F372014

General Info

Members Datasets Scaffolds Average Seq Length
263 171 526 203

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0005237|Ga0395899_0005237_6283_6996
Length 237
Sequence MMTIIIHGVKPLMTVDINVYWSLHAGVIPRGREMKITKAQAQANRAHVVETASALFRERGYDGVGVADLMAAAGFTHGGFYKQFRSKADLIAESAACGIAQTAVLTTGLDMSEFVQRYLSREHRDARATGCTMAALGGDAARQPEAVRATFAAGIESLLAALGSGGSASDGADTGESRAMTLDILAHAVGAIVMSRACPDDSPLADEILAICRDRILASLSTPATAGTPDSQPDRTG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
94 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
95 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
107 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
108 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
111 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
150 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
151 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
152 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
156 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
157 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
158 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
159 2643221672 Variovorax sp. Root434 Isolate Unclassified
160 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
161 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
162 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
163 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
164 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
165 2818991457 Xanthomonas translucens 569 Isolate Unclassified
166 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
167 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
168 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
169 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
170 2928163908 Burkholderia sp. 567 Isolate Unclassified
171 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.54
Metatranscriptomes 0.76
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.41
Nodule 1.52
Rhizoplane 3.42
Rhizosphere 60.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0005237 3300037312 Bacteria 10081
2 Ga0055535_1007869 3300003761 Bacteria 1980
3 Ga0055536_1000398 3300003781 Bacteria 31589
4 Ga0055536_1000425 3300003781 Bacteria 30112
5 Ga0055540_1000092 3300003792 Bacteria 98476
6 Ga0055531_10000084 3300003794 Bacteria 102550
7 Ga0070658_10024049 3300005327 Bacteria 4889
8 Ga0070658_10094432 3300005327 Bacteria 2468
9 Ga0068869_100632590 3300005334 Bacteria 907
10 Ga0070660_100010734 3300005339 Bacteria 6483
11 Ga0070660_100083771 3300005339 Bacteria 2506
12 Ga0070661_100047192 3300005344 Bacteria 3152
13 Ga0070659_100011703 3300005366 Bacteria 6494
14 Ga0070659_100233668 3300005366 Bacteria 1520
15 Ga0070667_100170784 3300005367 Bacteria 1919
16 Ga0070662_100034051 3300005457 Bacteria 3590
17 Ga0070684_100219634 3300005535 Bacteria 1734
18 Ga0068855_100083320 3300005563 Bacteria 3704
19 Ga0070664_100043142 3300005564 Bacteria 3805
20 Ga0068857_100002663 3300005577 Bacteria 14658
21 Ga0068857_100722627 3300005577 Bacteria 947
22 Ga0068857_100838793 3300005577 Bacteria 879
23 Ga0068856_100107004 3300005614 Bacteria 2792
24 Ga0068852_100010677 3300005616 Bacteria 6876
25 Ga0068852_101158070 3300005616 Bacteria 794
26 Ga0068861_100028681 3300005719 Bacteria 4063
27 Ga0068862_100149501 3300005844 Bacteria 2078
28 Ga0075367_10037683 3300006178 Bacteria 2811
29 Ga0075366_10008537 3300006195 Bacteria 5700
30 Ga0075370_10013506 3300006353 Bacteria 4344
31 Ga0075370_10020293 3300006353 Bacteria 3630
32 Ga0068865_100304177 3300006881 Bacteria 1277
33 Ga0079104_1000064 3300006946 Bacteria 159242
34 Ga0099826_10000536 3300006948 Bacteria 18784
35 Ga0105251_10000029 3300009011 Bacteria 125097
36 Ga0105244_10002718 3300009036 Bacteria 13226
37 Ga0105244_10037766 3300009036 Bacteria 2522
38 Ga0105250_10028381 3300009092 Bacteria 2254
39 Ga0105240_10000645 3300009093 Bacteria 64351
40 Ga0105240_10005228 3300009093 Bacteria 19411
41 Ga0105243_10000604 3300009148 Bacteria 35803
42 Ga0105243_10078782 3300009148 Bacteria 2684
43 Ga0105241_10017442 3300009174 Bacteria 5278
44 Ga0105241_10354034 3300009174 Bacteria 1276
45 Ga0105242_10044338 3300009176 Bacteria 3602
46 Ga0105242_10180120 3300009176 Bacteria 1864
47 Ga0105237_10054543 3300009545 Bacteria 4005
48 Ga0105239_10046934 3300010375 Bacteria 4732
49 Ga0105239_10157242 3300010375 Bacteria 2539
50 Ga0157373_10087900 3300013100 Bacteria 2190
51 Ga0157373_10102376 3300013100 Bacteria 2015
52 Ga0157373_10356767 3300013100 Bacteria 1043
53 Ga0157371_10000040 3300013102 Bacteria 207451
54 Ga0157371_10385951 3300013102 Bacteria 1023
55 Ga0157370_10046129 3300013104 Bacteria 4178
56 Ga0157370_10061310 3300013104 Bacteria 3570
57 Ga0157369_10000186 3300013105 Bacteria 85966
58 Ga0157374_10413754 3300013296 Bacteria 1346
59 Ga0157378_10008575 3300013297 Bacteria 8898
60 Ga0163162_10432353 3300013306 Bacteria 1448
61 Ga0157372_10220252 3300013307 Bacteria 2200
62 Ga0182008_10000251 3300014497 Bacteria 41625
63 Ga0182008_10002737 3300014497 Bacteria 10932
64 Ga0157379_10712813 3300014968 Bacteria 942
65 Ga0157376_10362278 3300014969 Bacteria 1391
66 Ga0182006_1000193 3300015261 Bacteria 62779
67 Ga0182006_1006842 3300015261 Bacteria 5262
68 Ga0182006_1009631 3300015261 Bacteria 4324
69 Ga0182006_1108561 3300015261 Bacteria 976
70 Ga0182007_10100475 3300015262 Bacteria 957
71 Ga0182005_1000355 3300015265 Bacteria 25795
72 Ga0182005_1006030 3300015265 Bacteria 3743
73 Ga0163161_10009711 3300017792 Bacteria 6663
74 Ga0163161_10018211 3300017792 Bacteria 4924
75 Ga0206354_10785190 3300020081 Bacteria 1930
76 Ga0206353_10752385 3300020082 Bacteria 1757
77 Ga0209147_100144 3300025229 Bacteria 106567
78 Ga0209258_100227 3300025242 Bacteria 106567
79 Ga0209148_1000628 3300025254 Bacteria 31272
80 Ga0209759_1002283 3300025256 Bacteria 8656
81 Ga0209455_1000222 3300025272 Bacteria 78507
82 Ga0209673_1012529 3300025273 Bacteria 3410
83 Ga0209676_1000123 3300025292 Bacteria 195351
84 Ga0209676_1000190 3300025292 Bacteria 140482
85 Ga0209050_1000188 3300025298 Bacteria 138865
86 Ga0209051_1000091 3300025303 Bacteria 173683
87 Ga0209257_1000057 3300025304 Bacteria 396985
88 Ga0207655_1004762 3300025728 Bacteria 9467
89 Ga0207713_1000112 3300025735 Bacteria 133341
90 Ga0207705_10018600 3300025909 Bacteria 4966
91 Ga0207705_10137867 3300025909 Bacteria 1820
92 Ga0207654_10084870 3300025911 Bacteria 1915
93 Ga0207695_10000547 3300025913 Bacteria 78059
94 Ga0207695_10002506 3300025913 Bacteria 26998
95 Ga0207695_10188815 3300025913 Bacteria 1979
96 Ga0207671_10007787 3300025914 Bacteria 9222
97 Ga0207671_10330231 3300025914 Bacteria 1207
98 Ga0207657_10000195 3300025919 Bacteria 63084
99 Ga0207657_10033701 3300025919 Bacteria 4614
100 Ga0207657_10075759 3300025919 Bacteria 2839
101 Ga0207649_10049743 3300025920 Bacteria 2590
102 Ga0207694_10055769 3300025924 Bacteria 3068
103 Ga0207687_10648600 3300025927 Bacteria 893
104 Ga0207690_10000038 3300025932 Bacteria 136549
105 Ga0207690_10023840 3300025932 Bacteria 3825
106 Ga0207706_10021587 3300025933 Bacteria 5780
107 Ga0207709_10795407 3300025935 Bacteria 763
108 Ga0207704_10146289 3300025938 Bacteria 1661
109 Ga0207689_10143499 3300025942 Bacteria 1967
110 Ga0207679_10548183 3300025945 Bacteria 1037
111 Ga0207667_10009946 3300025949 Bacteria 11156
112 Ga0207658_10351233 3300025986 Bacteria 1284
113 Ga0207678_10008324 3300026067 Bacteria 9140
114 Ga0207678_10482291 3300026067 Bacteria 1080
115 Ga0207674_10011039 3300026116 Bacteria 10159
116 Ga0207674_10385109 3300026116 Bacteria 1356
117 Ga0207674_10406754 3300026116 Bacteria 1315
118 Ga0207675_100024055 3300026118 Bacteria 5663
119 Ga0207698_10065786 3300026142 Bacteria 2850
120 Ga0207698_11016679 3300026142 Bacteria 840
121 Ga0209281_1000009 3300027111 Bacteria 771717
122 Ga0209282_1052035 3300027666 Bacteria 2342
123 Ga0307515_10000053 3300028794 Bacteria 266512
124 Ga0307408_100000026 3300031548 Bacteria 261688
125 Ga0307408_100704859 3300031548 Bacteria 908
126 Ga0307508_10000892 3300031616 Bacteria 34774
127 Ga0307412_10000482 3300031911 Bacteria 23818
128 Ga0307414_10942498 3300032004 Bacteria 793
129 Ga0307510_10248842 3300033180 Bacteria 1266
130 Ga0373950_0001137 3300034818 Bacteria 3413
131 Ga0373951_0015679 3300035091 Bacteria 1708
132 Ga0373939_0000047 3300035114 Bacteria 43790
133 Ga0373960_0009350 3300035121 Bacteria 2372
134 Ga0373962_0014787 3300035242 Bacteria 1993
135 Ga0373931_0065477 3300035691 Bacteria 1969
136 Ga0395899_0000023 3300037312 Bacteria 367159
137 Ga0395900_0000019 3300037418 Bacteria 357240
138 Ga0395900_0000438 3300037418 Bacteria 59867
139 Ga0395900_0134416 3300037418 Bacteria 2533
140 Ga0395898_0000016 3300037466 Bacteria 435585
141 Ga0395898_0001621 3300037466 Bacteria 30522
142 Ga0395898_0028754 3300037466 Bacteria 5571
143 Ga0395898_0135277 3300037466 Bacteria 2360
144 Ga0395905_0003423 3300037471 Bacteria 16977
145 Ga0395905_0083631 3300037471 Bacteria 2990
146 Ga0395905_0178527 3300037471 Bacteria 1993
147 Ga0395901_0000498 3300038443 Bacteria 45527
148 Ga0395901_0297203 3300038443 Bacteria 1674
149 Ga0439436_0126270 3300041404 Bacteria 716
150 Ga0439466_0040015 3300041411 Bacteria 1569
151 Ga0439448_0000746 3300042005 Bacteria 7861
152 Ga0439432_000026 3300042006 Bacteria 50283
153 Ga0439455_0014202 3300042012 Bacteria 1816
154 Ga0439458_0001212 3300042157 Bacteria 6533
155 Ga0439464_0048542 3300042439 Bacteria 1223
156 Ga0439440_0035462 3300042993 Bacteria 1196
157 Ga0495617_002094 3300046452 Bacteria 8243
158 Ga0495617_051271 3300046452 Bacteria 1372
159 Ga0495638_0000124 3300046460 Bacteria 125417
160 Ga0495638_0029591 3300046460 Bacteria 3532
161 Ga0495638_0054070 3300046460 Bacteria 2497
162 Ga0495585_0215732 3300046492 Bacteria 970
163 Ga0495607_0001075 3300046501 Bacteria 24954
164 Ga0495610_0033151 3300046512 Bacteria 2673
165 Ga0495616_0067386 3300046513 Bacteria 1740
166 Ga0495616_0077905 3300046513 Bacteria 1590
167 Ga0495631_0000793 3300046518 Bacteria 20196
168 Ga0495632_0011725 3300046519 Bacteria 5103
169 Ga0495637_0054031 3300046520 Bacteria 1670
170 Ga0495621_0009784 3300046539 Bacteria 2922
171 Ga0495597_0000019 3300046542 Bacteria 164636
172 Ga0495622_0212784 3300046557 Bacteria 858
173 Ga0495633_0001936 3300046558 Bacteria 15058
174 Ga0495633_0002852 3300046558 Bacteria 11878
175 Ga0495633_0017028 3300046558 Bacteria 3728
176 Ga0495668_0015701 3300046616 Bacteria 4414
177 Ga0495611_0003059 3300046648 Bacteria 7435
178 Ga0495625_0046606 3300046660 Bacteria 3127
179 Ga0495672_0006832 3300047320 Bacteria 8714
180 Ga0495687_112474 3300047443 Bacteria 998
181 Ga0495681_0042012 3300047470 Bacteria 2216
182 Ga0496100_0810036 3300048903 Bacteria 734
183 Ga0496100_0816795 3300048903 Bacteria 731
184 Ga0496103_0152431 3300048906 Bacteria 1481
185 Ga0496104_0028822 3300048907 Bacteria 5146
186 Ga0496107_0527992 3300048910 Bacteria 875
187 Ga0496113_0178538 3300048916 Bacteria 1683
188 Ga0496116_0000593 3300048919 Bacteria 48320
189 Ga0496116_0040732 3300048919 Bacteria 3195
190 Ga0496116_0042740 3300048919 Bacteria 3094
191 Ga0496116_0055252 3300048919 Bacteria 2609
192 Ga0496116_0289750 3300048919 Bacteria 787
193 Ga0496117_0008329 3300048920 Bacteria 9864
194 Ga0496117_0076724 3300048920 Bacteria 2214
195 Ga0496117_0111231 3300048920 Bacteria 1706
196 Ga0496117_0180081 3300048920 Bacteria 1216
197 Ga0496117_0320493 3300048920 Bacteria 812
198 Ga0496118_0000074 3300048921 Bacteria 196515
199 Ga0496118_0002433 3300048921 Bacteria 25052
200 Ga0496118_0004887 3300048921 Bacteria 15588
201 Ga0496118_0016826 3300048921 Bacteria 6684
202 Ga0496118_0018342 3300048921 Bacteria 6318
203 Ga0496118_0032612 3300048921 Bacteria 4286
204 Ga0496118_0065976 3300048921 Bacteria 2644
205 Ga0496118_0146102 3300048921 Bacteria 1488
206 Ga0496118_0162220 3300048921 Bacteria 1380
207 Ga0496118_0209454 3300048921 Bacteria 1145
208 Ga0496119_0030877 3300048922 Bacteria 3603
209 Ga0496119_0110895 3300048922 Bacteria 1523
210 Ga0496119_0220464 3300048922 Bacteria 971
211 Ga0496120_0094907 3300048923 Bacteria 1586
212 Ga0496121_0000373 3300048924 Bacteria 92338
213 Ga0496121_0000614 3300048924 Bacteria 66384
214 Ga0496121_0000866 3300048924 Bacteria 54662
215 Ga0496122_0001605 3300048925 Bacteria 35364
216 Ga0496122_0017184 3300048925 Bacteria 6782
217 Ga0496122_0046418 3300048925 Bacteria 3365
218 Ga0496122_0073744 3300048925 Bacteria 2418
219 Ga0496122_0102243 3300048925 Bacteria 1911
220 Ga0496122_0210980 3300048925 Bacteria 1125
221 Ga0496123_0003847 3300048926 Bacteria 16337
222 Ga0496123_0018671 3300048926 Bacteria 5499
223 Ga0496123_0118783 3300048926 Bacteria 1492
224 Ga0496123_0297914 3300048926 Bacteria 771
225 Ga0496124_0000312 3300048927 Bacteria 89996
226 Ga0496124_0001209 3300048927 Bacteria 39976
227 Ga0496124_0009793 3300048927 Bacteria 9804
228 Ga0496124_0033034 3300048927 Bacteria 4558
229 Ga0496124_0083168 3300048927 Bacteria 2626
230 Ga0496124_0101048 3300048927 Bacteria 2337
231 Ga0496124_0126341 3300048927 Bacteria 2036
232 Ga0496125_0000095 3300048928 Bacteria 208094
233 Ga0496125_0011781 3300048928 Bacteria 8714
234 Ga0496125_0078320 3300048928 Bacteria 2542
235 Ga0496126_0011377 3300048929 Bacteria 9220
236 Ga0496126_0385854 3300048929 Bacteria 1139
237 Ga0501266_000058 3300049763 Bacteria 17471
238 nmdc:mga0k408_8197_c1 3300050493 Bacteria 5600
239 nmdc:mga07m45_2031_c1 3300050496 Bacteria 9388
240 nmdc:mga07m45_298083_c1 3300050496 Bacteria 938
241 Ga0500562_006481 3300053108 Bacteria 2949
242 Ga0500592_006474 3300053116 Bacteria 1865
243 Ga0500594_0002581 3300053118 Bacteria 3934
244 Ga0500608_060458 3300053122 Bacteria 1812
245 Ga0500658_0000166 3300053134 Bacteria 31883
246 Ga0500568_0001031 3300053139 Bacteria 19068
247 Ga0500634_0000172 3300053161 Bacteria 21425
248 Ga0500565_006141 3300053734 Bacteria 1090
249 2599746022 2599185240 Bacteria 7968121
250 2600208144 2599185355 Bacteria 7968906
251 2644397288 2643221672 Bacteria 6322190
252 2652545340 2651869719 Bacteria 6047974
253 2676743613 2675903129 Bacteria 7964495
254 2746090031 2744054900 Bacteria 8399525
255 2746099054 2744054901 Bacteria 8397047
256 2808943595 2808606379 Bacteria 5022697
257 2819661057 2818991457 Bacteria 5323295
258 2885194022 2885192300 Bacteria 5882526
259 2912965829 2912963787 Bacteria 5646108
260 2928090067 2928084124 Bacteria 7159212
261 2928160724 2928157003 Bacteria 7522202
262 2928169770 2928163908 Bacteria 7561269
263 2981991639 2981990288 Bacteria 7590678
264 Ga0395899_0005237
265 Ga0055535_1007869
266 Ga0055536_1000398
267 Ga0055536_1000425
268 Ga0055540_1000092
269 Ga0055531_10000084
270 Ga0070658_10024049
271 Ga0070658_10094432
272 Ga0068869_100632590
273 Ga0070660_100010734
274 Ga0070660_100083771
275 Ga0070661_100047192
276 Ga0070659_100011703
277 Ga0070659_100233668
278 Ga0070667_100170784
279 Ga0070662_100034051
280 Ga0070684_100219634
281 Ga0068855_100083320
282 Ga0070664_100043142
283 Ga0068857_100002663
284 Ga0068857_100722627
285 Ga0068857_100838793
286 Ga0068856_100107004
287 Ga0068852_100010677
288 Ga0068852_101158070
289 Ga0068861_100028681
290 Ga0068862_100149501
291 Ga0075367_10037683
292 Ga0075366_10008537
293 Ga0075370_10013506
294 Ga0075370_10020293
295 Ga0068865_100304177
296 Ga0079104_1000064
297 Ga0099826_10000536
298 Ga0105251_10000029
299 Ga0105244_10002718
300 Ga0105244_10037766
301 Ga0105250_10028381
302 Ga0105240_10000645
303 Ga0105240_10005228
304 Ga0105243_10000604
305 Ga0105243_10078782
306 Ga0105241_10017442
307 Ga0105241_10354034
308 Ga0105242_10044338
309 Ga0105242_10180120
310 Ga0105237_10054543
311 Ga0105239_10046934
312 Ga0105239_10157242
313 Ga0157373_10087900
314 Ga0157373_10102376
315 Ga0157373_10356767
316 Ga0157371_10000040
317 Ga0157371_10385951
318 Ga0157370_10046129
319 Ga0157370_10061310
320 Ga0157369_10000186
321 Ga0157374_10413754
322 Ga0157378_10008575
323 Ga0163162_10432353
324 Ga0157372_10220252
325 Ga0182008_10000251
326 Ga0182008_10002737
327 Ga0157379_10712813
328 Ga0157376_10362278
329 Ga0182006_1000193
330 Ga0182006_1006842
331 Ga0182006_1009631
332 Ga0182006_1108561
333 Ga0182007_10100475
334 Ga0182005_1000355
335 Ga0182005_1006030
336 Ga0163161_10009711
337 Ga0163161_10018211
338 Ga0206354_10785190
339 Ga0206353_10752385
340 Ga0209147_100144
341 Ga0209258_100227
342 Ga0209148_1000628
343 Ga0209759_1002283
344 Ga0209455_1000222
345 Ga0209673_1012529
346 Ga0209676_1000123
347 Ga0209676_1000190
348 Ga0209050_1000188
349 Ga0209051_1000091
350 Ga0209257_1000057
351 Ga0207655_1004762
352 Ga0207713_1000112
353 Ga0207705_10018600
354 Ga0207705_10137867
355 Ga0207654_10084870
356 Ga0207695_10000547
357 Ga0207695_10002506
358 Ga0207695_10188815
359 Ga0207671_10007787
360 Ga0207671_10330231
361 Ga0207657_10000195
362 Ga0207657_10033701
363 Ga0207657_10075759
364 Ga0207649_10049743
365 Ga0207694_10055769
366 Ga0207687_10648600
367 Ga0207690_10000038
368 Ga0207690_10023840
369 Ga0207706_10021587
370 Ga0207709_10795407
371 Ga0207704_10146289
372 Ga0207689_10143499
373 Ga0207679_10548183
374 Ga0207667_10009946
375 Ga0207658_10351233
376 Ga0207678_10008324
377 Ga0207678_10482291
378 Ga0207674_10011039
379 Ga0207674_10385109
380 Ga0207674_10406754
381 Ga0207675_100024055
382 Ga0207698_10065786
383 Ga0207698_11016679
384 Ga0209281_1000009
385 Ga0209282_1052035
386 Ga0307515_10000053
387 Ga0307408_100000026
388 Ga0307408_100704859
389 Ga0307508_10000892
390 Ga0307412_10000482
391 Ga0307414_10942498
392 Ga0307510_10248842
393 Ga0373950_0001137
394 Ga0373951_0015679
395 Ga0373939_0000047
396 Ga0373960_0009350
397 Ga0373962_0014787
398 Ga0373931_0065477
399 Ga0395899_0000023
400 Ga0395900_0000019
401 Ga0395900_0000438
402 Ga0395900_0134416
403 Ga0395898_0000016
404 Ga0395898_0001621
405 Ga0395898_0028754
406 Ga0395898_0135277
407 Ga0395905_0003423
408 Ga0395905_0083631
409 Ga0395905_0178527
410 Ga0395901_0000498
411 Ga0395901_0297203
412 Ga0439436_0126270
413 Ga0439466_0040015
414 Ga0439448_0000746
415 Ga0439432_000026
416 Ga0439455_0014202
417 Ga0439458_0001212
418 Ga0439464_0048542
419 Ga0439440_0035462
420 Ga0495617_002094
421 Ga0495617_051271
422 Ga0495638_0000124
423 Ga0495638_0029591
424 Ga0495638_0054070
425 Ga0495585_0215732
426 Ga0495607_0001075
427 Ga0495610_0033151
428 Ga0495616_0067386
429 Ga0495616_0077905
430 Ga0495631_0000793
431 Ga0495632_0011725
432 Ga0495637_0054031
433 Ga0495621_0009784
434 Ga0495597_0000019
435 Ga0495622_0212784
436 Ga0495633_0001936
437 Ga0495633_0002852
438 Ga0495633_0017028
439 Ga0495668_0015701
440 Ga0495611_0003059
441 Ga0495625_0046606
442 Ga0495672_0006832
443 Ga0495687_112474
444 Ga0495681_0042012
445 Ga0496100_0810036
446 Ga0496100_0816795
447 Ga0496103_0152431
448 Ga0496104_0028822
449 Ga0496107_0527992
450 Ga0496113_0178538
451 Ga0496116_0000593
452 Ga0496116_0040732
453 Ga0496116_0042740
454 Ga0496116_0055252
455 Ga0496116_0289750
456 Ga0496117_0008329
457 Ga0496117_0076724
458 Ga0496117_0111231
459 Ga0496117_0180081
460 Ga0496117_0320493
461 Ga0496118_0000074
462 Ga0496118_0002433
463 Ga0496118_0004887
464 Ga0496118_0016826
465 Ga0496118_0018342
466 Ga0496118_0032612
467 Ga0496118_0065976
468 Ga0496118_0146102
469 Ga0496118_0162220
470 Ga0496118_0209454
471 Ga0496119_0030877
472 Ga0496119_0110895
473 Ga0496119_0220464
474 Ga0496120_0094907
475 Ga0496121_0000373
476 Ga0496121_0000614
477 Ga0496121_0000866
478 Ga0496122_0001605
479 Ga0496122_0017184
480 Ga0496122_0046418
481 Ga0496122_0073744
482 Ga0496122_0102243
483 Ga0496122_0210980
484 Ga0496123_0003847
485 Ga0496123_0018671
486 Ga0496123_0118783
487 Ga0496123_0297914
488 Ga0496124_0000312
489 Ga0496124_0001209
490 Ga0496124_0009793
491 Ga0496124_0033034
492 Ga0496124_0083168
493 Ga0496124_0101048
494 Ga0496124_0126341
495 Ga0496125_0000095
496 Ga0496125_0011781
497 Ga0496125_0078320
498 Ga0496126_0011377
499 Ga0496126_0385854
500 Ga0501266_000058
501 nmdc:mga0k408_8197_c1
502 nmdc:mga07m45_2031_c1
503 nmdc:mga07m45_298083_c1
504 Ga0500562_006481
505 Ga0500592_006474
506 Ga0500594_0002581
507 Ga0500608_060458
508 Ga0500658_0000166
509 Ga0500568_0001031
510 Ga0500634_0000172
511 Ga0500565_006141
512 2599746022
513 2600208144
514 2644397288
515 2652545340
516 2676743613
517 2746090031
518 2746099054
519 2808943595
520 2819661057
521 2885194022
522 2912965829
523 2928090067
524 2928160724
525 2928169770
526 2981991639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

48

94

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fd5-assembly1.cif.gz_A-2 the crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1 0.8094 4 183
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.8077 8 186
2fd5-assembly1.cif.gz_A-2 the crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1 0.7972 4 183
3dpj-assembly2.cif.gz_H the crystal structure of a tetr transcription regulator from silicibacter pomeroyi dss 0.776 12 189
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.7602 8 186
ID Description Score Start End Superfamily
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9459 11 57 1.10.10.60
1jt0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9296 11 57 1.10.10.60
1jt0C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9274 11 57 1.10.10.60
1qvuE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9197 11 57 1.10.10.60
1jusB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9166 12 57 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A840JJ94-F1-model_v4 deleted 0.9739 1 186
AF-A0A7Y5EHR6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9652 1 186 GO:0003677
GO:0006355
AF-A0A0Q5F7D8-F1-model_v4 TetR family transcriptional regulator 0.9642 1 186 GO:0003677
GO:0006355
AF-F3GB07-F1-model_v4 Regulatory protein, TetR 0.961 32 186 GO:0003677
AF-F8GWE6-F1-model_v4 Transcriptional regulator TetR family 0.9578 1 186 GO:0003677
GO:0006355

Map