F371944

General Info

Members Datasets Scaffolds Average Seq Length
263 174 262 327

Family's Representative Sequence

Representative Sequence 3300027364|Ga0209967_1006397|Ga0209967_10063972
Length 370
Sequence MAVKVGINGFGRIGRNIMRAALGDGEIDFVAVNDLTSTATLAHLFKYDSILGNLHADVRAAGDSITVDGDSFKVLSIKDPAQLPWKDLGVEVVFEGTGLFTDRDAAAKHLAAGAKKVIITAPGKKPDLMTVMGVNNQTYDPAKHHIISNASCTTNCLAPFAKVLHESFRIVHGWMTTIHSYTNDQNLLDLPHKDLRRARAAALSMIPTTTGAATAVGQVLPDLKGKLDGIAIRVPTPNVSLVDLAAVVEKTTTKDEVNAAYQSLCVLMLPYAARGELRLGMGTHDTALIERVAAHAAGVGIAMVVPGSNGIAMFLGAAIAEGNAKTAQSLLDGTVGQIDKAAKKGVIHDNAAARYKSRLTRKVRSLAAAK

Samples

Sample ID Description Type Environment
1 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
121 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
122 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
123 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
135 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
136 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.76
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 0.38
Rhizosphere 97.72
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10078409 3300005288 Bacteria 2600
2 Ga0065712_10000323 3300005290 Bacteria 14921
3 Ga0065712_10007420 3300005290 Bacteria 4242
4 Ga0065712_10097926 3300005290 Bacteria 2135
5 Ga0065712_10115271 3300005290 Bacteria 1734
6 Ga0065715_10006910 3300005293 Bacteria 2777
7 Ga0065715_10035853 3300005293 Bacteria 1601
8 Ga0065715_10106464 3300005293 Bacteria 2828
9 Ga0065707_10014735 3300005295 Bacteria 2950
10 Ga0070670_100009177 3300005331 Bacteria 8455
11 Ga0070670_100040869 3300005331 Bacteria 3985
12 Ga0070670_100133641 3300005331 Bacteria 2143
13 Ga0070677_10023855 3300005333 Bacteria 2269
14 Ga0068869_100013748 3300005334 Bacteria 5391
15 Ga0070666_10159647 3300005335 Bacteria 1575
16 Ga0070687_100014123 3300005343 Bacteria 3580
17 Ga0070669_100057629 3300005353 Bacteria 2850
18 Ga0070669_100208503 3300005353 Bacteria 1540
19 Ga0070675_100044630 3300005354 Bacteria 3624
20 Ga0070675_100149554 3300005354 Bacteria 2001
21 Ga0070671_100083793 3300005355 Bacteria 2666
22 Ga0070674_100086428 3300005356 Bacteria 2253
23 Ga0070673_100021965 3300005364 Bacteria 4638
24 Ga0070673_100068886 3300005364 Bacteria 2834
25 Ga0070688_100002252 3300005365 Bacteria 9736
26 Ga0070659_100121898 3300005366 Bacteria 2113
27 Ga0070709_10094109 3300005434 Bacteria 1982
28 Ga0070711_100264429 3300005439 Bacteria 1355
29 Ga0070700_100039490 3300005441 Bacteria 2883
30 Ga0070694_100006691 3300005444 Bacteria 7000
31 Ga0070708_100036347 3300005445 Bacteria 4296
32 Ga0068867_100089018 3300005459 Bacteria 2340
33 Ga0068867_100219370 3300005459 Bacteria 1532
34 Ga0070707_100001725 3300005468 Bacteria 21065
35 Ga0070707_100087924 3300005468 Bacteria 3006
36 Ga0070698_100097305 3300005471 Bacteria 2919
37 Ga0070698_100210785 3300005471 Bacteria 1877
38 Ga0070699_100033137 3300005518 Bacteria 4462
39 Ga0070699_100390729 3300005518 Bacteria 1257
40 Ga0070679_100001140 3300005530 Bacteria 23233
41 Ga0070672_100033246 3300005543 Bacteria 3904
42 Ga0070672_100056295 3300005543 Bacteria 3083
43 Ga0070672_100332337 3300005543 Bacteria 1293
44 Ga0070686_100038171 3300005544 Bacteria 2984
45 Ga0070686_100043563 3300005544 Bacteria 2816
46 Ga0070693_100081922 3300005547 Bacteria 1926
47 Ga0070704_100027870 3300005549 Bacteria 3752
48 Ga0070704_100062322 3300005549 Bacteria 2672
49 Ga0070664_100009500 3300005564 Bacteria 7886
50 Ga0068854_100082573 3300005578 Bacteria 2375
51 Ga0070702_100038951 3300005615 Bacteria 2650
52 Ga0068859_100167488 3300005617 Bacteria 2277
53 Ga0068859_100243277 3300005617 Bacteria 1889
54 Ga0068864_100017940 3300005618 Bacteria 5905
55 Ga0068864_100300843 3300005618 Bacteria 1502
56 Ga0068858_100005505 3300005842 Bacteria 12398
57 Ga0068860_100067922 3300005843 Bacteria 3386
58 Ga0068862_100260533 3300005844 Bacteria 1583
59 Ga0081455_10025985 3300005937 Bacteria 5395
60 Ga0070717_10034261 3300006028 Bacteria 4104
61 Ga0075364_10039090 3300006051 Bacteria 3074
62 Ga0075432_10029236 3300006058 Bacteria 1902
63 Ga0075428_100037571 3300006844 Bacteria 5330
64 Ga0075430_100012425 3300006846 Bacteria 7244
65 Ga0075430_100042827 3300006846 Bacteria 3828
66 Ga0075433_10041676 3300006852 Bacteria 3979
67 Ga0075433_10066018 3300006852 Bacteria 3174
68 Ga0075433_10079995 3300006852 Bacteria 2880
69 Ga0075433_10124552 3300006852 Bacteria 2289
70 Ga0075434_100016570 3300006871 Bacteria 7086
71 Ga0075434_100114589 3300006871 Bacteria 2709
72 Ga0075434_100138231 3300006871 Bacteria 2456
73 Ga0075434_100147901 3300006871 Bacteria 2369
74 Ga0075434_100159001 3300006871 Bacteria 2279
75 Ga0075434_100311885 3300006871 Bacteria 1593
76 Ga0075429_100055717 3300006880 Bacteria 3440
77 Ga0068865_100106682 3300006881 Bacteria 2059
78 Ga0075436_100003507 3300006914 Bacteria 10754
79 Ga0097620_100167488 3300006931 Bacteria 2277
80 Ga0097620_100243257 3300006931 Bacteria 1889
81 Ga0075435_100000569 3300007076 Bacteria 22675
82 Ga0075435_100006343 3300007076 Bacteria 8356
83 Ga0075435_100007710 3300007076 Bacteria 7694
84 Ga0075435_100017869 3300007076 Bacteria 5375
85 Ga0075435_100331708 3300007076 Bacteria 1303
86 Ga0111539_10003958 3300009094 Bacteria 19463
87 Ga0111539_10004760 3300009094 Bacteria 17717
88 Ga0111539_10010949 3300009094 Bacteria 11415
89 Ga0111539_10295943 3300009094 Bacteria 1884
90 Ga0111539_10359366 3300009094 Bacteria 1695
91 Ga0111539_10623056 3300009094 Bacteria 1256
92 Ga0105245_10041387 3300009098 Bacteria 4107
93 Ga0105247_10012167 3300009101 Bacteria 5173
94 Ga0114129_10011729 3300009147 Bacteria 12471
95 Ga0114129_10014871 3300009147 Bacteria 11087
96 Ga0114129_10023072 3300009147 Bacteria 8828
97 Ga0114129_10043470 3300009147 Bacteria 6321
98 Ga0114129_10052581 3300009147 Bacteria 5717
99 Ga0114129_10062829 3300009147 Bacteria 5187
100 Ga0114129_10063432 3300009147 Bacteria 5159
101 Ga0114129_10269237 3300009147 Bacteria 2280
102 Ga0105243_10052005 3300009148 Bacteria 3243
103 Ga0105239_10037399 3300010375 Bacteria 5322
104 Ga0157375_10101915 3300013308 Bacteria 2955
105 Ga0157375_10534423 3300013308 Bacteria 1335
106 Ga0163163_10055039 3300014325 Bacteria 3932
107 Ga0163163_10115821 3300014325 Bacteria 2711
108 Ga0163163_10181894 3300014325 Bacteria 2149
109 Ga0163161_10006174 3300017792 Bacteria 8300
110 Ga0209233_1006389 3300025261 Bacteria 3805
111 Ga0207697_10044550 3300025315 Bacteria 1826
112 Ga0207682_10020962 3300025893 Bacteria 2570
113 Ga0207680_10146750 3300025903 Bacteria 1569
114 Ga0207645_10011952 3300025907 Bacteria 5906
115 Ga0207643_10017640 3300025908 Bacteria 3905
116 Ga0207643_10063712 3300025908 Bacteria 2109
117 Ga0207684_10129317 3300025910 Bacteria 2167
118 Ga0207707_10272511 3300025912 Bacteria 1467
119 Ga0207663_10168629 3300025916 Bacteria 1553
120 Ga0207662_10002158 3300025918 Bacteria 9803
121 Ga0207662_10007267 3300025918 Bacteria 6020
122 Ga0207652_10001901 3300025921 Bacteria 18089
123 Ga0207646_10000005 3300025922 Bacteria 523896
124 Ga0207646_10000094 3300025922 Bacteria 119406
125 Ga0207681_10059961 3300025923 Bacteria 2610
126 Ga0207650_10010274 3300025925 Bacteria 6417
127 Ga0207659_10015705 3300025926 Bacteria 4915
128 Ga0207690_10131790 3300025932 Bacteria 1830
129 Ga0207706_10136995 3300025933 Bacteria 2154
130 Ga0207669_10121685 3300025937 Bacteria 1773
131 Ga0207704_10046009 3300025938 Bacteria 2597
132 Ga0207691_10041719 3300025940 Bacteria 4235
133 Ga0207689_10014135 3300025942 Bacteria 6793
134 Ga0207679_10007122 3300025945 Bacteria 7086
135 Ga0207679_10057768 3300025945 Bacteria 2871
136 Ga0207651_10000958 3300025960 Bacteria 12747
137 Ga0207651_10006634 3300025960 Bacteria 6084
138 Ga0207658_10262174 3300025986 Bacteria 1473
139 Ga0207703_10256064 3300026035 Bacteria 1580
140 Ga0207678_10094726 3300026067 Bacteria 2551
141 Ga0207708_10044151 3300026075 Bacteria 3396
142 Ga0207708_10180234 3300026075 Bacteria 1677
143 Ga0207641_10261403 3300026088 Bacteria 1621
144 Ga0207648_10101891 3300026089 Bacteria 2516
145 Ga0207676_10030742 3300026095 Bacteria 4034
146 Ga0207676_10404105 3300026095 Bacteria 1277
147 Ga0207674_10015147 3300026116 Bacteria 8485
148 Ga0207675_100182058 3300026118 Bacteria 2012
149 Ga0207683_10061088 3300026121 Bacteria 3315
150 Ga0209967_1006397 3300027364 Bacteria 1598
151 Ga0209998_10019147 3300027717 Bacteria 1457
152 Ga0207428_10000751 3300027907 Bacteria 37099
153 Ga0268266_10224427 3300028379 Bacteria 1728
154 Ga0268265_10104850 3300028380 Bacteria 2293
155 Ga0268264_10110084 3300028381 Bacteria 2411
156 Ga0268264_10166181 3300028381 Bacteria 1992
157 Ga0265338_10006160 3300028800 Bacteria 15388
158 Ga0265760_10037131 3300031090 Bacteria 1446
159 Ga0265320_10107051 3300031240 Bacteria 1284
160 Ga0265325_10003342 3300031241 Bacteria 10528
161 Ga0265316_10158750 3300031344 Bacteria 1691
162 Ga0307408_100018432 3300031548 Bacteria 4686
163 Ga0316579_10001011 3300031691 Bacteria 9887
164 Ga0316578_10151150 3300031728 Bacteria 1398
165 Ga0307405_10015827 3300031731 Bacteria 4095
166 Ga0316577_10031676 3300031733 Bacteria 2954
167 Ga0307413_10043591 3300031824 Bacteria 2645
168 Ga0307410_10140813 3300031852 Bacteria 1784
169 Ga0307410_10387504 3300031852 Bacteria 1126
170 Ga0307406_10018854 3300031901 Bacteria 4040
171 Ga0307407_10041634 3300031903 Bacteria 2570
172 Ga0307407_10106094 3300031903 Bacteria 1754
173 Ga0307412_10054414 3300031911 Bacteria 2657
174 Ga0307409_100013075 3300031995 Bacteria 5322
175 Ga0307409_100549801 3300031995 Bacteria 1133
176 Ga0307416_100019729 3300032002 Bacteria 4788
177 Ga0307416_100020579 3300032002 Bacteria 4712
178 Ga0307416_100034332 3300032002 Bacteria 3859
179 Ga0307416_100184855 3300032002 Bacteria 1958
180 Ga0307416_100218020 3300032002 Bacteria 1827
181 Ga0307411_10009084 3300032005 Bacteria 5202
182 Ga0307415_100036047 3300032126 Bacteria 3238
183 Ga0316583_10008383 3300032133 Bacteria 3729
184 Ga0316585_10001311 3300032137 Bacteria 6528
185 Ga0316580_10000762 3300032139 Bacteria 7827
186 Ga0316588_1000621 3300033528 Bacteria 5080
187 Ga0373951_0023878 3300035091 Bacteria 1414
188 Ga0373962_0011744 3300035242 Bacteria 2198
189 Ga0316574_0105076 3300035398 Bacteria 1808
190 Ga0373933_0000935 3300035724 Bacteria 17819
191 Ga0373933_0025443 3300035724 Bacteria 3395
192 Ga0373937_0000048 3300036401 Bacteria 106296
193 Ga0373937_0002653 3300036401 Bacteria 14905
194 Ga0316584_0106283 3300036712 Bacteria 2100
195 Ga0373925_0002373 3300037068 Bacteria 15107
196 Ga0395905_0037418 3300037471 Bacteria 4556
197 Ga0436364_1037995 3300037853 Bacteria 6633
198 Ga0436365_1779329 3300039437 Bacteria 1460
199 Ga0439453_0002059 3300041408 Bacteria 2716
200 Ga0450896_003053 3300042133 Bacteria 2202
201 Ga0450900_012044 3300042136 Bacteria 1130
202 Ga0439464_0026893 3300042439 Bacteria 1598
203 Ga0439464_0027557 3300042439 Bacteria 1580
204 Ga0466967_0207461 3300045976 Bacteria 1858
205 Ga0466967_0479399 3300045976 Bacteria 1219
206 Ga0495584_0059089 3300046491 Bacteria 1929
207 Ga0495598_0006597 3300046537 Bacteria 2628
208 Ga0495634_0158748 3300046642 Bacteria 1427
209 Ga0495634_0224958 3300046642 Bacteria 1156
210 Ga0495646_0168620 3300046680 Bacteria 1208
211 Ga0495674_0206899 3300047319 Bacteria 1627
212 Ga0495675_0015814 3300047444 Bacteria 4772
213 Ga0495602_0002854 3300048088 Bacteria 17704
214 Ga0496102_0188489 3300048905 Bacteria 1944
215 Ga0501034_0010887 3300049571 Bacteria 9448
216 Ga0501039_0276861 3300049575 Bacteria 1319
217 Ga0501040_0271949 3300049576 Bacteria 1210
218 Ga0501041_0236249 3300049577 Bacteria 1148
219 Ga0501047_0004990 3300049581 Bacteria 12456
220 Ga0501067_0098486 3300049583 Bacteria 1624
221 Ga0501072_0006143 3300049588 Bacteria 9157
222 Ga0501073_0158983 3300049589 Bacteria 1566
223 Ga0501076_0049907 3300049592 Bacteria 3310
224 Ga0501077_0038857 3300049593 Bacteria 3031
225 Ga0501081_0130740 3300049743 Bacteria 1794
226 Ga0501083_0224094 3300049744 Bacteria 1225
227 Ga0501044_0003961 3300049823 Bacteria 16585
228 Ga0501045_0014316 3300049824 Bacteria 5620
229 nmdc:mga05p37_146219_c1 3300050507 Bacteria 2894
230 nmdc:mga05p37_166689_c1 3300050507 Bacteria 2688
231 nmdc:mga05p37_232079_c1 3300050507 Bacteria 2223
232 nmdc:mga05p37_23684_c1 3300050507 Bacteria 7454
233 nmdc:mga05p37_282114_c1 3300050507 Bacteria 1980
234 nmdc:mga05p37_31179_c1 3300050507 Bacteria 6511
235 nmdc:mga05p37_41767_c1 3300050507 Bacteria 5631
236 nmdc:mga05p37_478059_c1 3300050507 Bacteria 1436
237 nmdc:mga05p37_87015_c1 3300050507 Bacteria 3851
238 nmdc:mga09592_93254_c1 3300050508 Bacteria 2575
239 nmdc:mga0qj67_14709_c1 3300050509 Bacteria 5917
240 nmdc:mga06r32_68478_c1 3300050510 Bacteria 3429
241 nmdc:mga08y16_327225_c1 3300050511 Bacteria 1577
242 nmdc:mga08y16_341281_c1 3300050511 Bacteria 1540
243 nmdc:mga08y16_5651_c1 3300050511 Bacteria 13102
244 nmdc:mga0n895_36605_c1 3300050512 Bacteria 4740
245 nmdc:mga0n895_428885_c1 3300050512 Bacteria 1336
246 nmdc:mga0rr50_181285_c1 3300050513 Bacteria 1722
247 nmdc:mga0rr50_21314_c1 3300050513 Bacteria 4421
248 nmdc:mga0rr50_7916_c1 3300050513 Bacteria 6593
249 nmdc:mga0rr50_8864_c1 3300050513 Bacteria 6283
250 nmdc:mga0rr50_91029_c1 3300050513 Bacteria 2375
251 nmdc:mga08x19_13845_c2 3300050514 Bacteria 4456
252 nmdc:mga0a205_121861_c1 3300050515 Bacteria 2507
253 nmdc:mga0a205_12273_c1 3300050515 Bacteria 7925
254 nmdc:mga0a205_32931_c1 3300050515 Bacteria 4970
255 nmdc:mga0a205_8057_c1 3300050515 Bacteria 7677
256 Ga0495601_0170600 3300053077 Bacteria 1422
257 Ga0495601_0200455 3300053077 Bacteria 1304
258 Ga0500556_0006025 3300053104 Bacteria 3436
259 Ga0501084_0067395 3300054114 Bacteria 2996
260 Ga0501082_0082701 3300060353 Bacteria 2770
261 Ga0501082_0174470 3300060353 Bacteria 1869
262 Ga0530510_0038382 3300061734 Bacteria 3458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10534423 Ga0157375_105344232 297
2 3300039437 Ga0436365_1779329 Ga0436365_1779329_426_1427 309
3 3300005290 Ga0065712_10097926 Ga0065712_100979262 311
4 3300005293 Ga0065715_10035853 Ga0065715_100358532 311
5 3300017792 Ga0163161_10006174 Ga0163161_100061747 319
6 3300026118 Ga0207675_100182058 Ga0207675_1001820582 319
7 3300031995 Ga0307409_100549801 Ga0307409_1005498011 319
8 3300037068 Ga0373925_0002373 Ga0373925_0002373_7721_8725 319
9 3300046537 Ga0495598_0006597 Ga0495598_0006597_1202_2203 319
10 3300049577 Ga0501041_0236249 Ga0501041_0236249_47_1042 319
11 3300061734 Ga0530510_0038382 Ga0530510_0038382_1606_2601 319
12 3300005434 Ga0070709_10094109 Ga0070709_100941092 320
13 3300031903 Ga0307407_10041634 Ga0307407_100416342 320
14 3300032002 Ga0307416_100184855 Ga0307416_1001848551 320
15 3300035724 Ga0373933_0025443 Ga0373933_0025443_482_1489 320
16 3300036401 Ga0373937_0002653 Ga0373937_0002653_4258_5265 320
17 3300047319 Ga0495674_0206899 Ga0495674_0206899_295_1302 320
18 3300053077 Ga0495601_0170600 Ga0495601_0170600_70_1077 320
19 3300005290 Ga0065712_10007420 Ga0065712_100074204 321
20 3300005290 Ga0065712_10115271 Ga0065712_101152712 321
21 3300005293 Ga0065715_10106464 Ga0065715_101064642 321
22 3300005295 Ga0065707_10014735 Ga0065707_100147352 321
23 3300005331 Ga0070670_100009177 Ga0070670_1000091776 321
24 3300005331 Ga0070670_100040869 Ga0070670_1000408692 321
25 3300005354 Ga0070675_100044630 Ga0070675_1000446303 321
26 3300005354 Ga0070675_100149554 Ga0070675_1001495542 321
27 3300005364 Ga0070673_100021965 Ga0070673_1000219652 321
28 3300005365 Ga0070688_100002252 Ga0070688_1000022523 321
29 3300005543 Ga0070672_100056295 Ga0070672_1000562953 321
30 3300005544 Ga0070686_100038171 Ga0070686_1000381712 321
31 3300005564 Ga0070664_100009500 Ga0070664_1000095006 321
32 3300005618 Ga0068864_100017940 Ga0068864_1000179402 321
33 3300005842 Ga0068858_100005505 Ga0068858_1000055054 321
34 3300006846 Ga0075430_100042827 Ga0075430_1000428272 321
35 3300006880 Ga0075429_100055717 Ga0075429_1000557173 321
36 3300009094 Ga0111539_10003958 Ga0111539_1000395816 321
37 3300009094 Ga0111539_10004760 Ga0111539_1000476017 321
38 3300009094 Ga0111539_10359366 Ga0111539_103593662 321
39 3300009101 Ga0105247_10012167 Ga0105247_100121672 321
40 3300009147 Ga0114129_10052581 Ga0114129_100525815 321
41 3300009147 Ga0114129_10062829 Ga0114129_100628292 321
42 3300013308 Ga0157375_10101915 Ga0157375_101019152 321
43 3300014325 Ga0163163_10055039 Ga0163163_100550392 321
44 3300014325 Ga0163163_10115821 Ga0163163_101158212 321
45 3300025893 Ga0207682_10020962 Ga0207682_100209622 321
46 3300025908 Ga0207643_10017640 Ga0207643_100176403 321
47 3300025908 Ga0207643_10063712 Ga0207643_100637122 321
48 3300025918 Ga0207662_10007267 Ga0207662_100072674 321
49 3300025923 Ga0207681_10059961 Ga0207681_100599612 321
50 3300025925 Ga0207650_10010274 Ga0207650_100102744 321
51 3300025926 Ga0207659_10015705 Ga0207659_100157052 321
52 3300025940 Ga0207691_10041719 Ga0207691_100417192 321
53 3300025945 Ga0207679_10007122 Ga0207679_100071224 321
54 3300025960 Ga0207651_10006634 Ga0207651_100066345 321
55 3300026088 Ga0207641_10261403 Ga0207641_102614032 321
56 3300026095 Ga0207676_10030742 Ga0207676_100307422 321
57 3300027907 Ga0207428_10000751 Ga0207428_100007515 321
58 3300028379 Ga0268266_10224427 Ga0268266_102244271 321
59 3300028381 Ga0268264_10166181 Ga0268264_101661812 321
60 3300032002 Ga0307416_100218020 Ga0307416_1002180201 321
61 3300049575 Ga0501039_0276861 Ga0501039_0276861_181_1188 321
62 3300049588 Ga0501072_0006143 Ga0501072_0006143_4380_5387 321
63 3300049592 Ga0501076_0049907 Ga0501076_0049907_1025_2032 321
64 3300049593 Ga0501077_0038857 Ga0501077_0038857_697_1704 321
65 3300049744 Ga0501083_0224094 Ga0501083_0224094_167_1174 321
66 3300049824 Ga0501045_0014316 Ga0501045_0014316_698_1705 321
67 3300050507 nmdc:mga05p37_166689_c1 nmdc:mga05p37_166689_c1_1438_2445 321
68 3300050507 nmdc:mga05p37_232079_c1 nmdc:mga05p37_232079_c1_421_1428 321
69 3300050508 nmdc:mga09592_93254_c1 nmdc:mga09592_93254_c1_880_1887 321
70 3300050509 nmdc:mga0qj67_14709_c1 nmdc:mga0qj67_14709_c1_1273_2283 321
71 3300050511 nmdc:mga08y16_327225_c1 nmdc:mga08y16_327225_c1_201_1208 321
72 3300050511 nmdc:mga08y16_5651_c1 nmdc:mga08y16_5651_c1_5157_6164 321
73 3300054114 Ga0501084_0067395 Ga0501084_0067395_1639_2646 321
74 3300060353 Ga0501082_0174470 Ga0501082_0174470_526_1533 321
75 3300005293 Ga0065715_10006910 Ga0065715_100069102 322
76 3300005333 Ga0070677_10023855 Ga0070677_100238552 322
77 3300005334 Ga0068869_100013748 Ga0068869_1000137483 322
78 3300005335 Ga0070666_10159647 Ga0070666_101596472 322
79 3300005343 Ga0070687_100014123 Ga0070687_1000141233 322
80 3300005353 Ga0070669_100208503 Ga0070669_1002085032 322
81 3300005355 Ga0070671_100083793 Ga0070671_1000837932 322
82 3300005356 Ga0070674_100086428 Ga0070674_1000864281 322
83 3300005364 Ga0070673_100068886 Ga0070673_1000688862 322
84 3300005366 Ga0070659_100121898 Ga0070659_1001218981 322
85 3300005441 Ga0070700_100039490 Ga0070700_1000394902 322
86 3300005459 Ga0068867_100089018 Ga0068867_1000890182 322
87 3300005543 Ga0070672_100033246 Ga0070672_1000332462 322
88 3300005544 Ga0070686_100043563 Ga0070686_1000435632 322
89 3300005547 Ga0070693_100081922 Ga0070693_1000819222 322
90 3300005549 Ga0070704_100027870 Ga0070704_1000278702 322
91 3300005549 Ga0070704_100062322 Ga0070704_1000623222 322
92 3300005578 Ga0068854_100082573 Ga0068854_1000825732 322
93 3300005615 Ga0070702_100038951 Ga0070702_1000389512 322
94 3300005617 Ga0068859_100167488 Ga0068859_1001674882 322
95 3300005843 Ga0068860_100067922 Ga0068860_1000679223 322
96 3300006871 Ga0075434_100138231 Ga0075434_1001382312 322
97 3300006931 Ga0097620_100167488 Ga0097620_1001674882 322
98 3300007076 Ga0075435_100000569 Ga0075435_1000005695 322
99 3300009098 Ga0105245_10041387 Ga0105245_100413873 322
100 3300009148 Ga0105243_10052005 Ga0105243_100520053 322
101 3300010375 Ga0105239_10037399 Ga0105239_100373993 322
102 3300025315 Ga0207697_10044550 Ga0207697_100445502 322
103 3300025903 Ga0207680_10146750 Ga0207680_101467501 322
104 3300025907 Ga0207645_10011952 Ga0207645_100119522 322
105 3300025918 Ga0207662_10002158 Ga0207662_100021587 322
106 3300025932 Ga0207690_10131790 Ga0207690_101317902 322
107 3300025933 Ga0207706_10136995 Ga0207706_101369952 322
108 3300025937 Ga0207669_10121685 Ga0207669_101216852 322
109 3300025938 Ga0207704_10046009 Ga0207704_100460091 322
110 3300025942 Ga0207689_10014135 Ga0207689_100141354 322
111 3300025945 Ga0207679_10057768 Ga0207679_100577682 322
112 3300025960 Ga0207651_10000958 Ga0207651_100009585 322
113 3300026035 Ga0207703_10256064 Ga0207703_102560641 322
114 3300026067 Ga0207678_10094726 Ga0207678_100947262 322
115 3300026075 Ga0207708_10044151 Ga0207708_100441512 322
116 3300026089 Ga0207648_10101891 Ga0207648_101018912 322
117 3300026116 Ga0207674_10015147 Ga0207674_100151479 322
118 3300026121 Ga0207683_10061088 Ga0207683_100610883 322
119 3300028381 Ga0268264_10110084 Ga0268264_101100841 322
120 3300035091 Ga0373951_0023878 Ga0373951_0023878_289_1296 322
121 3300035242 Ga0373962_0011744 Ga0373962_0011744_204_1211 322
122 3300046491 Ga0495584_0059089 Ga0495584_0059089_733_1800 322
123 3300046642 Ga0495634_0158748 Ga0495634_0158748_254_1261 322
124 3300048905 Ga0496102_0188489 Ga0496102_0188489_407_1414 322
125 3300049583 Ga0501067_0098486 Ga0501067_0098486_11_1018 322
126 3300050513 nmdc:mga0rr50_8864_c1 nmdc:mga0rr50_8864_c1_2717_3724 322
127 3300005444 Ga0070694_100006691 Ga0070694_1000066918 323
128 3300006852 Ga0075433_10066018 Ga0075433_100660183 323
129 3300009147 Ga0114129_10011729 Ga0114129_1001172913 323
130 3300031911 Ga0307412_10054414 Ga0307412_100544142 323
131 3300032002 Ga0307416_100034332 Ga0307416_1000343322 323
132 3300049576 Ga0501040_0271949 Ga0501040_0271949_49_1056 323
133 3300050515 nmdc:mga0a205_121861_c1 nmdc:mga0a205_121861_c1_1454_2461 323
134 3300032002 Ga0307416_100019729 Ga0307416_1000197293 324
135 3300050507 nmdc:mga05p37_87015_c1 nmdc:mga05p37_87015_c1_2238_3266 324
136 3300007076 Ga0075435_100017869 Ga0075435_1000178692 325
137 3300009147 Ga0114129_10269237 Ga0114129_102692372 325
138 3300042133 Ga0450896_003053 Ga0450896_003053_356_1363 325
139 3300042439 Ga0439464_0027557 Ga0439464_0027557_497_1492 325
140 3300049589 Ga0501073_0158983 Ga0501073_0158983_226_1230 325
141 3300050513 nmdc:mga0rr50_21314_c1 nmdc:mga0rr50_21314_c1_463_1470 325
142 3300005331 Ga0070670_100133641 Ga0070670_1001336412 326
143 3300005618 Ga0068864_100300843 Ga0068864_1003008431 326
144 3300006881 Ga0068865_100106682 Ga0068865_1001066822 326
145 3300026095 Ga0207676_10404105 Ga0207676_104041051 326
146 3300005518 Ga0070699_100390729 Ga0070699_1003907291 327
147 3300005937 Ga0081455_10025985 Ga0081455_100259852 328
148 3300006852 Ga0075433_10079995 Ga0075433_100799953 328
149 3300006871 Ga0075434_100147901 Ga0075434_1001479012 328
150 3300050512 nmdc:mga0n895_36605_c1 nmdc:mga0n895_36605_c1_3293_4300 328
151 3300050515 nmdc:mga0a205_8057_c1 nmdc:mga0a205_8057_c1_6275_7282 328
152 3300027364 Ga0209967_1006397 Ga0209967_10063972 331
153 3300053104 Ga0500556_0006025 Ga0500556_0006025_1947_2942 331
154 iso_pu_bacteria 3006969106 3006971491 331
155 3300006871 Ga0075434_100159001 Ga0075434_1001590012 332
156 3300031691 Ga0316579_10001011 Ga0316579_100010115 333
157 3300031728 Ga0316578_10151150 Ga0316578_101511502 333
158 3300031733 Ga0316577_10031676 Ga0316577_100316763 333
159 3300032133 Ga0316583_10008383 Ga0316583_100083835 333
160 3300032137 Ga0316585_10001311 Ga0316585_100013112 333
161 3300032139 Ga0316580_10000762 Ga0316580_100007629 333
162 3300033528 Ga0316588_1000621 Ga0316588_10006215 333
163 3300035398 Ga0316574_0105076 Ga0316574_0105076_263_1267 333
164 3300036712 Ga0316584_0106283 Ga0316584_0106283_263_1267 333
165 3300050507 nmdc:mga05p37_282114_c1 nmdc:mga05p37_282114_c1_564_1571 333
166 3300005468 Ga0070707_100001725 Ga0070707_10000172517 334
167 3300005468 Ga0070707_100087924 Ga0070707_1000879241 334
168 3300005518 Ga0070699_100033137 Ga0070699_1000331374 334
169 3300006028 Ga0070717_10034261 Ga0070717_100342613 334
170 3300025910 Ga0207684_10129317 Ga0207684_101293172 334
171 3300025922 Ga0207646_10000005 Ga0207646_10000005267 334
172 3300025922 Ga0207646_10000094 Ga0207646_1000009457 334
173 3300028800 Ga0265338_10006160 Ga0265338_100061604 334
174 3300031090 Ga0265760_10037131 Ga0265760_100371311 334
175 3300031240 Ga0265320_10107051 Ga0265320_101070511 334
176 3300031241 Ga0265325_10003342 Ga0265325_100033426 334
177 3300031344 Ga0265316_10158750 Ga0265316_101587502 334
178 3300035724 Ga0373933_0000935 Ga0373933_0000935_5478_6482 334
179 3300036401 Ga0373937_0000048 Ga0373937_0000048_47575_48579 334
180 3300045976 Ga0466967_0207461 Ga0466967_0207461_290_1294 334
181 3300046680 Ga0495646_0168620 Ga0495646_0168620_77_1081 334
182 3300047444 Ga0495675_0015814 Ga0495675_0015814_3209_4213 334
183 3300048088 Ga0495602_0002854 Ga0495602_0002854_9954_10958 334
184 3300005288 Ga0065714_10078409 Ga0065714_100784092 335
185 3300005290 Ga0065712_10000323 Ga0065712_100003237 335
186 3300005353 Ga0070669_100057629 Ga0070669_1000576292 335
187 3300005439 Ga0070711_100264429 Ga0070711_1002644291 335
188 3300005445 Ga0070708_100036347 Ga0070708_1000363475 335
189 3300005459 Ga0068867_100219370 Ga0068867_1002193701 335
190 3300005471 Ga0070698_100097305 Ga0070698_1000973052 335
191 3300005471 Ga0070698_100210785 Ga0070698_1002107852 335
192 3300005530 Ga0070679_100001140 Ga0070679_10000114017 335
193 3300005543 Ga0070672_100332337 Ga0070672_1003323372 335
194 3300005617 Ga0068859_100243277 Ga0068859_1002432772 335
195 3300005844 Ga0068862_100260533 Ga0068862_1002605332 335
196 3300006051 Ga0075364_10039090 Ga0075364_100390902 335
197 3300006058 Ga0075432_10029236 Ga0075432_100292362 335
198 3300006844 Ga0075428_100037571 Ga0075428_1000375715 335
199 3300006846 Ga0075430_100012425 Ga0075430_1000124255 335
200 3300006852 Ga0075433_10041676 Ga0075433_100416763 335
201 3300006852 Ga0075433_10124552 Ga0075433_101245522 335
202 3300006871 Ga0075434_100016570 Ga0075434_1000165702 335
203 3300006871 Ga0075434_100114589 Ga0075434_1001145892 335
204 3300006871 Ga0075434_100311885 Ga0075434_1003118852 335
205 3300006914 Ga0075436_100003507 Ga0075436_1000035078 335
206 3300006931 Ga0097620_100243257 Ga0097620_1002432572 335
207 3300007076 Ga0075435_100006343 Ga0075435_1000063437 335
208 3300007076 Ga0075435_100007710 Ga0075435_1000077104 335
209 3300007076 Ga0075435_100331708 Ga0075435_1003317082 335
210 3300009094 Ga0111539_10010949 Ga0111539_100109493 335
211 3300009094 Ga0111539_10295943 Ga0111539_102959432 335
212 3300009094 Ga0111539_10623056 Ga0111539_106230561 335
213 3300009147 Ga0114129_10014871 Ga0114129_100148713 335
214 3300009147 Ga0114129_10023072 Ga0114129_100230722 335
215 3300009147 Ga0114129_10043470 Ga0114129_100434701 335
216 3300009147 Ga0114129_10063432 Ga0114129_100634324 335
217 3300014325 Ga0163163_10181894 Ga0163163_101818942 335
218 3300025261 Ga0209233_1006389 Ga0209233_10063892 335
219 3300025912 Ga0207707_10272511 Ga0207707_102725112 335
220 3300025916 Ga0207663_10168629 Ga0207663_101686292 335
221 3300025921 Ga0207652_10001901 Ga0207652_1000190115 335
222 3300025986 Ga0207658_10262174 Ga0207658_102621742 335
223 3300026075 Ga0207708_10180234 Ga0207708_101802341 335
224 3300027717 Ga0209998_10019147 Ga0209998_100191471 335
225 3300028380 Ga0268265_10104850 Ga0268265_101048501 335
226 3300031548 Ga0307408_100018432 Ga0307408_1000184324 335
227 3300031731 Ga0307405_10015827 Ga0307405_100158275 335
228 3300031824 Ga0307413_10043591 Ga0307413_100435912 335
229 3300031852 Ga0307410_10140813 Ga0307410_101408132 335
230 3300031852 Ga0307410_10387504 Ga0307410_103875041 335
231 3300031901 Ga0307406_10018854 Ga0307406_100188545 335
232 3300031903 Ga0307407_10106094 Ga0307407_101060942 335
233 3300031995 Ga0307409_100013075 Ga0307409_1000130752 335
234 3300032002 Ga0307416_100020579 Ga0307416_1000205792 335
235 3300032005 Ga0307411_10009084 Ga0307411_100090845 335
236 3300032126 Ga0307415_100036047 Ga0307415_1000360472 335
237 3300037471 Ga0395905_0037418 Ga0395905_0037418_985_1992 335
238 3300037853 Ga0436364_1037995 Ga0436364_1037995_4995_6002 335
239 3300041408 Ga0439453_0002059 Ga0439453_0002059_1475_2488 335
240 3300042136 Ga0450900_012044 Ga0450900_012044_69_1076 335
241 3300042439 Ga0439464_0026893 Ga0439464_0026893_333_1340 335
242 3300045976 Ga0466967_0479399 Ga0466967_0479399_74_1081 335
243 3300046642 Ga0495634_0224958 Ga0495634_0224958_14_1021 335
244 3300049571 Ga0501034_0010887 Ga0501034_0010887_3077_4084 335
245 3300049581 Ga0501047_0004990 Ga0501047_0004990_3303_4310 335
246 3300049743 Ga0501081_0130740 Ga0501081_0130740_720_1727 335
247 3300049823 Ga0501044_0003961 Ga0501044_0003961_1195_2202 335
248 3300050507 nmdc:mga05p37_146219_c1 nmdc:mga05p37_146219_c1_269_1276 335
249 3300050507 nmdc:mga05p37_23684_c1 nmdc:mga05p37_23684_c1_2961_3968 335
250 3300050507 nmdc:mga05p37_31179_c1 nmdc:mga05p37_31179_c1_1317_2324 335
251 3300050507 nmdc:mga05p37_41767_c1 nmdc:mga05p37_41767_c1_67_1074 335
252 3300050507 nmdc:mga05p37_478059_c1 nmdc:mga05p37_478059_c1_43_1050 335
253 3300050510 nmdc:mga06r32_68478_c1 nmdc:mga06r32_68478_c1_1077_2090 335
254 3300050511 nmdc:mga08y16_341281_c1 nmdc:mga08y16_341281_c1_292_1299 335
255 3300050512 nmdc:mga0n895_428885_c1 nmdc:mga0n895_428885_c1_66_1073 335
256 3300050513 nmdc:mga0rr50_181285_c1 nmdc:mga0rr50_181285_c1_401_1408 335
257 3300050513 nmdc:mga0rr50_7916_c1 nmdc:mga0rr50_7916_c1_4295_5302 335
258 3300050513 nmdc:mga0rr50_91029_c1 nmdc:mga0rr50_91029_c1_875_1882 335
259 3300050514 nmdc:mga08x19_13845_c2 nmdc:mga08x19_13845_c2_2247_3254 335
260 3300050515 nmdc:mga0a205_12273_c1 nmdc:mga0a205_12273_c1_4310_5317 335
261 3300050515 nmdc:mga0a205_32931_c1 nmdc:mga0a205_32931_c1_3028_4035 335
262 3300053077 Ga0495601_0200455 Ga0495601_0200455_217_1224 335
263 3300060353 Ga0501082_0082701 Ga0501082_0082701_1633_2640 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00044

Gp_dh_N

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain

3

103

0.99

PF02800

Gp_dh_C

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain

157

275

0.97

PF01649

Ribosomal_S20p

Ribosomal protein S20

314

364

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dib-assembly2.cif.gz_C the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9689 3 332
4dib-assembly1.cif.gz_E the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9685 3 332
4dib-assembly1.cif.gz_D the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9658 3 332
2i5p-assembly1.cif.gz_P crystal structure of glyceraldehyde-3-phosphate dehydrogenase isoform 1 from k. marxianus 0.9653 3 330
1vsu-assembly1.cif.gz_A crystal structure of apo-glyceraldehyde 3-phosphate dehydrogenase from cryptosporidium parvum 0.9649 2 335
ID Description Score Start End Superfamily
af_F1M269_1_75_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9761 79 155 3.40.50.720
af_Q2G032_1_148_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9699 1 149 3.40.50.720
1hdgO01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9689 3 149 3.40.50.720
af_M0RCH4_11_120_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9673 202 314 3.30.360.10
af_F1M004_3_96_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9658 235 314 3.30.360.10
ID Description Score Start End GO Terms
AF-A5Z1X9-F1-model_v4 Chloroplast glyceraldehyde-3-phosphate dehydrogenase 0.9935 236 317 GO:0016620
AF-A0A239P280-F1-model_v4 Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain 0.9921 77 167 GO:0006096
GO:0016620
GO:0051287
AF-A0A7C3X0N2-F1-model_v4 Type I glyceraldehyde-3-phosphate dehydrogenase 0.9867 1 135 GO:0006096
GO:0016620
GO:0051287
AF-A0A357V737-F1-model_v4 Erythrose-4-phosphate dehydrogenase (EC 1.2.1.12) 0.9857 233 321 GO:0004365
AF-A0A6J7NT40-F1-model_v4 Unannotated protein 0.9843 224 332 GO:0016620

Feature Viewer

pLDDT pTM Quality
90.43 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map