F372109

General Info

Members Datasets Scaffolds Average Seq Length
263 217 526 189

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0051339|Ga0495668_0051339_927_1577
Length 216
Sequence MKNDLITSLRPAAVMTILFAVVLGVIYPILMTIVGQTVFPHQANGSLIRDGDKVIGSELIGQNFAAARYFHGRPSAAGKGYDATASSGSNYGPTSQALIDRVRGDIKTLAAEHPGRPIPADLVTASGSGLDPEITPEAAEWQVDRVARARGIDAAAVRKIVASETREPVLGFIGEPRVNVLALNRRLDAQAAGRKSPRAPIRMPCCAPLRAKGAAA

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
90 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
117 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
137 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
138 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
147 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
148 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
154 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
155 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
159 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
160 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
161 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
166 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
169 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
170 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
171 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
172 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
173 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
174 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
175 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
176 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
177 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
178 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
179 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
180 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
181 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
182 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
183 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
184 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
185 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
186 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
187 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
188 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
189 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
190 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
191 2909042592 Labrys sp. LIt4 Isolate Nodule
192 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
193 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
194 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
195 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
196 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
197 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
198 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
199 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
200 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
201 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
202 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
203 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
204 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
205 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
206 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
207 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
208 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
209 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
210 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
211 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
212 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
213 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
214 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
215 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
216 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
217 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.23
Metatranscriptomes 0.38
Isolates 19.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.76
Bulb 0
Endosphere 17.87
Nodule 8.37
Rhizoplane 4.56
Rhizosphere 55.13
Stem 0
Stem Tuber 1.9
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0051339 3300046616 Bacteria 2283
2 JGI24740J21852_10023959 3300001979 Bacteria 2076
3 JGI25160J50197_1012675 3300003354 Bacteria 2914
4 Ga0055542_1000792 3300003762 Bacteria 23465
5 Ga0055529_1004278 3300003763 Bacteria 2189
6 Ga0055526_1014647 3300003771 Bacteria 3207
7 Ga0055536_1000344 3300003781 Bacteria 34426
8 Ga0055536_1000492 3300003781 Bacteria 27396
9 Ga0055530_10002951 3300003791 Bacteria 10267
10 Ga0055530_10013013 3300003791 Bacteria 2864
11 Ga0055531_10000526 3300003794 Bacteria 34418
12 Ga0055543_1043435 3300004625 Bacteria 753
13 Ga0070658_10095923 3300005327 Bacteria 2448
14 Ga0070658_10186792 3300005327 Bacteria 1746
15 Ga0068869_100213194 3300005334 Bacteria 1528
16 Ga0070680_100022494 3300005336 Bacteria 5022
17 Ga0070660_100323302 3300005339 Bacteria 1267
18 Ga0070691_10004399 3300005341 Bacteria 6400
19 Ga0070671_100023569 3300005355 Bacteria 5039
20 Ga0070681_10037373 3300005458 Bacteria 4873
21 Ga0070685_10003083 3300005466 Bacteria 8477
22 Ga0070679_100130194 3300005530 Bacteria 2497
23 Ga0068853_100130979 3300005539 Bacteria 2245
24 Ga0068853_101050660 3300005539 Bacteria 785
25 Ga0070686_100260442 3300005544 Bacteria 1271
26 Ga0068855_100065965 3300005563 Bacteria 4220
27 Ga0068854_100001702 3300005578 Bacteria 13388
28 Ga0068852_100137826 3300005616 Bacteria 2254
29 Ga0068863_100075978 3300005841 Bacteria 3178
30 Ga0068860_100376891 3300005843 Bacteria 1400
31 Ga0075365_10018115 3300006038 Bacteria 4324
32 Ga0075364_10018577 3300006051 Bacteria 4353
33 Ga0075369_10113878 3300006186 Bacteria 1220
34 Ga0097621_100145336 3300006237 Bacteria 2030
35 Ga0075370_10428449 3300006353 Bacteria 795
36 Ga0105240_10005462 3300009093 Bacteria 18943
37 Ga0105245_10859695 3300009098 Bacteria 947
38 Ga0105241_10098480 3300009174 Bacteria 2320
39 Ga0105242_10444140 3300009176 Bacteria 1221
40 Ga0105248_10174327 3300009177 Bacteria 2424
41 Ga0105238_10216632 3300009551 Bacteria 1891
42 Ga0105238_10308990 3300009551 Bacteria 1566
43 Ga0105239_10025918 3300010375 Bacteria 6457
44 Ga0105239_10348148 3300010375 Bacteria 1673
45 Ga0105239_10565249 3300010375 Bacteria 1296
46 Ga0157373_10916040 3300013100 Bacteria 651
47 Ga0157369_10702769 3300013105 Bacteria 1041
48 Ga0157374_10165913 3300013296 Bacteria 2152
49 Ga0157378_10000136 3300013297 Bacteria 69380
50 Ga0157378_10000273 3300013297 Bacteria 50350
51 Ga0157375_10000059 3300013308 Bacteria 118614
52 Ga0157380_10573776 3300014326 Bacteria 1111
53 Ga0182008_10035203 3300014497 Bacteria 2509
54 Ga0182006_1070011 3300015261 Bacteria 1303
55 Ga0209677_119597 3300025253 Bacteria 804
56 Ga0209148_1000080 3300025254 Bacteria 277806
57 Ga0209455_1000219 3300025272 Bacteria 79850
58 Ga0209676_1000057 3300025292 Bacteria 361061
59 Ga0209676_1000468 3300025292 Bacteria 67646
60 Ga0209050_1000486 3300025298 Bacteria 69279
61 Ga0209050_1000522 3300025298 Bacteria 63985
62 Ga0209050_1005294 3300025298 Bacteria 8204
63 Ga0207426_1009851 3300025302 Bacteria 3746
64 Ga0209051_1000720 3300025303 Bacteria 36140
65 Ga0209257_1000520 3300025304 Bacteria 66890
66 Ga0209257_1005080 3300025304 Bacteria 9554
67 Ga0207705_10012038 3300025909 Bacteria 6250
68 Ga0207705_10110070 3300025909 Bacteria 2035
69 Ga0207654_10082087 3300025911 Bacteria 1943
70 Ga0207707_10028691 3300025912 Bacteria 4863
71 Ga0207671_10003582 3300025914 Bacteria 15373
72 Ga0207671_10667094 3300025914 Bacteria 828
73 Ga0207660_10160572 3300025917 Bacteria 1734
74 Ga0207657_10136985 3300025919 Bacteria 2002
75 Ga0207657_10280370 3300025919 Bacteria 1323
76 Ga0207652_10066587 3300025921 Bacteria 3122
77 Ga0207694_10146936 3300025924 Bacteria 1898
78 Ga0207694_10401150 3300025924 Bacteria 1140
79 Ga0207690_10264479 3300025932 Bacteria 1334
80 Ga0207689_10010363 3300025942 Bacteria 8032
81 Ga0207640_10001843 3300025981 Bacteria 11365
82 Ga0207703_10825880 3300026035 Bacteria 886
83 Ga0207678_10106412 3300026067 Bacteria 2393
84 Ga0207678_10480736 3300026067 Bacteria 1082
85 Ga0207641_10105769 3300026088 Bacteria 2486
86 Ga0207698_10059418 3300026142 Bacteria 2969
87 Ga0268264_10147474 3300028381 Bacteria 2105
88 Ga0265338_10370565 3300028800 Bacteria 1026
89 Ga0265340_10000223 3300031247 Bacteria 28904
90 Ga0265340_10005815 3300031247 Bacteria 6828
91 Ga0265331_10000006 3300031250 Bacteria 418907
92 Ga0265331_10015033 3300031250 Bacteria 4101
93 Ga0265316_10148259 3300031344 Bacteria 1758
94 Ga0307408_100032395 3300031548 Bacteria 3644
95 Ga0265313_10070366 3300031595 Bacteria 1612
96 Ga0265314_10023733 3300031711 Bacteria 4667
97 Ga0265314_10103412 3300031711 Bacteria 1826
98 Ga0265342_10035660 3300031712 Bacteria 3044
99 Ga0307413_10006196 3300031824 Bacteria 5434
100 Ga0307413_10019510 3300031824 Bacteria 3585
101 Ga0307410_10086480 3300031852 Bacteria 2214
102 Ga0307410_10087433 3300031852 Bacteria 2204
103 Ga0307406_10006216 3300031901 Bacteria 6574
104 Ga0307407_10252004 3300031903 Bacteria 1210
105 Ga0307412_10029315 3300031911 Bacteria 3453
106 Ga0307409_100007660 3300031995 Bacteria 6480
107 Ga0307416_100118056 3300032002 Bacteria 2356
108 Ga0307414_10003914 3300032004 Bacteria 8025
109 Ga0307414_10605082 3300032004 Bacteria 983
110 Ga0307415_100038363 3300032126 Bacteria 3157
111 Ga0436363_0805742 3300039450 Bacteria 1165
112 Ga0451845_0485342 3300041501 Bacteria 1064
113 Ga0451843_1431392 3300041509 Bacteria 1113
114 Ga0495627_000788 3300046453 Bacteria 23346
115 Ga0495591_012288 3300046458 Bacteria 3195
116 Ga0495641_0065989 3300046461 Bacteria 1629
117 Ga0495650_0000034 3300046471 Bacteria 410132
118 Ga0495584_0015110 3300046491 Bacteria 3934
119 Ga0495596_0201043 3300046500 Bacteria 774
120 Ga0495607_0014027 3300046501 Bacteria 5232
121 Ga0495606_0002195 3300046507 Bacteria 23408
122 Ga0495610_0000153 3300046512 Bacteria 76652
123 Ga0495610_0003614 3300046512 Bacteria 11938
124 Ga0495616_0111963 3300046513 Bacteria 1267
125 Ga0495637_0089788 3300046520 Bacteria 1214
126 Ga0495637_0134871 3300046520 Bacteria 940
127 Ga0495648_0014266 3300046524 Bacteria 5826
128 Ga0495654_0000146 3300046530 Bacteria 73331
129 Ga0495609_0311648 3300046538 Bacteria 639
130 Ga0495597_0105161 3300046542 Bacteria 1187
131 Ga0495622_0029238 3300046557 Bacteria 2575
132 Ga0495633_0013516 3300046558 Bacteria 4298
133 Ga0495668_0000019 3300046616 Bacteria 416042
134 Ga0495625_0361709 3300046660 Bacteria 914
135 Ga0495661_0017191 3300046665 Bacteria 4779
136 Ga0495661_0125332 3300046665 Bacteria 1414
137 Ga0495671_0017656 3300046692 Bacteria 3795
138 Ga0495649_0022851 3300046694 Bacteria 3497
139 Ga0495589_0016646 3300046794 Bacteria 3777
140 Ga0495660_0000020 3300046810 Bacteria 304768
141 Ga0495672_0000011 3300047320 Bacteria 535362
142 Ga0495672_0188549 3300047320 Bacteria 1039
143 Ga0495676_0368484 3300047321 Bacteria 958
144 Ga0495683_0037794 3300047323 Bacteria 2445
145 Ga0495679_011237 3300047446 Bacteria 3469
146 Ga0495673_0000020 3300047469 Bacteria 548327
147 Ga0495673_0080217 3300047469 Bacteria 1353
148 Ga0495681_0000015 3300047470 Bacteria 183538
149 Ga0495686_0000864 3300047472 Bacteria 38828
150 Ga0495686_0025608 3300047472 Bacteria 3866
151 Ga0495686_0077541 3300047472 Bacteria 2034
152 Ga0495686_0172723 3300047472 Bacteria 1256
153 Ga0496100_0116577 3300048903 Bacteria 1864
154 Ga0496101_0822801 3300048904 Bacteria 732
155 Ga0496102_0052595 3300048905 Bacteria 3712
156 Ga0496104_0776137 3300048907 Bacteria 865
157 Ga0496106_0060422 3300048909 Bacteria 2873
158 Ga0496112_0028508 3300048915 Bacteria 5390
159 Ga0496113_0319694 3300048916 Bacteria 1244
160 Ga0496114_0708647 3300048917 Bacteria 882
161 Ga0496115_0385130 3300048918 Bacteria 1140
162 Ga0496115_0507593 3300048918 Bacteria 968
163 Ga0496118_0156405 3300048921 Bacteria 1417
164 Ga0496122_0115283 3300048925 Bacteria 1751
165 Ga0496123_0052973 3300048926 Bacteria 2686
166 Ga0496124_0004871 3300048927 Bacteria 15435
167 Ga0496124_0014207 3300048927 Bacteria 7714
168 Ga0496124_0020765 3300048927 Bacteria 6061
169 Ga0496124_0138049 3300048927 Bacteria 1928
170 Ga0496124_0138609 3300048927 Bacteria 1923
171 Ga0496124_0304141 3300048927 Bacteria 1150
172 Ga0496125_0113283 3300048928 Bacteria 1957
173 Ga0496125_0239066 3300048928 Bacteria 1155
174 Ga0496126_0022224 3300048929 Bacteria 6175
175 Ga0495678_000551 3300049459 Bacteria 36076
176 Ga0495682_0000005 3300049460 Bacteria 360387
177 Ga0495682_0014588 3300049460 Bacteria 2979
178 Ga0501321_009287 3300049537 Bacteria 1059
179 Ga0501036_0306033 3300049572 Bacteria 1329
180 Ga0501043_0018304 3300049579 Bacteria 5493
181 Ga0501046_0098327 3300049580 Bacteria 2247
182 Ga0501047_0019401 3300049581 Bacteria 6523
183 Ga0501047_0682936 3300049581 Bacteria 845
184 Ga0501067_0246469 3300049583 Bacteria 994
185 Ga0501072_0021773 3300049588 Bacteria 4971
186 Ga0501074_0230810 3300049590 Bacteria 1317
187 Ga0501202_072383 3300049652 Bacteria 797
188 Ga0501247_011748 3300049677 Bacteria 1059
189 Ga0501249_001366 3300049679 Bacteria 5057
190 Ga0501044_0315768 3300049823 Bacteria 1488
191 nmdc:mga03n38_17870_c1 3300050490 Bacteria 2786
192 nmdc:mga07m45_17612_c1 3300050496 Bacteria 3841
193 nmdc:mga07m45_343134_c1 3300050496 Bacteria 868
194 nmdc:mga0sz30_4001_c1 3300050516 Bacteria 5308
195 Ga0500647_0034810 3300053091 Bacteria 2406
196 Ga0500651_0002216 3300053093 Bacteria 10188
197 Ga0500566_0004635 3300053094 Bacteria 8176
198 Ga0500641_0118754 3300053096 Bacteria 1139
199 Ga0500555_001028 3300053103 Bacteria 9426
200 Ga0500608_242209 3300053122 Bacteria 710
201 Ga0500621_000014 3300053126 Bacteria 126576
202 Ga0500642_0003804 3300053130 Bacteria 4626
203 Ga0500655_000030 3300053133 Bacteria 39615
204 Ga0500559_0092558 3300053136 Bacteria 1385
205 Ga0500559_0114902 3300053136 Bacteria 1249
206 Ga0500577_0030248 3300053142 Bacteria 1883
207 Ga0500622_0019825 3300053156 Bacteria 3569
208 Ga0500622_0067908 3300053156 Bacteria 1807
209 Ga0500622_0171142 3300053156 Bacteria 1011
210 Ga0500624_000018 3300053157 Bacteria 131677
211 Ga0500570_008941 3300053724 Bacteria 5549
212 Ga0501082_0195199 3300060353 Bacteria 1761
213 2507511198 2507262055 Bacteria 8048963
214 2508693743 2508501042 Bacteria 8719808
215 2512932655 2512875016 Bacteria 6529530
216 2514010461 2513237161 Bacteria 8871253
217 2538427315 2537561728 Bacteria 5149301
218 2585262521 2582581305 Bacteria 4895574
219 2588518738 2588253730 Bacteria 6881675
220 2600226766 2599185359 Bacteria 4772316
221 2617350559 2617270735 Bacteria 9163226
222 2753767431 2751185897 Bacteria 5322941
223 2819715787 2818991466 Bacteria 4748179
224 2838129118 2838122688 Bacteria 8803140
225 2841990339 2841983080 Bacteria 8395090
226 2852103780 2852103415 Bacteria 5193810
227 2855198698 2855195626 Bacteria 4927512
228 2858470082 2858466076 Bacteria 4722413
229 2871277193 2871272651 Bacteria 5042015
230 2876365093 2876363079 Bacteria 6544991
231 2885411568 2885409591 Bacteria 9235467
232 2900054103 2900051742 Bacteria 4985156
233 2900055769 2900051742 Bacteria 4985156
234 2903450093 2903448605 Bacteria 7357801
235 2903522172 2903521522 Bacteria 6525694
236 2903528550 2903528002 Bacteria 6586099
237 2909047323 2909042592 Bacteria 6499737
238 2928029161 2928027323 Bacteria 4382488
239 2928529801 2928526807 Bacteria 4760224
240 2928535190 2928531327 Bacteria 5101314
241 2928970702 2928968154 Bacteria 4633371
242 2935653530 2935648319 Bacteria 8801166
243 2935662279 2935656913 Bacteria 8965014
244 2935986183 2935984226 Bacteria 8302647
245 2936016581 2936011229 Bacteria 8801034
246 2936025105 2936019824 Bacteria 8804134
247 2936034056 2936028420 Bacteria 8965941
248 2936052004 2936046547 Bacteria 8903709
249 2936059777 2936055302 Bacteria 8785755
250 2937852119 2937848649 Bacteria 6983481
251 2963646548 2963644680 Bacteria 6530403
252 2965069141 2965062239 Bacteria 7412989
253 2968090659 2968083720 Bacteria 7351627
254 2968134494 2968128360 Bacteria 6270294
255 2977926161 2977922695 Bacteria 6956781
256 2977988595 2977986579 Bacteria 6581278
257 2984555397 2984555340 Bacteria 4247089
258 2993357504 2993356040 Bacteria 4247105
259 3004217944 3004211236 Bacteria 7417683
260 3004221008 3004218560 Bacteria 7421728
261 3004335876 3004334049 Bacteria 8449246
262 637075751 637000159 Bacteria 7596297
263 8055434532 8055431914 Bacteria 4551896
264 Ga0495668_0051339
265 JGI24740J21852_10023959
266 JGI25160J50197_1012675
267 Ga0055542_1000792
268 Ga0055529_1004278
269 Ga0055526_1014647
270 Ga0055536_1000344
271 Ga0055536_1000492
272 Ga0055530_10002951
273 Ga0055530_10013013
274 Ga0055531_10000526
275 Ga0055543_1043435
276 Ga0070658_10095923
277 Ga0070658_10186792
278 Ga0068869_100213194
279 Ga0070680_100022494
280 Ga0070660_100323302
281 Ga0070691_10004399
282 Ga0070671_100023569
283 Ga0070681_10037373
284 Ga0070685_10003083
285 Ga0070679_100130194
286 Ga0068853_100130979
287 Ga0068853_101050660
288 Ga0070686_100260442
289 Ga0068855_100065965
290 Ga0068854_100001702
291 Ga0068852_100137826
292 Ga0068863_100075978
293 Ga0068860_100376891
294 Ga0075365_10018115
295 Ga0075364_10018577
296 Ga0075369_10113878
297 Ga0097621_100145336
298 Ga0075370_10428449
299 Ga0105240_10005462
300 Ga0105245_10859695
301 Ga0105241_10098480
302 Ga0105242_10444140
303 Ga0105248_10174327
304 Ga0105238_10216632
305 Ga0105238_10308990
306 Ga0105239_10025918
307 Ga0105239_10348148
308 Ga0105239_10565249
309 Ga0157373_10916040
310 Ga0157369_10702769
311 Ga0157374_10165913
312 Ga0157378_10000136
313 Ga0157378_10000273
314 Ga0157375_10000059
315 Ga0157380_10573776
316 Ga0182008_10035203
317 Ga0182006_1070011
318 Ga0209677_119597
319 Ga0209148_1000080
320 Ga0209455_1000219
321 Ga0209676_1000057
322 Ga0209676_1000468
323 Ga0209050_1000486
324 Ga0209050_1000522
325 Ga0209050_1005294
326 Ga0207426_1009851
327 Ga0209051_1000720
328 Ga0209257_1000520
329 Ga0209257_1005080
330 Ga0207705_10012038
331 Ga0207705_10110070
332 Ga0207654_10082087
333 Ga0207707_10028691
334 Ga0207671_10003582
335 Ga0207671_10667094
336 Ga0207660_10160572
337 Ga0207657_10136985
338 Ga0207657_10280370
339 Ga0207652_10066587
340 Ga0207694_10146936
341 Ga0207694_10401150
342 Ga0207690_10264479
343 Ga0207689_10010363
344 Ga0207640_10001843
345 Ga0207703_10825880
346 Ga0207678_10106412
347 Ga0207678_10480736
348 Ga0207641_10105769
349 Ga0207698_10059418
350 Ga0268264_10147474
351 Ga0265338_10370565
352 Ga0265340_10000223
353 Ga0265340_10005815
354 Ga0265331_10000006
355 Ga0265331_10015033
356 Ga0265316_10148259
357 Ga0307408_100032395
358 Ga0265313_10070366
359 Ga0265314_10023733
360 Ga0265314_10103412
361 Ga0265342_10035660
362 Ga0307413_10006196
363 Ga0307413_10019510
364 Ga0307410_10086480
365 Ga0307410_10087433
366 Ga0307406_10006216
367 Ga0307407_10252004
368 Ga0307412_10029315
369 Ga0307409_100007660
370 Ga0307416_100118056
371 Ga0307414_10003914
372 Ga0307414_10605082
373 Ga0307415_100038363
374 Ga0436363_0805742
375 Ga0451845_0485342
376 Ga0451843_1431392
377 Ga0495627_000788
378 Ga0495591_012288
379 Ga0495641_0065989
380 Ga0495650_0000034
381 Ga0495584_0015110
382 Ga0495596_0201043
383 Ga0495607_0014027
384 Ga0495606_0002195
385 Ga0495610_0000153
386 Ga0495610_0003614
387 Ga0495616_0111963
388 Ga0495637_0089788
389 Ga0495637_0134871
390 Ga0495648_0014266
391 Ga0495654_0000146
392 Ga0495609_0311648
393 Ga0495597_0105161
394 Ga0495622_0029238
395 Ga0495633_0013516
396 Ga0495668_0000019
397 Ga0495625_0361709
398 Ga0495661_0017191
399 Ga0495661_0125332
400 Ga0495671_0017656
401 Ga0495649_0022851
402 Ga0495589_0016646
403 Ga0495660_0000020
404 Ga0495672_0000011
405 Ga0495672_0188549
406 Ga0495676_0368484
407 Ga0495683_0037794
408 Ga0495679_011237
409 Ga0495673_0000020
410 Ga0495673_0080217
411 Ga0495681_0000015
412 Ga0495686_0000864
413 Ga0495686_0025608
414 Ga0495686_0077541
415 Ga0495686_0172723
416 Ga0496100_0116577
417 Ga0496101_0822801
418 Ga0496102_0052595
419 Ga0496104_0776137
420 Ga0496106_0060422
421 Ga0496112_0028508
422 Ga0496113_0319694
423 Ga0496114_0708647
424 Ga0496115_0385130
425 Ga0496115_0507593
426 Ga0496118_0156405
427 Ga0496122_0115283
428 Ga0496123_0052973
429 Ga0496124_0004871
430 Ga0496124_0014207
431 Ga0496124_0020765
432 Ga0496124_0138049
433 Ga0496124_0138609
434 Ga0496124_0304141
435 Ga0496125_0113283
436 Ga0496125_0239066
437 Ga0496126_0022224
438 Ga0495678_000551
439 Ga0495682_0000005
440 Ga0495682_0014588
441 Ga0501321_009287
442 Ga0501036_0306033
443 Ga0501043_0018304
444 Ga0501046_0098327
445 Ga0501047_0019401
446 Ga0501047_0682936
447 Ga0501067_0246469
448 Ga0501072_0021773
449 Ga0501074_0230810
450 Ga0501202_072383
451 Ga0501247_011748
452 Ga0501249_001366
453 Ga0501044_0315768
454 nmdc:mga03n38_17870_c1
455 nmdc:mga07m45_17612_c1
456 nmdc:mga07m45_343134_c1
457 nmdc:mga0sz30_4001_c1
458 Ga0500647_0034810
459 Ga0500651_0002216
460 Ga0500566_0004635
461 Ga0500641_0118754
462 Ga0500555_001028
463 Ga0500608_242209
464 Ga0500621_000014
465 Ga0500642_0003804
466 Ga0500655_000030
467 Ga0500559_0092558
468 Ga0500559_0114902
469 Ga0500577_0030248
470 Ga0500622_0019825
471 Ga0500622_0067908
472 Ga0500622_0171142
473 Ga0500624_000018
474 Ga0500570_008941
475 Ga0501082_0195199
476 2507511198
477 2508693743
478 2512932655
479 2514010461
480 2538427315
481 2585262521
482 2588518738
483 2600226766
484 2617350559
485 2753767431
486 2819715787
487 2838129118
488 2841990339
489 2852103780
490 2855198698
491 2858470082
492 2871277193
493 2876365093
494 2885411568
495 2900054103
496 2900055769
497 2903450093
498 2903522172
499 2903528550
500 2909047323
501 2928029161
502 2928529801
503 2928535190
504 2928970702
505 2935653530
506 2935662279
507 2935986183
508 2936016581
509 2936025105
510 2936034056
511 2936052004
512 2936059777
513 2937852119
514 2963646548
515 2965069141
516 2968090659
517 2968134494
518 2977926161
519 2977988595
520 2984555397
521 2993357504
522 3004217944
523 3004221008
524 3004335876
525 637075751
526 8055434532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

9

189

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7413 6 186
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7263 1 186
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7212 1 186
8dgl-assembly1.cif.gz_C crystal structure of the rdfs excisionase 0.502 127 185
2j37-assembly1.cif.gz_W model of mammalian srp bound to 80s rncs 0.5007 90 159
ID Description Score Start End Superfamily
af_Q14B70_7_70_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.537 98 159 1.10.10.60
af_Q4DXG1_88_164_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5289 92 185 1.10.238.10
af_Q4DXG1_88_164_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5064 92 185 1.10.238.10
1kcyA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4989 94 187 1.10.238.10
5le5J00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.4933 88 146 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A536ZNA7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9795 111 184 GO:0005524
GO:0005886
GO:0008556
AF-A0A8B3G858-F1-model_v4 deleted 0.9759 130 184
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.9703 114 187 GO:0005524
GO:0005886
GO:0008556
AF-A0A3L9ZEW8-F1-model_v4 K+-transporting ATPase C subunit 0.9604 120 187 GO:0005524
GO:0005886
GO:0008556
AF-Q8VTB5-F1-model_v4 FrrA 0.9593 127 186 GO:0005524
GO:0005886
GO:0008556

Map