2687
55 Ga0075430_100210113 3300006846 Bacteria 1615
56 Ga0075434_100449360 3300006871 Bacteria 1310
57 Ga0068865_100025832 3300006881 Bacteria 3867
58 Ga0097620_101051644 3300006931 Bacteria 895
59 Ga0105240_10158446 3300009093 Bacteria 2691
60 Ga0105240_10179345 3300009093 Bacteria 2501
61 Ga0105240_10184339 3300009093 Bacteria 2460
62 Ga0105240_10212523 3300009093 Bacteria 2259
63 Ga0105240_10439014 3300009093 Bacteria 1463
64 Ga0105240_10707731 3300009093 Bacteria 1099
65 Ga0111539_10704716 3300009094 Bacteria 1175
66 Ga0105245_10070841 3300009098 Bacteria 3165
67 Ga0105245_10133433 3300009098 Bacteria 2331
68 Ga0105245_10339594 3300009098 Bacteria 1485
69 Ga0105243_10006780 3300009148 Bacteria 8830
70 Ga0105241_10213025 3300009174 Bacteria 1620
71 Ga0105241_10404339 3300009174 Bacteria 1198
72 Ga0105242_10336093 3300009176 Bacteria 1390
73 Ga0105248_10000001 3300009177 Bacteria 1881304
74 Ga0105248_10091830 3300009177 Bacteria 3419
75 Ga0105248_10109932 3300009177 Bacteria 3108
76 Ga0105237_10126897 3300009545 Bacteria 2546
77 Ga0105238_10095547 3300009551 Bacteria 2959
78 Ga0105238_10313114 3300009551 Unclassified 1555
79 Ga0105249_10521235 3300009553 Bacteria 1236
80 Ga0099796_10035270 3300010159 Bacteria 1658
81 Ga0105239_10601738 3300010375 Bacteria 1254
82 Ga0157370_10004453 3300013104 Bacteria 16057
83 Ga0157374_10025468 3300013296 Bacteria 5312
84 Ga0157374_10306111 3300013296 Bacteria 1573
85 Ga0157378_10195461 3300013297 Bacteria 1910
86 Ga0157378_10436553 3300013297 Unclassified 1297
87 Ga0163162_10044647 3300013306 Bacteria 4439
88 Ga0157372_10071967 3300013307 Bacteria 3895
89 Ga0163163_10272295 3300014325 Bacteria 1744
90 Ga0163163_10310133 3300014325 Bacteria 1631
91 Ga0213876_10000274 3300021384 Bacteria 47640
92 Ga0209233_1000006 3300025261 Bacteria 1473685
93 Ga0209455_1017948 3300025272 Bacteria 1467
94 Ga0207680_10001419 3300025903 Bacteria 11354
95 Ga0207645_10005584 3300025907 Bacteria 9097
96 Ga0207643_10059494 3300025908 Bacteria 2179
97 Ga0207705_10013975 3300025909 Bacteria 5788
98 Ga0207707_10132852 3300025912 Bacteria 2177
99 Ga0207707_10240668 3300025912 Bacteria 1573
100 Ga0207695_10023131 3300025913 Bacteria 7032
101 Ga0207695_10084002 3300025913 Bacteria 3215
102 Ga0207695_10339669 3300025913 Bacteria 1390
103 Ga0207660_10540126 3300025917 Unclassified 948
104 Ga0207657_10284720 3300025919 Bacteria 1311
105 Ga0207652_10435889 3300025921 Bacteria 1181
106 Ga0207694_10360375 3300025924 Unclassified 1205
107 Ga0207650_10473419 3300025925 Bacteria 1044
108 Ga0207687_10049061 3300025927 Bacteria 2934
109 Ga0207706_10141251 3300025933 Bacteria 2119
110 Ga0207706_10465863 3300025933 Bacteria 1092
111 Ga0207711_10000001 3300025941 Bacteria 1325674
112 Ga0207689_10026374 3300025942 Bacteria 4865
113 Ga0207661_10251838 3300025944 Bacteria 1570
114 Ga0207667_10035769 3300025949 Bacteria 5327
115 Ga0207667_10077363 3300025949 Bacteria 3451
116 Ga0207667_10194008 3300025949 Bacteria 2084
117 Ga0207658_10023373 3300025986 Bacteria 4314
118 Ga0207677_10004318 3300026023 Bacteria 7614
119 Ga0207639_10001556 3300026041 Bacteria 15378
120 Ga0207641_10105212 3300026088 Bacteria 2492
121 Ga0207648_10009495 3300026089 Bacteria 9309
122 Ga0207683_10003082 3300026121 Bacteria 14565
123 Ga0207683_10240861 3300026121 Unclassified 1650
124 Ga0207683_10446794 3300026121 Bacteria 1192
125 Ga0207698_10017662 3300026142 Bacteria 4847
126 Ga0268266_10000463 3300028379 Bacteria 59089
127 Ga0268266_10059775 3300028379 Bacteria 3284
128 Ga0268266_10255452 3300028379 Bacteria 1622
129 Ga0265337_1001547 3300028556 Bacteria 11281
130 Ga0265334_10003612 3300028573 Bacteria 7011
131 Ga0265334_10014267 3300028573 Bacteria 3312
132 Ga0265318_10000444 3300028577 Bacteria 31172
133 Ga0265338_10000011 3300028800 Bacteria 433370
134 Ga0265338_10001087 3300028800 Bacteria 45161
135 Ga0265338_10033137 3300028800 Bacteria 5021
136 Ga0265338_10093448 3300028800 Bacteria 2478
137 Ga0265338_10194920 3300028800 Bacteria 1532
138 Ga0265330_10042348 3300031235 Bacteria 2018
139 Ga0265332_10049698 3300031238 Bacteria 1803
140 Ga0265325_10000009 3300031241 Bacteria 184273
141 Ga0265325_10030929 3300031241 Bacteria 2869
142 Ga0265340_10040223 3300031247 Bacteria 2304
143 Ga0265339_10002153 3300031249 Bacteria 14321
144 Ga0265331_10000008 3300031250 Bacteria 324311
145 Ga0265331_10000009 3300031250 Bacteria 314950
146 Ga0265331_10002453 3300031250 Bacteria 12567
147 Ga0265327_10000036 3300031251 Bacteria 312827
148 Ga0265316_10043504 3300031344 Bacteria 3579
149 Ga0265316_10107429 3300031344 Bacteria 2116
150 Ga0265316_10168292 3300031344 Bacteria 1636
151 Ga0307408_100248956 3300031548 Bacteria 1464
152 Ga0265313_10001052 3300031595 Bacteria 26852
153 Ga0265313_10014153 3300031595 Bacteria 4733
154 Ga0265313_10130463 3300031595 Bacteria 1089
155 Ga0265314_10004872 3300031711 Bacteria 12269
156 Ga0265314_10029360 3300031711 Bacteria 4088
157 Ga0265314_10031751 3300031711 Bacteria 3894
158 Ga0265314_10086542 3300031711 Bacteria 2051
159 Ga0265342_10128949 3300031712 Bacteria 1418
160 Ga0307516_10081749 3300031730 Bacteria 3073
161 Ga0373937_0074153 3300036401 Bacteria 3140
162 Ga0373937_0116965 3300036401 Bacteria 2483
163 Ga0373937_0222866 3300036401 Bacteria 1775
164 Ga0373925_0577733 3300037068 Bacteria 925
165 Ga0395899_0182634 3300037312 Bacteria 1472
166 Ga0395900_0042543 3300037418 Bacteria 4682
167 Ga0395898_0026131 3300037466 Bacteria 5877
168 Ga0436365_0257402 3300039437 Bacteria 164674
169 Ga0436360_1347255 3300039438 Bacteria 1879
170 Ga0495580_0058252 3300046472 Bacteria 2717
171 Ga0495606_0155603 3300046507 Bacteria 1338
172 Ga0495586_0032722 3300046535 Bacteria 2789
173 Ga0495587_0217197 3300046536 Unclassified 1079
174 Ga0495667_0304280 3300046559 Bacteria 1010
175 Ga0495634_0083933 3300046642 Bacteria 2078
176 Ga0495684_0217610 3300047471 Unclassified 1402
177 Ga0501031_0166192 3300049568 Bacteria 1442
178 Ga0501032_0028493 3300049569 Bacteria 3838
179 Ga0501032_0035434 3300049569 Bacteria 3411
180 Ga0501033_0002118 3300049570 Bacteria 17169
181 Ga0501033_0014827 3300049570 Bacteria 5917
182 Ga0501033_0023422 3300049570 Bacteria 4657
183 Ga0501034_0035157 3300049571 Bacteria 5081
184 Ga0501034_0160248 3300049571 Bacteria 2221
185 Ga0501034_0181610 3300049571 Bacteria 2069
186 Ga0501036_0090154 3300049572 Bacteria 2590
187 Ga0501036_0109098 3300049572 Bacteria 2339
188 Ga0501036_0115270 3300049572 Bacteria 2270
189 Ga0501036_0402004 3300049572 Bacteria 1143
190 Ga0501037_0045879 3300049573 Bacteria 3207
191 Ga0501037_0069823 3300049573 Bacteria 2557
192 Ga0501037_0077572 3300049573 Bacteria 2411
193 Ga0501037_0179223 3300049573 Bacteria 1504
194 Ga0501037_0192007 3300049573 Bacteria 1446
195 Ga0501038_0073458 3300049574 Bacteria 2896
196 Ga0501038_0083391 3300049574 Bacteria 2691
197 Ga0501038_0146784 3300049574 Bacteria 1925
198 Ga0501038_0397145 3300049574 Bacteria 1067
199 Ga0501039_0101153 3300049575 Bacteria 2250
200 Ga0501043_0049315 3300049579 Bacteria 3310
201 Ga0501043_0067150 3300049579 Bacteria 2816
202 Ga0501043_0267162 3300049579 Bacteria 1314
203 Ga0501043_0274423 3300049579 Bacteria 1294
204 Ga0501046_0207630 3300049580 Bacteria 1455
205 Ga0501047_0010064 3300049581 Bacteria 8941
206 Ga0501047_0010117 3300049581 Bacteria 8917
207 Ga0501047_0010754 3300049581 Bacteria 8651
208 Ga0501047_0028145 3300049581 Bacteria 5417
209 Ga0501047_0126604 3300049581 Bacteria 2435
210 Ga0501047_0145258 3300049581 Bacteria 2249
211 Ga0501047_0180121 3300049581 Bacteria 1980
212 Ga0501047_0284837 3300049581 Bacteria 1496
213 Ga0501047_0430518 3300049581 Unclassified 1150
214 Ga0501048_0182555 3300049582 Bacteria 1487
215 Ga0501067_0015446 3300049583 Bacteria 4227
216 Ga0501067_0019884 3300049583 Bacteria 3716
217 Ga0501069_0037953 3300049585 Bacteria 2658
218 Ga0501069_0239763 3300049585 Bacteria 1056
219 Ga0501070_0012304 3300049586 Bacteria 7222
220 Ga0501070_0040381 3300049586 Bacteria 3890
221 Ga0501070_0052121 3300049586 Bacteria 3396
222 Ga0501072_0016454 3300049588 Bacteria 5678
223 Ga0501073_0022692 3300049589 Bacteria 4515
224 Ga0501073_0121775 3300049589 Bacteria 1808
225 Ga0501073_0123969 3300049589 Bacteria 1791
226 Ga0501079_0029883 3300049741 Bacteria 4186
227 Ga0501080_0003916 3300049742 Bacteria 13188
228 Ga0501080_0059893 3300049742 Bacteria 3543
229 Ga0501080_0065071 3300049742 Bacteria 3391
230 Ga0501080_0151206 3300049742 Bacteria 2145
231 Ga0501083_0034604 3300049744 Bacteria 3454
232 Ga0501083_0109833 3300049744 Bacteria 1814
233 Ga0501035_0002523 3300049822 Bacteria 17906
234 Ga0501035_0005014 3300049822 Bacteria 12538
235 Ga0501035_0015352 3300049822 Bacteria 7069
236 Ga0501035_0066618 3300049822 Bacteria 3196
237 Ga0501035_0119819 3300049822 Bacteria 2301
238 Ga0501035_0456208 3300049822 Unclassified 1057
239 Ga0501044_0007608 3300049823 Bacteria 11911
240 Ga0501044_0029726 3300049823 Bacteria 5761
241 Ga0501044_0050191 3300049823 Bacteria 4306
242 Ga0501044_0098234 3300049823 Bacteria 2948
243 Ga0501044_0148544 3300049823 Bacteria 2327
244 Ga0501044_0201115 3300049823 Bacteria 1950
245 Ga0501044_0365757 3300049823 Bacteria 1360
246 nmdc:mga03n38_32505_c1 3300050490 Bacteria 2211
247 nmdc:mga00v17_210307_c1 3300050491 Bacteria 1259
248 nmdc:mga0yw44_120492_c1 3300050492 Bacteria 1690
249 nmdc:mga06z11_19580_c1 3300050494 Bacteria 3115
250 nmdc:mga06z11_21260_c1 3300050494 Bacteria 3013
251 nmdc:mga0qj67_456284_c1 3300050509 Bacteria 1029
252 nmdc:mga08y16_140982_c1 3300050511 Bacteria 2506
253 nmdc:mga0sz30_3071_c1 3300050516 Bacteria 5979
254 Ga0500643_000027 3300053087 Bacteria 251062
255 Ga0500566_0066345 3300053094 Bacteria 2034
256 Ga0500566_0101291 3300053094 Bacteria 1578
257 Ga0500652_000023 3300053131 Bacteria 116316
258 Ga0500588_0079231 3300053146 Bacteria 1095
259 Ga0500619_001348 3300053154 Bacteria 4316
260 Ga0500636_0028588 3300053177 Bacteria 3292
261 Ga0501084_0058502 3300054114 Bacteria 3225
262 Ga0501084_0092209 3300054114 Bacteria 2543
263 Ga0501082_0078700 3300060353 Bacteria 2844
264 Ga0207712_10428835
265 Ga0070658_10013783
266 Ga0070658_10177805
267 Ga0070658_10363043
268 Ga0070676_10001376
269 Ga0070683_100176571
270 Ga0070690_100062948
271 Ga0068869_100002394
272 Ga0070666_10001350
273 Ga0070666_10006536
274 Ga0070680_100019997
275 Ga0070680_100252931
276 Ga0068868_100075321
277 Ga0068868_100248891
278 Ga0070660_100026293
279 Ga0070671_100071315
280 Ga0070659_100018711
281 Ga0070667_100003377
282 Ga0070667_100012865
283 Ga0070714_100188412
284 Ga0070713_100129822
285 Ga0070713_100232736
286 Ga0070711_100170334
287 Ga0070681_10030628
288 Ga0070681_10151923
289 Ga0070685_10173039
290 Ga0070679_100266819
291 Ga0070679_100315465
292 Ga0070684_100041676
293 Ga0070684_100464665
294 Ga0068853_100070770
295 Ga0068853_100108211
296 Ga0068853_100118853
297 Ga0070672_100367225
298 Ga0070696_100028174
299 Ga0070665_100002597
300 Ga0070665_100064387
301 Ga0068855_100022613
302 Ga0068855_100027939
303 Ga0068855_100201419
304 Ga0068855_100337213
305 Ga0068855_100641253
306 Ga0068852_100005013
307 Ga0068859_101051634
308 Ga0075368_10020865
309 Ga0075363_100052615
310 Ga0070712_100336093
311 Ga0075362_10120287
312 Ga0075367_10017280
313 Ga0075369_10007114
314 Ga0097621_100002964
315 Ga0097621_100019884
316 Ga0068871_100001250
317 Ga0075428_100134682
318 Ga0075430_100210113
319 Ga0075434_100449360
320 Ga0068865_100025832
321 Ga0097620_101051644
322 Ga0105240_10158446
323 Ga0105240_10179345
324 Ga0105240_10184339
325 Ga0105240_10212523
326 Ga0105240_10439014
327 Ga0105240_10707731
328 Ga0111539_10704716
329 Ga0105245_10070841
330 Ga0105245_10133433
331 Ga0105245_10339594
332 Ga0105243_10006780
333 Ga0105241_10213025
334 Ga0105241_10404339
335 Ga0105242_10336093
336 Ga0105248_10000001
337 Ga0105248_10091830
338 Ga0105248_10109932
339 Ga0105237_10126897
340 Ga0105238_10095547
341 Ga0105238_10313114
342 Ga0105249_10521235
343 Ga0099796_10035270
344 Ga0105239_10601738
345 Ga0157370_10004453
346 Ga0157374_10025468
347 Ga0157374_10306111
348 Ga0157378_10195461
349 Ga0157378_10436553
350 Ga0163162_10044647
351 Ga0157372_10071967
352 Ga0163163_10272295
353 Ga0163163_10310133
354 Ga0213876_10000274
355 Ga0209233_1000006
356 Ga0209455_1017948
357 Ga0207680_10001419
358 Ga0207645_10005584
359 Ga0207643_10059494
360 Ga0207705_10013975
361 Ga0207707_10132852
362 Ga0207707_10240668
363 Ga0207695_10023131
364 Ga0207695_10084002
365 Ga0207695_10339669
366 Ga0207660_10540126
367 Ga0207657_10284720
368 Ga0207652_10435889
369 Ga0207694_10360375
370 Ga0207650_10473419
371 Ga0207687_10049061
372 Ga0207706_10141251
373 Ga0207706_10465863
374 Ga0207711_10000001
375 Ga0207689_10026374
376 Ga0207661_10251838
377 Ga0207667_10035769
378 Ga0207667_10077363
379 Ga0207667_10194008
380 Ga0207658_10023373
381 Ga0207677_10004318
382 Ga0207639_10001556
383 Ga0207641_10105212
384 Ga0207648_10009495
385 Ga0207683_10003082
386 Ga0207683_10240861
387 Ga0207683_10446794
388 Ga0207698_10017662
389 Ga0268266_10000463
390 Ga0268266_10059775
391 Ga0268266_10255452
392 Ga0265337_1001547
393 Ga0265334_10003612
394 Ga0265334_10014267
395 Ga0265318_10000444
396 Ga0265338_10000011
397 Ga0265338_10001087
398 Ga0265338_10033137
399 Ga0265338_10093448
400 Ga0265338_10194920
401 Ga0265330_10042348
402 Ga0265332_10049698
403 Ga0265325_10000009
404 Ga0265325_10030929
405 Ga0265340_10040223
406 Ga0265339_10002153
407 Ga0265331_10000008
408 Ga0265331_10000009
409 Ga0265331_10002453
410 Ga0265327_10000036
411 Ga0265316_10043504
412 Ga0265316_10107429
413 Ga0265316_10168292
414 Ga0307408_100248956
415 Ga0265313_10001052
416 Ga0265313_10014153
417 Ga0265313_10130463
418 Ga0265314_10004872
419 Ga0265314_10029360
420 Ga0265314_10031751
421 Ga0265314_10086542
422 Ga0265342_10128949
423 Ga0307516_10081749
424 Ga0373937_0074153
425 Ga0373937_0116965
426 Ga0373937_0222866
427 Ga0373925_0577733
428 Ga0395899_0182634
429 Ga0395900_0042543
430 Ga0395898_0026131
431 Ga0436365_0257402
432 Ga0436360_1347255
433 Ga0495580_0058252
434 Ga0495606_0155603
435 Ga0495586_0032722
436 Ga0495587_0217197
437 Ga0495667_0304280
438 Ga0495634_0083933
439 Ga0495684_0217610
440 Ga0501031_0166192
441 Ga0501032_0028493
442 Ga0501032_0035434
443 Ga0501033_0002118
444 Ga0501033_0014827
445 Ga0501033_0023422
446 Ga0501034_0035157
447 Ga0501034_0160248
448 Ga0501034_0181610
449 Ga0501036_0090154
450 Ga0501036_0109098
451 Ga0501036_0115270
452 Ga0501036_0402004
453 Ga0501037_0045879
454 Ga0501037_0069823
455 Ga0501037_0077572
456 Ga0501037_0179223
457 Ga0501037_0192007
458 Ga0501038_0073458
459 Ga0501038_0083391
460 Ga0501038_0146784
461 Ga0501038_0397145
462 Ga0501039_0101153
463 Ga0501043_0049315
464 Ga0501043_0067150
465 Ga0501043_0267162
466 Ga0501043_0274423
467 Ga0501046_0207630
468 Ga0501047_0010064
469 Ga0501047_0010117
470 Ga0501047_0010754
471 Ga0501047_0028145
472 Ga0501047_0126604
473 Ga0501047_0145258
474 Ga0501047_0180121
475 Ga0501047_0284837
476 Ga0501047_0430518
477 Ga0501048_0182555
478 Ga0501067_0015446
479 Ga0501067_0019884
480 Ga0501069_0037953
481 Ga0501069_0239763
482 Ga0501070_0012304
483 Ga0501070_0040381
484 Ga0501070_0052121
485 Ga0501072_0016454
486 Ga0501073_0022692
487 Ga0501073_0121775
488 Ga0501073_0123969
489 Ga0501079_0029883
490 Ga0501080_0003916
491 Ga0501080_0059893
492 Ga0501080_0065071
493 Ga0501080_0151206
494 Ga0501083_0034604
495 Ga0501083_0109833
496 Ga0501035_0002523
497 Ga0501035_0005014
498 Ga0501035_0015352
499 Ga0501035_0066618
500 Ga0501035_0119819
501 Ga0501035_0456208
502 Ga0501044_0007608
503 Ga0501044_0029726
504 Ga0501044_0050191
505 Ga0501044_0098234
506 Ga0501044_0148544
507 Ga0501044_0201115
508 Ga0501044_0365757
509 nmdc:mga03n38_32505_c1
510 nmdc:mga00v17_210307_c1
511 nmdc:mga0yw44_120492_c1
512 nmdc:mga06z11_19580_c1
513 nmdc:mga06z11_21260_c1
514 nmdc:mga0qj67_456284_c1
515 nmdc:mga08y16_140982_c1
516 nmdc:mga0sz30_3071_c1
517 Ga0500643_000027
518 Ga0500566_0066345
519 Ga0500566_0101291
520 Ga0500652_000023
521 Ga0500588_0079231
522 Ga0500619_001348
523 Ga0500636_0028588
524 Ga0501084_0058502
525 Ga0501084_0092209
526 Ga0501082_0078700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01863

YgjP-like

YgjP-like, metallopeptidase domain

39

232

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mdx-assembly1.cif.gz_A mechanism of protease dependent dpc repair 0.823 175 237
4jix-assembly1.cif.gz_B crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7821 158 252
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7782 158 258
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7459 158 258
4jix-assembly1.cif.gz_B crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7175 158 252
ID Description Score Start End Superfamily
af_P42597_68_160_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8196 177 252 3.30.2010.10
3cqbA01 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8158 160 219 3.30.2010.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7922 158 256 3.30.2010.10
af_P66948_73_150_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7884 156 222 3.30.2010.10
4jixB00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7821 158 252 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A4R8FCZ9-F1-model_v4 deleted 0.9892 135 255
AF-A0A3A9JT86-F1-model_v4 M48 family peptidase 0.9838 153 255
AF-A0A529Q2S7-F1-model_v4 M48 family metallopeptidase 0.9805 170 254
AF-A0A5A7N5F7-F1-model_v4 YgjP-like metallopeptidase domain-containing protein 0.9783 145 259
AF-A0A3D1TWJ5-F1-model_v4 YgjP-like metallopeptidase domain-containing protein 0.9782 146 238

Map