F372109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 263 | 217 | 526 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0051339|Ga0495668_0051339_927_1577 |
| Length | 216 |
| Sequence | MKNDLITSLRPAAVMTILFAVVLGVIYPILMTIVGQTVFPHQANGSLIRDGDKVIGSELIGQNFAAARYFHGRPSAAGKGYDATASSGSNYGPTSQALIDRVRGDIKTLAAEHPGRPIPADLVTASGSGLDPEITPEAAEWQVDRVARARGIDAAAVRKIVASETREPVLGFIGEPRVNVLALNRRLDAQAAGRKSPRAPIRMPCCAPLRAKGAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 27 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 72 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 73 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 74 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 75 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 76 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 77 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 78 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 79 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 80 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 81 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 82 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 83 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 85 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 86 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 87 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 88 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 89 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 90 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 91 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 124 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 125 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 126 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 127 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 128 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 129 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 130 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 131 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 132 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 133 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 134 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 135 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 136 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 147 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 148 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 149 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 151 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 152 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 153 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 154 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 155 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 156 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 157 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 158 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 159 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 160 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 161 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 162 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 163 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 164 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 165 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 166 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 167 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 169 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 170 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 171 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 172 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 173 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 174 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 175 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 176 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 177 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 178 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 179 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 180 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 181 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 182 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 183 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 184 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 185 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 186 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 187 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 188 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 189 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 190 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 191 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 192 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 193 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 194 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 195 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 196 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 197 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 198 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 199 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 200 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 201 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 202 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 203 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 204 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 205 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 206 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 207 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 208 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 209 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 210 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 211 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 212 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 213 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 214 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 215 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 216 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 217 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.23 |
| Metatranscriptomes | 0.38 |
| Isolates | 19.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.76 |
| Bulb | 0 |
| Endosphere | 17.87 |
| Nodule | 8.37 |
| Rhizoplane | 4.56 |
| Rhizosphere | 55.13 |
| Stem | 0 |
| Stem Tuber | 1.9 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495668_0051339 | 3300046616 | Bacteria | 2283 |
| 2 | JGI24740J21852_10023959 | 3300001979 | Bacteria | 2076 |
| 3 | JGI25160J50197_1012675 | 3300003354 | Bacteria | 2914 |
| 4 | Ga0055542_1000792 | 3300003762 | Bacteria | 23465 |
| 5 | Ga0055529_1004278 | 3300003763 | Bacteria | 2189 |
| 6 | Ga0055526_1014647 | 3300003771 | Bacteria | 3207 |
| 7 | Ga0055536_1000344 | 3300003781 | Bacteria | 34426 |
| 8 | Ga0055536_1000492 | 3300003781 | Bacteria | 27396 |
| 9 | Ga0055530_10002951 | 3300003791 | Bacteria | 10267 |
| 10 | Ga0055530_10013013 | 3300003791 | Bacteria | 2864 |
| 11 | Ga0055531_10000526 | 3300003794 | Bacteria | 34418 |
| 12 | Ga0055543_1043435 | 3300004625 | Bacteria | 753 |
| 13 | Ga0070658_10095923 | 3300005327 | Bacteria | 2448 |
| 14 | Ga0070658_10186792 | 3300005327 | Bacteria | 1746 |
| 15 | Ga0068869_100213194 | 3300005334 | Bacteria | 1528 |
| 16 | Ga0070680_100022494 | 3300005336 | Bacteria | 5022 |
| 17 | Ga0070660_100323302 | 3300005339 | Bacteria | 1267 |
| 18 | Ga0070691_10004399 | 3300005341 | Bacteria | 6400 |
| 19 | Ga0070671_100023569 | 3300005355 | Bacteria | 5039 |
| 20 | Ga0070681_10037373 | 3300005458 | Bacteria | 4873 |
| 21 | Ga0070685_10003083 | 3300005466 | Bacteria | 8477 |
| 22 | Ga0070679_100130194 | 3300005530 | Bacteria | 2497 |
| 23 | Ga0068853_100130979 | 3300005539 | Bacteria | 2245 |
| 24 | Ga0068853_101050660 | 3300005539 | Bacteria | 785 |
| 25 | Ga0070686_100260442 | 3300005544 | Bacteria | 1271 |
| 26 | Ga0068855_100065965 | 3300005563 | Bacteria | 4220 |
| 27 | Ga0068854_100001702 | 3300005578 | Bacteria | 13388 |
| 28 | Ga0068852_100137826 | 3300005616 | Bacteria | 2254 |
| 29 | Ga0068863_100075978 | 3300005841 | Bacteria | 3178 |
| 30 | Ga0068860_100376891 | 3300005843 | Bacteria | 1400 |
| 31 | Ga0075365_10018115 | 3300006038 | Bacteria | 4324 |
| 32 | Ga0075364_10018577 | 3300006051 | Bacteria | 4353 |
| 33 | Ga0075369_10113878 | 3300006186 | Bacteria | 1220 |
| 34 | Ga0097621_100145336 | 3300006237 | Bacteria | 2030 |
| 35 | Ga0075370_10428449 | 3300006353 | Bacteria | 795 |
| 36 | Ga0105240_10005462 | 3300009093 | Bacteria | 18943 |
| 37 | Ga0105245_10859695 | 3300009098 | Bacteria | 947 |
| 38 | Ga0105241_10098480 | 3300009174 | Bacteria | 2320 |
| 39 | Ga0105242_10444140 | 3300009176 | Bacteria | 1221 |
| 40 | Ga0105248_10174327 | 3300009177 | Bacteria | 2424 |
| 41 | Ga0105238_10216632 | 3300009551 | Bacteria | 1891 |
| 42 | Ga0105238_10308990 | 3300009551 | Bacteria | 1566 |
| 43 | Ga0105239_10025918 | 3300010375 | Bacteria | 6457 |
| 44 | Ga0105239_10348148 | 3300010375 | Bacteria | 1673 |
| 45 | Ga0105239_10565249 | 3300010375 | Bacteria | 1296 |
| 46 | Ga0157373_10916040 | 3300013100 | Bacteria | 651 |
| 47 | Ga0157369_10702769 | 3300013105 | Bacteria | 1041 |
| 48 | Ga0157374_10165913 | 3300013296 | Bacteria | 2152 |
| 49 | Ga0157378_10000136 | 3300013297 | Bacteria | 69380 |
| 50 | Ga0157378_10000273 | 3300013297 | Bacteria | 50350 |
| 51 | Ga0157375_10000059 | 3300013308 | Bacteria | 118614 |
| 52 | Ga0157380_10573776 | 3300014326 | Bacteria | 1111 |
| 53 | Ga0182008_10035203 | 3300014497 | Bacteria | 2509 |
| 54 | Ga0182006_1070011 | 3300015261 | Bacteria | 1303 |
| 55 | Ga0209677_119597 | 3300025253 | Bacteria | 804 |
| 56 | Ga0209148_1000080 | 3300025254 | Bacteria | 277806 |
| 57 | Ga0209455_1000219 | 3300025272 | Bacteria | 79850 |
| 58 | Ga0209676_1000057 | 3300025292 | Bacteria | 361061 |
| 59 | Ga0209676_1000468 | 3300025292 | Bacteria | 67646 |
| 60 | Ga0209050_1000486 | 3300025298 | Bacteria | 69279 |
| 61 | Ga0209050_1000522 | 3300025298 | Bacteria | 63985 |
| 62 | Ga0209050_1005294 | 3300025298 | Bacteria | 8204 |
| 63 | Ga0207426_1009851 | 3300025302 | Bacteria | 3746 |
| 64 | Ga0209051_1000720 | 3300025303 | Bacteria | 36140 |
| 65 | Ga0209257_1000520 | 3300025304 | Bacteria | 66890 |
| 66 | Ga0209257_1005080 | 3300025304 | Bacteria | 9554 |
| 67 | Ga0207705_10012038 | 3300025909 | Bacteria | 6250 |
| 68 | Ga0207705_10110070 | 3300025909 | Bacteria | 2035 |
| 69 | Ga0207654_10082087 | 3300025911 | Bacteria | 1943 |
| 70 | Ga0207707_10028691 | 3300025912 | Bacteria | 4863 |
| 71 | Ga0207671_10003582 | 3300025914 | Bacteria | 15373 |
| 72 | Ga0207671_10667094 | 3300025914 | Bacteria | 828 |
| 73 | Ga0207660_10160572 | 3300025917 | Bacteria | 1734 |
| 74 | Ga0207657_10136985 | 3300025919 | Bacteria | 2002 |
| 75 | Ga0207657_10280370 | 3300025919 | Bacteria | 1323 |
| 76 | Ga0207652_10066587 | 3300025921 | Bacteria | 3122 |
| 77 | Ga0207694_10146936 | 3300025924 | Bacteria | 1898 |
| 78 | Ga0207694_10401150 | 3300025924 | Bacteria | 1140 |
| 79 | Ga0207690_10264479 | 3300025932 | Bacteria | 1334 |
| 80 | Ga0207689_10010363 | 3300025942 | Bacteria | 8032 |
| 81 | Ga0207640_10001843 | 3300025981 | Bacteria | 11365 |
| 82 | Ga0207703_10825880 | 3300026035 | Bacteria | 886 |
| 83 | Ga0207678_10106412 | 3300026067 | Bacteria | 2393 |
| 84 | Ga0207678_10480736 | 3300026067 | Bacteria | 1082 |
| 85 | Ga0207641_10105769 | 3300026088 | Bacteria | 2486 |
| 86 | Ga0207698_10059418 | 3300026142 | Bacteria | 2969 |
| 87 | Ga0268264_10147474 | 3300028381 | Bacteria | 2105 |
| 88 | Ga0265338_10370565 | 3300028800 | Bacteria | 1026 |
| 89 | Ga0265340_10000223 | 3300031247 | Bacteria | 28904 |
| 90 | Ga0265340_10005815 | 3300031247 | Bacteria | 6828 |
| 91 | Ga0265331_10000006 | 3300031250 | Bacteria | 418907 |
| 92 | Ga0265331_10015033 | 3300031250 | Bacteria | 4101 |
| 93 | Ga0265316_10148259 | 3300031344 | Bacteria | 1758 |
| 94 | Ga0307408_100032395 | 3300031548 | Bacteria | 3644 |
| 95 | Ga0265313_10070366 | 3300031595 | Bacteria | 1612 |
| 96 | Ga0265314_10023733 | 3300031711 | Bacteria | 4667 |
| 97 | Ga0265314_10103412 | 3300031711 | Bacteria | 1826 |
| 98 | Ga0265342_10035660 | 3300031712 | Bacteria | 3044 |
| 99 | Ga0307413_10006196 | 3300031824 | Bacteria | 5434 |
| 100 | Ga0307413_10019510 | 3300031824 | Bacteria | 3585 |
| 101 | Ga0307410_10086480 | 3300031852 | Bacteria | 2214 |
| 102 | Ga0307410_10087433 | 3300031852 | Bacteria | 2204 |
| 103 | Ga0307406_10006216 | 3300031901 | Bacteria | 6574 |
| 104 | Ga0307407_10252004 | 3300031903 | Bacteria | 1210 |
| 105 | Ga0307412_10029315 | 3300031911 | Bacteria | 3453 |
| 106 | Ga0307409_100007660 | 3300031995 | Bacteria | 6480 |
| 107 | Ga0307416_100118056 | 3300032002 | Bacteria | 2356 |
| 108 | Ga0307414_10003914 | 3300032004 | Bacteria | 8025 |
| 109 | Ga0307414_10605082 | 3300032004 | Bacteria | 983 |
| 110 | Ga0307415_100038363 | 3300032126 | Bacteria | 3157 |
| 111 | Ga0436363_0805742 | 3300039450 | Bacteria | 1165 |
| 112 | Ga0451845_0485342 | 3300041501 | Bacteria | 1064 |
| 113 | Ga0451843_1431392 | 3300041509 | Bacteria | 1113 |
| 114 | Ga0495627_000788 | 3300046453 | Bacteria | 23346 |
| 115 | Ga0495591_012288 | 3300046458 | Bacteria | 3195 |
| 116 | Ga0495641_0065989 | 3300046461 | Bacteria | 1629 |
| 117 | Ga0495650_0000034 | 3300046471 | Bacteria | 410132 |
| 118 | Ga0495584_0015110 | 3300046491 | Bacteria | 3934 |
| 119 | Ga0495596_0201043 | 3300046500 | Bacteria | 774 |
| 120 | Ga0495607_0014027 | 3300046501 | Bacteria | 5232 |
| 121 | Ga0495606_0002195 | 3300046507 | Bacteria | 23408 |
| 122 | Ga0495610_0000153 | 3300046512 | Bacteria | 76652 |
| 123 | Ga0495610_0003614 | 3300046512 | Bacteria | 11938 |
| 124 | Ga0495616_0111963 | 3300046513 | Bacteria | 1267 |
| 125 | Ga0495637_0089788 | 3300046520 | Bacteria | 1214 |
| 126 | Ga0495637_0134871 | 3300046520 | Bacteria | 940 |
| 127 | Ga0495648_0014266 | 3300046524 | Bacteria | 5826 |
| 128 | Ga0495654_0000146 | 3300046530 | Bacteria | 73331 |
| 129 | Ga0495609_0311648 | 3300046538 | Bacteria | 639 |
| 130 | Ga0495597_0105161 | 3300046542 | Bacteria | 1187 |
| 131 | Ga0495622_0029238 | 3300046557 | Bacteria | 2575 |
| 132 | Ga0495633_0013516 | 3300046558 | Bacteria | 4298 |
| 133 | Ga0495668_0000019 | 3300046616 | Bacteria | 416042 |
| 134 | Ga0495625_0361709 | 3300046660 | Bacteria | 914 |
| 135 | Ga0495661_0017191 | 3300046665 | Bacteria | 4779 |
| 136 | Ga0495661_0125332 | 3300046665 | Bacteria | 1414 |
| 137 | Ga0495671_0017656 | 3300046692 | Bacteria | 3795 |
| 138 | Ga0495649_0022851 | 3300046694 | Bacteria | 3497 |
| 139 | Ga0495589_0016646 | 3300046794 | Bacteria | 3777 |
| 140 | Ga0495660_0000020 | 3300046810 | Bacteria | 304768 |
| 141 | Ga0495672_0000011 | 3300047320 | Bacteria | 535362 |
| 142 | Ga0495672_0188549 | 3300047320 | Bacteria | 1039 |
| 143 | Ga0495676_0368484 | 3300047321 | Bacteria | 958 |
| 144 | Ga0495683_0037794 | 3300047323 | Bacteria | 2445 |
| 145 | Ga0495679_011237 | 3300047446 | Bacteria | 3469 |
| 146 | Ga0495673_0000020 | 3300047469 | Bacteria | 548327 |
| 147 | Ga0495673_0080217 | 3300047469 | Bacteria | 1353 |
| 148 | Ga0495681_0000015 | 3300047470 | Bacteria | 183538 |
| 149 | Ga0495686_0000864 | 3300047472 | Bacteria | 38828 |
| 150 | Ga0495686_0025608 | 3300047472 | Bacteria | 3866 |
| 151 | Ga0495686_0077541 | 3300047472 | Bacteria | 2034 |
| 152 | Ga0495686_0172723 | 3300047472 | Bacteria | 1256 |
| 153 | Ga0496100_0116577 | 3300048903 | Bacteria | 1864 |
| 154 | Ga0496101_0822801 | 3300048904 | Bacteria | 732 |
| 155 | Ga0496102_0052595 | 3300048905 | Bacteria | 3712 |
| 156 | Ga0496104_0776137 | 3300048907 | Bacteria | 865 |
| 157 | Ga0496106_0060422 | 3300048909 | Bacteria | 2873 |
| 158 | Ga0496112_0028508 | 3300048915 | Bacteria | 5390 |
| 159 | Ga0496113_0319694 | 3300048916 | Bacteria | 1244 |
| 160 | Ga0496114_0708647 | 3300048917 | Bacteria | 882 |
| 161 | Ga0496115_0385130 | 3300048918 | Bacteria | 1140 |
| 162 | Ga0496115_0507593 | 3300048918 | Bacteria | 968 |
| 163 | Ga0496118_0156405 | 3300048921 | Bacteria | 1417 |
| 164 | Ga0496122_0115283 | 3300048925 | Bacteria | 1751 |
| 165 | Ga0496123_0052973 | 3300048926 | Bacteria | 2686 |
| 166 | Ga0496124_0004871 | 3300048927 | Bacteria | 15435 |
| 167 | Ga0496124_0014207 | 3300048927 | Bacteria | 7714 |
| 168 | Ga0496124_0020765 | 3300048927 | Bacteria | 6061 |
| 169 | Ga0496124_0138049 | 3300048927 | Bacteria | 1928 |
| 170 | Ga0496124_0138609 | 3300048927 | Bacteria | 1923 |
| 171 | Ga0496124_0304141 | 3300048927 | Bacteria | 1150 |
| 172 | Ga0496125_0113283 | 3300048928 | Bacteria | 1957 |
| 173 | Ga0496125_0239066 | 3300048928 | Bacteria | 1155 |
| 174 | Ga0496126_0022224 | 3300048929 | Bacteria | 6175 |
| 175 | Ga0495678_000551 | 3300049459 | Bacteria | 36076 |
| 176 | Ga0495682_0000005 | 3300049460 | Bacteria | 360387 |
| 177 | Ga0495682_0014588 | 3300049460 | Bacteria | 2979 |
| 178 | Ga0501321_009287 | 3300049537 | Bacteria | 1059 |
| 179 | Ga0501036_0306033 | 3300049572 | Bacteria | 1329 |
| 180 | Ga0501043_0018304 | 3300049579 | Bacteria | 5493 |
| 181 | Ga0501046_0098327 | 3300049580 | Bacteria | 2247 |
| 182 | Ga0501047_0019401 | 3300049581 | Bacteria | 6523 |
| 183 | Ga0501047_0682936 | 3300049581 | Bacteria | 845 |
| 184 | Ga0501067_0246469 | 3300049583 | Bacteria | 994 |
| 185 | Ga0501072_0021773 | 3300049588 | Bacteria | 4971 |
| 186 | Ga0501074_0230810 | 3300049590 | Bacteria | 1317 |
| 187 | Ga0501202_072383 | 3300049652 | Bacteria | 797 |
| 188 | Ga0501247_011748 | 3300049677 | Bacteria | 1059 |
| 189 | Ga0501249_001366 | 3300049679 | Bacteria | 5057 |
| 190 | Ga0501044_0315768 | 3300049823 | Bacteria | 1488 |
| 191 | nmdc:mga03n38_17870_c1 | 3300050490 | Bacteria | 2786 |
| 192 | nmdc:mga07m45_17612_c1 | 3300050496 | Bacteria | 3841 |
| 193 | nmdc:mga07m45_343134_c1 | 3300050496 | Bacteria | 868 |
| 194 | nmdc:mga0sz30_4001_c1 | 3300050516 | Bacteria | 5308 |
| 195 | Ga0500647_0034810 | 3300053091 | Bacteria | 2406 |
| 196 | Ga0500651_0002216 | 3300053093 | Bacteria | 10188 |
| 197 | Ga0500566_0004635 | 3300053094 | Bacteria | 8176 |
| 198 | Ga0500641_0118754 | 3300053096 | Bacteria | 1139 |
| 199 | Ga0500555_001028 | 3300053103 | Bacteria | 9426 |
| 200 | Ga0500608_242209 | 3300053122 | Bacteria | 710 |
| 201 | Ga0500621_000014 | 3300053126 | Bacteria | 126576 |
| 202 | Ga0500642_0003804 | 3300053130 | Bacteria | 4626 |
| 203 | Ga0500655_000030 | 3300053133 | Bacteria | 39615 |
| 204 | Ga0500559_0092558 | 3300053136 | Bacteria | 1385 |
| 205 | Ga0500559_0114902 | 3300053136 | Bacteria | 1249 |
| 206 | Ga0500577_0030248 | 3300053142 | Bacteria | 1883 |
| 207 | Ga0500622_0019825 | 3300053156 | Bacteria | 3569 |
| 208 | Ga0500622_0067908 | 3300053156 | Bacteria | 1807 |
| 209 | Ga0500622_0171142 | 3300053156 | Bacteria | 1011 |
| 210 | Ga0500624_000018 | 3300053157 | Bacteria | 131677 |
| 211 | Ga0500570_008941 | 3300053724 | Bacteria | 5549 |
| 212 | Ga0501082_0195199 | 3300060353 | Bacteria | 1761 |
| 213 | 2507511198 | 2507262055 | Bacteria | 8048963 |
| 214 | 2508693743 | 2508501042 | Bacteria | 8719808 |
| 215 | 2512932655 | 2512875016 | Bacteria | 6529530 |
| 216 | 2514010461 | 2513237161 | Bacteria | 8871253 |
| 217 | 2538427315 | 2537561728 | Bacteria | 5149301 |
| 218 | 2585262521 | 2582581305 | Bacteria | 4895574 |
| 219 | 2588518738 | 2588253730 | Bacteria | 6881675 |
| 220 | 2600226766 | 2599185359 | Bacteria | 4772316 |
| 221 | 2617350559 | 2617270735 | Bacteria | 9163226 |
| 222 | 2753767431 | 2751185897 | Bacteria | 5322941 |
| 223 | 2819715787 | 2818991466 | Bacteria | 4748179 |
| 224 | 2838129118 | 2838122688 | Bacteria | 8803140 |
| 225 | 2841990339 | 2841983080 | Bacteria | 8395090 |
| 226 | 2852103780 | 2852103415 | Bacteria | 5193810 |
| 227 | 2855198698 | 2855195626 | Bacteria | 4927512 |
| 228 | 2858470082 | 2858466076 | Bacteria | 4722413 |
| 229 | 2871277193 | 2871272651 | Bacteria | 5042015 |
| 230 | 2876365093 | 2876363079 | Bacteria | 6544991 |
| 231 | 2885411568 | 2885409591 | Bacteria | 9235467 |
| 232 | 2900054103 | 2900051742 | Bacteria | 4985156 |
| 233 | 2900055769 | 2900051742 | Bacteria | 4985156 |
| 234 | 2903450093 | 2903448605 | Bacteria | 7357801 |
| 235 | 2903522172 | 2903521522 | Bacteria | 6525694 |
| 236 | 2903528550 | 2903528002 | Bacteria | 6586099 |
| 237 | 2909047323 | 2909042592 | Bacteria | 6499737 |
| 238 | 2928029161 | 2928027323 | Bacteria | 4382488 |
| 239 | 2928529801 | 2928526807 | Bacteria | 4760224 |
| 240 | 2928535190 | 2928531327 | Bacteria | 5101314 |
| 241 | 2928970702 | 2928968154 | Bacteria | 4633371 |
| 242 | 2935653530 | 2935648319 | Bacteria | 8801166 |
| 243 | 2935662279 | 2935656913 | Bacteria | 8965014 |
| 244 | 2935986183 | 2935984226 | Bacteria | 8302647 |
| 245 | 2936016581 | 2936011229 | Bacteria | 8801034 |
| 246 | 2936025105 | 2936019824 | Bacteria | 8804134 |
| 247 | 2936034056 | 2936028420 | Bacteria | 8965941 |
| 248 | 2936052004 | 2936046547 | Bacteria | 8903709 |
| 249 | 2936059777 | 2936055302 | Bacteria | 8785755 |
| 250 | 2937852119 | 2937848649 | Bacteria | 6983481 |
| 251 | 2963646548 | 2963644680 | Bacteria | 6530403 |
| 252 | 2965069141 | 2965062239 | Bacteria | 7412989 |
| 253 | 2968090659 | 2968083720 | Bacteria | 7351627 |
| 254 | 2968134494 | 2968128360 | Bacteria | 6270294 |
| 255 | 2977926161 | 2977922695 | Bacteria | 6956781 |
| 256 | 2977988595 | 2977986579 | Bacteria | 6581278 |
| 257 | 2984555397 | 2984555340 | Bacteria | 4247089 |
| 258 | 2993357504 | 2993356040 | Bacteria | 4247105 |
| 259 | 3004217944 | 3004211236 | Bacteria | 7417683 |
| 260 | 3004221008 | 3004218560 | Bacteria | 7421728 |
| 261 | 3004335876 | 3004334049 | Bacteria | 8449246 |
| 262 | 637075751 | 637000159 | Bacteria | 7596297 |
| 263 | 8055434532 | 8055431914 | Bacteria | 4551896 |
| 264 | Ga0495668_0051339 | |||
| 265 | JGI24740J21852_10023959 | |||
| 266 | JGI25160J50197_1012675 | |||
| 267 | Ga0055542_1000792 | |||
| 268 | Ga0055529_1004278 | |||
| 269 | Ga0055526_1014647 | |||
| 270 | Ga0055536_1000344 | |||
| 271 | Ga0055536_1000492 | |||
| 272 | Ga0055530_10002951 | |||
| 273 | Ga0055530_10013013 | |||
| 274 | Ga0055531_10000526 | |||
| 275 | Ga0055543_1043435 | |||
| 276 | Ga0070658_10095923 | |||
| 277 | Ga0070658_10186792 | |||
| 278 | Ga0068869_100213194 | |||
| 279 | Ga0070680_100022494 | |||
| 280 | Ga0070660_100323302 | |||
| 281 | Ga0070691_10004399 | |||
| 282 | Ga0070671_100023569 | |||
| 283 | Ga0070681_10037373 | |||
| 284 | Ga0070685_10003083 | |||
| 285 | Ga0070679_100130194 | |||
| 286 | Ga0068853_100130979 | |||
| 287 | Ga0068853_101050660 | |||
| 288 | Ga0070686_100260442 | |||
| 289 | Ga0068855_100065965 | |||
| 290 | Ga0068854_100001702 | |||
| 291 | Ga0068852_100137826 | |||
| 292 | Ga0068863_100075978 | |||
| 293 | Ga0068860_100376891 | |||
| 294 | Ga0075365_10018115 | |||
| 295 | Ga0075364_10018577 | |||
| 296 | Ga0075369_10113878 | |||
| 297 | Ga0097621_100145336 | |||
| 298 | Ga0075370_10428449 | |||
| 299 | Ga0105240_10005462 | |||
| 300 | Ga0105245_10859695 | |||
| 301 | Ga0105241_10098480 | |||
| 302 | Ga0105242_10444140 | |||
| 303 | Ga0105248_10174327 | |||
| 304 | Ga0105238_10216632 | |||
| 305 | Ga0105238_10308990 | |||
| 306 | Ga0105239_10025918 | |||
| 307 | Ga0105239_10348148 | |||
| 308 | Ga0105239_10565249 | |||
| 309 | Ga0157373_10916040 | |||
| 310 | Ga0157369_10702769 | |||
| 311 | Ga0157374_10165913 | |||
| 312 | Ga0157378_10000136 | |||
| 313 | Ga0157378_10000273 | |||
| 314 | Ga0157375_10000059 | |||
| 315 | Ga0157380_10573776 | |||
| 316 | Ga0182008_10035203 | |||
| 317 | Ga0182006_1070011 | |||
| 318 | Ga0209677_119597 | |||
| 319 | Ga0209148_1000080 | |||
| 320 | Ga0209455_1000219 | |||
| 321 | Ga0209676_1000057 | |||
| 322 | Ga0209676_1000468 | |||
| 323 | Ga0209050_1000486 | |||
| 324 | Ga0209050_1000522 | |||
| 325 | Ga0209050_1005294 | |||
| 326 | Ga0207426_1009851 | |||
| 327 | Ga0209051_1000720 | |||
| 328 | Ga0209257_1000520 | |||
| 329 | Ga0209257_1005080 | |||
| 330 | Ga0207705_10012038 | |||
| 331 | Ga0207705_10110070 | |||
| 332 | Ga0207654_10082087 | |||
| 333 | Ga0207707_10028691 | |||
| 334 | Ga0207671_10003582 | |||
| 335 | Ga0207671_10667094 | |||
| 336 | Ga0207660_10160572 | |||
| 337 | Ga0207657_10136985 | |||
| 338 | Ga0207657_10280370 | |||
| 339 | Ga0207652_10066587 | |||
| 340 | Ga0207694_10146936 | |||
| 341 | Ga0207694_10401150 | |||
| 342 | Ga0207690_10264479 | |||
| 343 | Ga0207689_10010363 | |||
| 344 | Ga0207640_10001843 | |||
| 345 | Ga0207703_10825880 | |||
| 346 | Ga0207678_10106412 | |||
| 347 | Ga0207678_10480736 | |||
| 348 | Ga0207641_10105769 | |||
| 349 | Ga0207698_10059418 | |||
| 350 | Ga0268264_10147474 | |||
| 351 | Ga0265338_10370565 | |||
| 352 | Ga0265340_10000223 | |||
| 353 | Ga0265340_10005815 | |||
| 354 | Ga0265331_10000006 | |||
| 355 | Ga0265331_10015033 | |||
| 356 | Ga0265316_10148259 | |||
| 357 | Ga0307408_100032395 | |||
| 358 | Ga0265313_10070366 | |||
| 359 | Ga0265314_10023733 | |||
| 360 | Ga0265314_10103412 | |||
| 361 | Ga0265342_10035660 | |||
| 362 | Ga0307413_10006196 | |||
| 363 | Ga0307413_10019510 | |||
| 364 | Ga0307410_10086480 | |||
| 365 | Ga0307410_10087433 | |||
| 366 | Ga0307406_10006216 | |||
| 367 | Ga0307407_10252004 | |||
| 368 | Ga0307412_10029315 | |||
| 369 | Ga0307409_100007660 | |||
| 370 | Ga0307416_100118056 | |||
| 371 | Ga0307414_10003914 | |||
| 372 | Ga0307414_10605082 | |||
| 373 | Ga0307415_100038363 | |||
| 374 | Ga0436363_0805742 | |||
| 375 | Ga0451845_0485342 | |||
| 376 | Ga0451843_1431392 | |||
| 377 | Ga0495627_000788 | |||
| 378 | Ga0495591_012288 | |||
| 379 | Ga0495641_0065989 | |||
| 380 | Ga0495650_0000034 | |||
| 381 | Ga0495584_0015110 | |||
| 382 | Ga0495596_0201043 | |||
| 383 | Ga0495607_0014027 | |||
| 384 | Ga0495606_0002195 | |||
| 385 | Ga0495610_0000153 | |||
| 386 | Ga0495610_0003614 | |||
| 387 | Ga0495616_0111963 | |||
| 388 | Ga0495637_0089788 | |||
| 389 | Ga0495637_0134871 | |||
| 390 | Ga0495648_0014266 | |||
| 391 | Ga0495654_0000146 | |||
| 392 | Ga0495609_0311648 | |||
| 393 | Ga0495597_0105161 | |||
| 394 | Ga0495622_0029238 | |||
| 395 | Ga0495633_0013516 | |||
| 396 | Ga0495668_0000019 | |||
| 397 | Ga0495625_0361709 | |||
| 398 | Ga0495661_0017191 | |||
| 399 | Ga0495661_0125332 | |||
| 400 | Ga0495671_0017656 | |||
| 401 | Ga0495649_0022851 | |||
| 402 | Ga0495589_0016646 | |||
| 403 | Ga0495660_0000020 | |||
| 404 | Ga0495672_0000011 | |||
| 405 | Ga0495672_0188549 | |||
| 406 | Ga0495676_0368484 | |||
| 407 | Ga0495683_0037794 | |||
| 408 | Ga0495679_011237 | |||
| 409 | Ga0495673_0000020 | |||
| 410 | Ga0495673_0080217 | |||
| 411 | Ga0495681_0000015 | |||
| 412 | Ga0495686_0000864 | |||
| 413 | Ga0495686_0025608 | |||
| 414 | Ga0495686_0077541 | |||
| 415 | Ga0495686_0172723 | |||
| 416 | Ga0496100_0116577 | |||
| 417 | Ga0496101_0822801 | |||
| 418 | Ga0496102_0052595 | |||
| 419 | Ga0496104_0776137 | |||
| 420 | Ga0496106_0060422 | |||
| 421 | Ga0496112_0028508 | |||
| 422 | Ga0496113_0319694 | |||
| 423 | Ga0496114_0708647 | |||
| 424 | Ga0496115_0385130 | |||
| 425 | Ga0496115_0507593 | |||
| 426 | Ga0496118_0156405 | |||
| 427 | Ga0496122_0115283 | |||
| 428 | Ga0496123_0052973 | |||
| 429 | Ga0496124_0004871 | |||
| 430 | Ga0496124_0014207 | |||
| 431 | Ga0496124_0020765 | |||
| 432 | Ga0496124_0138049 | |||
| 433 | Ga0496124_0138609 | |||
| 434 | Ga0496124_0304141 | |||
| 435 | Ga0496125_0113283 | |||
| 436 | Ga0496125_0239066 | |||
| 437 | Ga0496126_0022224 | |||
| 438 | Ga0495678_000551 | |||
| 439 | Ga0495682_0000005 | |||
| 440 | Ga0495682_0014588 | |||
| 441 | Ga0501321_009287 | |||
| 442 | Ga0501036_0306033 | |||
| 443 | Ga0501043_0018304 | |||
| 444 | Ga0501046_0098327 | |||
| 445 | Ga0501047_0019401 | |||
| 446 | Ga0501047_0682936 | |||
| 447 | Ga0501067_0246469 | |||
| 448 | Ga0501072_0021773 | |||
| 449 | Ga0501074_0230810 | |||
| 450 | Ga0501202_072383 | |||
| 451 | Ga0501247_011748 | |||
| 452 | Ga0501249_001366 | |||
| 453 | Ga0501044_0315768 | |||
| 454 | nmdc:mga03n38_17870_c1 | |||
| 455 | nmdc:mga07m45_17612_c1 | |||
| 456 | nmdc:mga07m45_343134_c1 | |||
| 457 | nmdc:mga0sz30_4001_c1 | |||
| 458 | Ga0500647_0034810 | |||
| 459 | Ga0500651_0002216 | |||
| 460 | Ga0500566_0004635 | |||
| 461 | Ga0500641_0118754 | |||
| 462 | Ga0500555_001028 | |||
| 463 | Ga0500608_242209 | |||
| 464 | Ga0500621_000014 | |||
| 465 | Ga0500642_0003804 | |||
| 466 | Ga0500655_000030 | |||
| 467 | Ga0500559_0092558 | |||
| 468 | Ga0500559_0114902 | |||
| 469 | Ga0500577_0030248 | |||
| 470 | Ga0500622_0019825 | |||
| 471 | Ga0500622_0067908 | |||
| 472 | Ga0500622_0171142 | |||
| 473 | Ga0500624_000018 | |||
| 474 | Ga0500570_008941 | |||
| 475 | Ga0501082_0195199 | |||
| 476 | 2507511198 | |||
| 477 | 2508693743 | |||
| 478 | 2512932655 | |||
| 479 | 2514010461 | |||
| 480 | 2538427315 | |||
| 481 | 2585262521 | |||
| 482 | 2588518738 | |||
| 483 | 2600226766 | |||
| 484 | 2617350559 | |||
| 485 | 2753767431 | |||
| 486 | 2819715787 | |||
| 487 | 2838129118 | |||
| 488 | 2841990339 | |||
| 489 | 2852103780 | |||
| 490 | 2855198698 | |||
| 491 | 2858470082 | |||
| 492 | 2871277193 | |||
| 493 | 2876365093 | |||
| 494 | 2885411568 | |||
| 495 | 2900054103 | |||
| 496 | 2900055769 | |||
| 497 | 2903450093 | |||
| 498 | 2903522172 | |||
| 499 | 2903528550 | |||
| 500 | 2909047323 | |||
| 501 | 2928029161 | |||
| 502 | 2928529801 | |||
| 503 | 2928535190 | |||
| 504 | 2928970702 | |||
| 505 | 2935653530 | |||
| 506 | 2935662279 | |||
| 507 | 2935986183 | |||
| 508 | 2936016581 | |||
| 509 | 2936025105 | |||
| 510 | 2936034056 | |||
| 511 | 2936052004 | |||
| 512 | 2936059777 | |||
| 513 | 2937852119 | |||
| 514 | 2963646548 | |||
| 515 | 2965069141 | |||
| 516 | 2968090659 | |||
| 517 | 2968134494 | |||
| 518 | 2977926161 | |||
| 519 | 2977988595 | |||
| 520 | 2984555397 | |||
| 521 | 2993357504 | |||
| 522 | 3004217944 | |||
| 523 | 3004221008 | |||
| 524 | 3004335876 | |||
| 525 | 637075751 | |||
| 526 | 8055434532 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hra-assembly1.cif.gz_C | cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) | 0.7413 | 6 | 186 |
| 7bh2-assembly1.cif.gz_C | cryo-em structure of kdpfabc in e2pi state with bef3 and k+ | 0.7263 | 1 | 186 |
| 7bh2-assembly1.cif.gz_C | cryo-em structure of kdpfabc in e2pi state with bef3 and k+ | 0.7212 | 1 | 186 |
| 8dgl-assembly1.cif.gz_C | crystal structure of the rdfs excisionase | 0.502 | 127 | 185 |
| 2j37-assembly1.cif.gz_W | model of mammalian srp bound to 80s rncs | 0.5007 | 90 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q14B70_7_70_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.537 | 98 | 159 | 1.10.10.60 |
| af_Q4DXG1_88_164_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.5289 | 92 | 185 | 1.10.238.10 |
| af_Q4DXG1_88_164_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.5064 | 92 | 185 | 1.10.238.10 |
| 1kcyA00 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.4989 | 94 | 187 | 1.10.238.10 |
| 5le5J00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.4933 | 88 | 146 | 3.60.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536ZNA7-F1-model_v4 | Potassium-transporting ATPase subunit C | 0.9795 | 111 | 184 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-A0A8B3G858-F1-model_v4 | deleted | 0.9759 | 130 | 184 |
|
| AF-I3E0A1-F1-model_v4 | Potassium-transporting ATPase C chain | 0.9703 | 114 | 187 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-A0A3L9ZEW8-F1-model_v4 | K+-transporting ATPase C subunit | 0.9604 | 120 | 187 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-Q8VTB5-F1-model_v4 | FrrA | 0.9593 | 127 | 186 |
GO:0005524
GO:0005886 GO:0008556 |