F372113

General Info

Members Datasets Scaffolds Average Seq Length
263 165 263 299

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0078399|Ga0495623_0078399_732_1751
Length 339
Sequence MSVSLRGYDRSGVHFRNNRSSDRIFWRASIVFQVEGVMSNPPVPAELVAAREQFLALVAELRPDLHRYCARLVGSAIDGEDVVQEALAKAFYAISLQPELPPLKPWLFRIAHNTAIDFLRRYERRFVEPMADPPEPVLADPGADPDVMRAALSSFVALPVSQRSAVILKDVLGHSLEEIATSTGTTVAAVKAALVRGRANLRARNQPDFTPWRDRAETSPEERALVSRYVSLFNARDWQGVRDMLLEECRLDLVSKSARRGKAVGLYFDRYAKEHELRFAVGVAEGRDVIGVFRGDGARPEYVILVDFDGDRVALIRDYRYVTYVAEELQFDAHDGGAR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
159 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
160 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
161 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 5.32
Rhizosphere 80.23
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10142956 3300003322 Unclassified 2366
2 rootH1_10036714 3300003323 Bacteria 8453
3 rootH1_10040618 3300003323 Bacteria 8083
4 rootH1_10149343 3300003323 Bacteria 6407
5 rootH1_10313642 3300003323 Unclassified 2215
6 Ga0065707_10107689 3300005295 Bacteria 2544
7 Ga0070683_100223573 3300005329 Bacteria 1789
8 Ga0070670_100128888 3300005331 Unclassified 2184
9 Ga0070670_100159520 3300005331 Bacteria 1954
10 Ga0070666_10186223 3300005335 Bacteria 1458
11 Ga0070680_100012257 3300005336 Bacteria 6658
12 Ga0070680_100177613 3300005336 Bacteria 1793
13 Ga0070660_100207972 3300005339 Bacteria 1588
14 Ga0070689_100034725 3300005340 Bacteria 3848
15 Ga0070689_100055260 3300005340 Bacteria 3076
16 Ga0070689_100457853 3300005340 Bacteria 1086
17 Ga0070668_100116780 3300005347 Bacteria 2128
18 Ga0070675_100027211 3300005354 Bacteria 4593
19 Ga0070671_100006429 3300005355 Bacteria 9389
20 Ga0070667_100019182 3300005367 Bacteria 5671
21 Ga0070667_100046083 3300005367 Bacteria 3667
22 Ga0070713_100082378 3300005436 Unclassified 2747
23 Ga0070711_100060308 3300005439 Unclassified 2637
24 Ga0070694_100035739 3300005444 Bacteria 3287
25 Ga0070681_10216031 3300005458 Unclassified 1833
26 Ga0070698_100078758 3300005471 Bacteria 3294
27 Ga0070698_100135795 3300005471 Bacteria 2413
28 Ga0070699_100153038 3300005518 Bacteria 2040
29 Ga0070679_100162395 3300005530 Unclassified 2208
30 Ga0070684_100139973 3300005535 Bacteria 2188
31 Ga0068853_100054219 3300005539 Bacteria 3455
32 Ga0070665_100010244 3300005548 Bacteria 9486
33 Ga0070665_100022086 3300005548 Bacteria 6401
34 Ga0070665_100033767 3300005548 Bacteria 5146
35 Ga0070665_100103737 3300005548 Bacteria 2846
36 Ga0070665_100129422 3300005548 Unclassified 2526
37 Ga0070665_100248239 3300005548 Bacteria 1780
38 Ga0070665_100328553 3300005548 Bacteria 1534
39 Ga0070704_100197627 3300005549 Bacteria 1621
40 Ga0068855_100010142 3300005563 Bacteria 11353
41 Ga0068855_100488936 3300005563 Bacteria 1339
42 Ga0068856_100158061 3300005614 Bacteria 2277
43 Ga0068859_100000036 3300005617 Bacteria 169326
44 Ga0068859_100027775 3300005617 Bacteria 5675
45 Ga0068859_100100120 3300005617 Bacteria 2954
46 Ga0068864_100154742 3300005618 Bacteria 2080
47 Ga0068863_100023966 3300005841 Bacteria 5824
48 Ga0068863_100128487 3300005841 Bacteria 2418
49 Ga0068858_100000418 3300005842 Bacteria 44177
50 Ga0068858_100085979 3300005842 Bacteria 2926
51 Ga0068858_100237201 3300005842 Bacteria 1730
52 Ga0068860_100002002 3300005843 Bacteria 21489
53 Ga0068860_100080546 3300005843 Bacteria 3096
54 Ga0068862_100000058 3300005844 Bacteria 138649
55 Ga0068862_100034217 3300005844 Bacteria 4298
56 Ga0068862_100105811 3300005844 Bacteria 2466
57 Ga0070717_10168026 3300006028 Bacteria 1906
58 Ga0070717_10333572 3300006028 Bacteria 1353
59 Ga0075366_10010931 3300006195 Bacteria 5108
60 Ga0097621_100180503 3300006237 Bacteria 1824
61 Ga0075430_100073991 3300006846 Unclassified 2856
62 Ga0075431_100007796 3300006847 Bacteria 10662
63 Ga0075429_100090704 3300006880 Unclassified 2665
64 Ga0075429_100272703 3300006880 Bacteria 1482
65 Ga0068865_100012021 3300006881 Bacteria 5439
66 Ga0075436_100056392 3300006914 Bacteria 2713
67 Ga0097620_100000036 3300006931 Bacteria 169326
68 Ga0097620_100027775 3300006931 Bacteria 5675
69 Ga0097620_100100118 3300006931 Bacteria 2954
70 Ga0097620_100266423 3300006931 Bacteria 1805
71 Ga0075435_100171942 3300007076 Bacteria 1828
72 Ga0075435_100375045 3300007076 Bacteria 1222
73 Ga0099794_10025692 3300007265 Bacteria 2715
74 Ga0099794_10043305 3300007265 Bacteria 2148
75 Ga0099794_10078018 3300007265 Bacteria 1630
76 Ga0099795_10005677 3300007788 Bacteria 3343
77 Ga0105250_10029200 3300009092 Bacteria 2219
78 Ga0105240_10031436 3300009093 Bacteria 6885
79 Ga0105240_10050251 3300009093 Bacteria 5258
80 Ga0105240_10072973 3300009093 Unclassified 4239
81 Ga0105240_10101701 3300009093 Bacteria 3495
82 Ga0105240_10243704 3300009093 Unclassified 2082
83 Ga0111539_10269824 3300009094 Bacteria 1981
84 Ga0105245_10000009 3300009098 Bacteria 279713
85 Ga0105247_10000267 3300009101 Bacteria 48481
86 Ga0105247_10002330 3300009101 Bacteria 12976
87 Ga0105247_10023223 3300009101 Bacteria 3736
88 Ga0105248_10018835 3300009177 Bacteria 7635
89 Ga0105248_10067163 3300009177 Bacteria 4025
90 Ga0105248_10097027 3300009177 Unclassified 3321
91 Ga0105237_10044650 3300009545 Bacteria 4462
92 Ga0105237_10178336 3300009545 Bacteria 2125
93 Ga0105237_10406585 3300009545 Bacteria 1366
94 Ga0105237_10438730 3300009545 Bacteria 1311
95 Ga0105238_10038748 3300009551 Bacteria 4839
96 Ga0105238_10117555 3300009551 Unclassified 2639
97 Ga0105238_10185709 3300009551 Bacteria 2055
98 Ga0105238_10194522 3300009551 Unclassified 2004
99 Ga0105238_10252395 3300009551 Bacteria 1742
100 Ga0105249_10087517 3300009553 Bacteria 2907
101 Ga0105249_10152641 3300009553 Bacteria 2225
102 Ga0099796_10003240 3300010159 Bacteria 3739
103 Ga0099796_10004526 3300010159 Bacteria 3376
104 Ga0105239_10277647 3300010375 Bacteria 1886
105 Ga0157370_10031127 3300013104 Bacteria 5222
106 Ga0157374_10276187 3300013296 Unclassified 1658
107 Ga0163162_10000030 3300013306 Bacteria 163717
108 Ga0163162_10003881 3300013306 Bacteria 14350
109 Ga0163162_10099075 3300013306 Bacteria 3005
110 Ga0163162_10208087 3300013306 Unclassified 2086
111 Ga0157372_10027255 3300013307 Bacteria 6220
112 Ga0157375_10020662 3300013308 Bacteria 6020
113 Ga0163163_10016883 3300014325 Bacteria 6795
114 Ga0163163_10065385 3300014325 Bacteria 3610
115 Ga0157379_10014623 3300014968 Bacteria 6881
116 Ga0157379_10061177 3300014968 Bacteria 3368
117 Ga0157379_10169434 3300014968 Bacteria 1971
118 Ga0157376_10002972 3300014969 Bacteria 11623
119 Ga0157376_10039953 3300014969 Bacteria 3831
120 Ga0157376_10261045 3300014969 Unclassified 1623
121 Ga0157376_10262306 3300014969 Unclassified 1619
122 Ga0213872_10019761 3300021361 Unclassified 3102
123 Ga0207696_1050363 3300025711 Bacteria 1192
124 Ga0207710_10001263 3300025900 Bacteria 12791
125 Ga0207710_10024081 3300025900 Bacteria 2620
126 Ga0207710_10032828 3300025900 Bacteria 2275
127 Ga0207680_10043067 3300025903 Bacteria 2645
128 Ga0207707_10027493 3300025912 Unclassified 4974
129 Ga0207707_10052202 3300025912 Bacteria 3561
130 Ga0207695_10030082 3300025913 Bacteria 5985
131 Ga0207695_10191264 3300025913 Unclassified 1964
132 Ga0207660_10035005 3300025917 Bacteria 3484
133 Ga0207660_10120661 3300025917 Bacteria 1985
134 Ga0207662_10118103 3300025918 Bacteria 1660
135 Ga0207652_10005665 3300025921 Bacteria 10132
136 Ga0207652_10054490 3300025921 Bacteria 3438
137 Ga0207694_10042309 3300025924 Bacteria 3514
138 Ga0207694_10306308 3300025924 Bacteria 1309
139 Ga0207694_10307901 3300025924 Bacteria 1305
140 Ga0207687_10000045 3300025927 Bacteria 99967
141 Ga0207644_10012632 3300025931 Bacteria 5613
142 Ga0207644_10244978 3300025931 Bacteria 1428
143 Ga0207686_10002065 3300025934 Bacteria 11068
144 Ga0207670_10039238 3300025936 Bacteria 3100
145 Ga0207704_10018945 3300025938 Bacteria 3605
146 Ga0207711_10054683 3300025941 Bacteria 3426
147 Ga0207711_10223644 3300025941 Unclassified 1722
148 Ga0207711_10339000 3300025941 Bacteria 1391
149 Ga0207667_10010882 3300025949 Bacteria 10609
150 Ga0207667_10436012 3300025949 Bacteria 1332
151 Ga0207712_10183151 3300025961 Unclassified 1647
152 Ga0207658_10040656 3300025986 Bacteria 3363
153 Ga0207677_10219177 3300026023 Bacteria 1525
154 Ga0207703_10002243 3300026035 Bacteria 16902
155 Ga0207703_10008627 3300026035 Bacteria 8042
156 Ga0207678_10062845 3300026067 Unclassified 3191
157 Ga0207702_10315493 3300026078 Bacteria 1487
158 Ga0207641_10004999 3300026088 Bacteria 11370
159 Ga0207641_10129105 3300026088 Bacteria 2267
160 Ga0207641_10142694 3300026088 Bacteria 2163
161 Ga0207676_10474431 3300026095 Bacteria 1184
162 Ga0207675_100057932 3300026118 Bacteria 3615
163 Ga0207683_10412862 3300026121 Unclassified 1243
164 Ga0209588_1019423 3300027671 Bacteria 2120
165 Ga0265356_1008232 3300028017 Bacteria 1191
166 Ga0268266_10024175 3300028379 Bacteria 5170
167 Ga0268265_10000075 3300028380 Bacteria 126053
168 Ga0268265_10011950 3300028380 Bacteria 5875
169 Ga0268264_10000499 3300028381 Bacteria 51388
170 Ga0268264_10024055 3300028381 Bacteria 4970
171 Ga0265334_10016258 3300028573 Bacteria 3079
172 Ga0265318_10001596 3300028577 Bacteria 13112
173 Ga0307517_10049143 3300028786 Bacteria 4323
174 Ga0307515_10000006 3300028794 Bacteria 725810
175 Ga0307515_10020599 3300028794 Bacteria 11750
176 Ga0265338_10052697 3300028800 Bacteria 3647
177 Ga0265338_10198312 3300028800 Bacteria 1515
178 Ga0307511_10000035 3300030521 Bacteria 104063
179 Ga0265325_10001184 3300031241 Bacteria 18612
180 Ga0265340_10040164 3300031247 Bacteria 2306
181 Ga0265339_10002670 3300031249 Bacteria 12698
182 Ga0265339_10155998 3300031249 Unclassified 1151
183 Ga0265316_10001021 3300031344 Bacteria 30377
184 Ga0265316_10003172 3300031344 Bacteria 16721
185 Ga0307509_10000226 3300031507 Bacteria 90768
186 Ga0307509_10003077 3300031507 Bacteria 25910
187 Ga0307509_10053809 3300031507 Bacteria 4289
188 Ga0307509_10063327 3300031507 Bacteria 3894
189 Ga0307509_10155449 3300031507 Bacteria 2194
190 Ga0265313_10024054 3300031595 Bacteria 3263
191 Ga0265314_10000001 3300031711 Bacteria 3792860
192 Ga0265314_10056599 3300031711 Bacteria 2698
193 Ga0265342_10014781 3300031712 Bacteria 5170
194 Ga0307510_10000010 3300033180 Bacteria 377457
195 Ga0307510_10047305 3300033180 Bacteria 4611
196 Ga0373949_0000494 3300035090 Bacteria 13367
197 Ga0373961_0000003 3300035241 Bacteria 149339
198 Ga0373933_0070944 3300035724 Unclassified 2120
199 Ga0373937_0090286 3300036401 Unclassified 2837
200 Ga0395898_0166690 3300037466 Bacteria 2107
201 Ga0395905_0013795 3300037471 Bacteria 7733
202 Ga0466969_0001104 3300044656 Bacteria 14551
203 Ga0466966_0000078 3300044684 Bacteria 62090
204 Ga0466966_0050870 3300044684 Bacteria 2635
205 Ga0466961_0120228 3300044693 Bacteria 1649
206 Ga0466963_0030682 3300044694 Bacteria 3471
207 Ga0466971_0003602 3300044719 Bacteria 6617
208 Ga0466960_0043549 3300044901 Unclassified 2136
209 Ga0466967_0280778 3300045976 Bacteria 1598
210 Ga0495629_0211910 3300046459 Bacteria 1338
211 Ga0495580_0000595 3300046472 Bacteria 30578
212 Ga0495580_0050918 3300046472 Bacteria 2928
213 Ga0495628_0234089 3300046516 Bacteria 1376
214 Ga0495632_0135371 3300046519 Bacteria 1145
215 Ga0495623_0078399 3300046679 Bacteria 2048
216 Ga0495658_0039095 3300046683 Bacteria 2631
217 Ga0495613_0174280 3300046689 Bacteria 1525
218 Ga0495636_0036846 3300047318 Bacteria 2019
219 Ga0495686_0027796 3300047472 Bacteria 3689
220 Ga0495593_0127726 3300047673 Bacteria 1292
221 Ga0495602_0093942 3300048088 Bacteria 2480
222 Ga0496102_0051666 3300048905 Bacteria 3745
223 Ga0496102_0075455 3300048905 Unclassified 3100
224 Ga0496103_0112683 3300048906 Unclassified 1728
225 Ga0496104_0000057 3300048907 Bacteria 119211
226 Ga0496105_0000037 3300048908 Bacteria 119355
227 Ga0496106_0049727 3300048909 Bacteria 3159
228 Ga0496110_0466448 3300048913 Bacteria 1151
229 Ga0496111_0313313 3300048914 Bacteria 1163
230 Ga0496112_0007912 3300048915 Bacteria 9469
231 Ga0496113_0025370 3300048916 Bacteria 4224
232 Ga0496114_0054347 3300048917 Bacteria 3339
233 Ga0496115_0064976 3300048918 Bacteria 2947
234 Ga0496115_0161293 3300048918 Bacteria 1853
235 Ga0496115_0213959 3300048918 Unclassified 1592
236 Ga0496117_0000152 3300048920 Bacteria 147897
237 Ga0496118_0000052 3300048921 Bacteria 237465
238 Ga0496119_0000275 3300048922 Bacteria 72619
239 Ga0496119_0001275 3300048922 Bacteria 31240
240 Ga0496119_0052678 3300048922 Bacteria 2491
241 Ga0496120_0000286 3300048923 Bacteria 84869
242 Ga0496121_0016441 3300048924 Bacteria 7641
243 Ga0496121_0076314 3300048924 Unclassified 2672
244 Ga0496121_0171077 3300048924 Bacteria 1578
245 Ga0496125_0001192 3300048928 Bacteria 39310
246 Ga0496125_0015552 3300048928 Bacteria 7350
247 Ga0496126_0039757 3300048929 Bacteria 4362
248 Ga0496126_0289426 3300048929 Unclassified 1355
249 nmdc:mga0k408_8593_c1 3300050493 Bacteria 5487
250 nmdc:mga09592_14437_c1 3300050508 Bacteria 6447
251 nmdc:mga09592_23686_c1 3300050508 Bacteria 5071
252 nmdc:mga09592_361121_c1 3300050508 Bacteria 1257
253 nmdc:mga0qj67_86689_c1 3300050509 Bacteria 2512
254 nmdc:mga06r32_332724_c1 3300050510 Unclassified 1504
255 nmdc:mga0rr50_485712_c1 3300050513 Bacteria 1049
256 Ga0500635_0006681 3300053080 Bacteria 3089
257 Ga0500583_0009854 3300053092 Bacteria 3515
258 Ga0500566_0002646 3300053094 Bacteria 10664
259 Ga0500614_003128 3300053123 Unclassified 3592
260 Ga0500568_0028441 3300053139 Bacteria 2330
261 Ga0500603_001852 3300053150 Bacteria 4733
262 Ga0500622_0067249 3300053156 Bacteria 1818
263 Ga0466962_0003230 3300061719 Bacteria 7746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10276187 Ga0157374_102761873 245
2 3300014325 Ga0163163_10065385 Ga0163163_100653855 245
3 3300046519 Ga0495632_0135371 Ga0495632_0135371_35_823 248
4 3300026121 Ga0207683_10412862 Ga0207683_104128622 253
5 3300009553 Ga0105249_10087517 Ga0105249_100875174 258
6 3300009551 Ga0105238_10038748 Ga0105238_100387486 260
7 3300031507 Ga0307509_10053809 Ga0307509_100538092 267
8 3300005340 Ga0070689_100055260 Ga0070689_1000552602 269
9 3300025936 Ga0207670_10039238 Ga0207670_100392383 269
10 3300046472 Ga0495580_0000595 Ga0495580_0000595_15762_16661 269
11 3300003323 rootH1_10313642 rootH1_103136423 271
12 3300048924 Ga0496121_0076314 Ga0496121_0076314_1097_1975 271
13 3300003323 rootH1_10040618 rootH1_100406187 272
14 3300005444 Ga0070694_100035739 Ga0070694_1000357392 272
15 3300005471 Ga0070698_100078758 Ga0070698_1000787583 272
16 3300005549 Ga0070704_100197627 Ga0070704_1001976272 272
17 3300044901 Ga0466960_0043549 Ga0466960_0043549_201_1079 272
18 3300005548 Ga0070665_100129422 Ga0070665_1001294223 273
19 3300005844 Ga0068862_100105811 Ga0068862_1001058112 273
20 3300006914 Ga0075436_100056392 Ga0075436_1000563924 273
21 3300009093 Ga0105240_10031436 Ga0105240_100314365 273
22 3300009553 Ga0105249_10152641 Ga0105249_101526412 273
23 3300025913 Ga0207695_10191264 Ga0207695_101912642 273
24 3300025961 Ga0207712_10183151 Ga0207712_101831512 273
25 3300028380 Ga0268265_10011950 Ga0268265_100119503 273
26 3300048905 Ga0496102_0075455 Ga0496102_0075455_1512_2375 273
27 3300048906 Ga0496103_0112683 Ga0496103_0112683_707_1570 273
28 3300048920 Ga0496117_0000152 Ga0496117_0000152_71942_72805 273
29 3300048921 Ga0496118_0000052 Ga0496118_0000052_111046_111909 273
30 3300048922 Ga0496119_0001275 Ga0496119_0001275_12879_13742 273
31 3300048929 Ga0496126_0039757 Ga0496126_0039757_2033_2896 273
32 3300048929 Ga0496126_0289426 Ga0496126_0289426_15_875 273
33 3300005563 Ga0068855_100488936 Ga0068855_1004889362 274
34 3300025949 Ga0207667_10436012 Ga0207667_104360121 274
35 3300026078 Ga0207702_10315493 Ga0207702_103154932 274
36 3300036401 Ga0373937_0090286 Ga0373937_0090286_246_1160 274
37 3300006880 Ga0075429_100272703 Ga0075429_1002727032 276
38 3300050508 nmdc:mga09592_14437_c1 nmdc:mga09592_14437_c1_5247_6155 276
39 3300053080 Ga0500635_0006681 Ga0500635_0006681_176_1066 276
40 3300053094 Ga0500566_0002646 Ga0500566_0002646_3094_3984 276
41 3300053150 Ga0500603_001852 Ga0500603_001852_3156_4046 276
42 3300005548 Ga0070665_100022086 Ga0070665_1000220866 277
43 3300005617 Ga0068859_100100120 Ga0068859_1001001204 277
44 3300006931 Ga0097620_100100118 Ga0097620_1001001182 277
45 3300009177 Ga0105248_10097027 Ga0105248_100970273 277
46 3300025941 Ga0207711_10223644 Ga0207711_102236442 277
47 3300026067 Ga0207678_10062845 Ga0207678_100628452 277
48 3300053139 Ga0500568_0028441 Ga0500568_0028441_1182_2021 277
49 3300009093 Ga0105240_10072973 Ga0105240_100729735 278
50 3300009545 Ga0105237_10406585 Ga0105237_104065852 278
51 3300009551 Ga0105238_10252395 Ga0105238_102523952 278
52 3300010159 Ga0099796_10003240 Ga0099796_100032401 278
53 3300033180 Ga0307510_10000010 Ga0307510_10000010189 278
54 3300048907 Ga0496104_0000057 Ga0496104_0000057_57161_58138 278
55 3300048908 Ga0496105_0000037 Ga0496105_0000037_57301_58278 278
56 3300048913 Ga0496110_0466448 Ga0496110_0466448_150_1061 278
57 3300048918 Ga0496115_0213959 Ga0496115_0213959_41_949 278
58 3300048922 Ga0496119_0000275 Ga0496119_0000275_69993_70892 278
59 3300048923 Ga0496120_0000286 Ga0496120_0000286_76243_77142 278
60 3300005331 Ga0070670_100159520 Ga0070670_1001595203 279
61 3300009101 Ga0105247_10002330 Ga0105247_100023309 279
62 3300009101 Ga0105247_10023223 Ga0105247_100232233 279
63 3300009545 Ga0105237_10438730 Ga0105237_104387302 279
64 3300009551 Ga0105238_10117555 Ga0105238_101175553 279
65 3300013306 Ga0163162_10208087 Ga0163162_102080873 279
66 3300014968 Ga0157379_10061177 Ga0157379_100611773 279
67 3300014969 Ga0157376_10262306 Ga0157376_102623062 279
68 3300025900 Ga0207710_10024081 Ga0207710_100240811 279
69 3300025900 Ga0207710_10032828 Ga0207710_100328281 279
70 3300025903 Ga0207680_10043067 Ga0207680_100430672 279
71 3300025924 Ga0207694_10042309 Ga0207694_100423092 279
72 3300026035 Ga0207703_10002243 Ga0207703_1000224310 279
73 3300048924 Ga0496121_0171077 Ga0496121_0171077_668_1564 279
74 3300048928 Ga0496125_0001192 Ga0496125_0001192_34497_35393 279
75 3300053123 Ga0500614_003128 Ga0500614_003128_1462_2391 279
76 3300005335 Ga0070666_10186223 Ga0070666_101862232 280
77 3300005548 Ga0070665_100010244 Ga0070665_1000102449 280
78 3300005843 Ga0068860_100002002 Ga0068860_1000020025 280
79 3300006237 Ga0097621_100180503 Ga0097621_1001805032 280
80 3300009551 Ga0105238_10194522 Ga0105238_101945222 280
81 3300026088 Ga0207641_10004999 Ga0207641_100049998 280
82 3300026095 Ga0207676_10474431 Ga0207676_104744312 280
83 3300028379 Ga0268266_10024175 Ga0268266_100241753 280
84 3300028381 Ga0268264_10000499 Ga0268264_1000049920 280
85 3300033180 Ga0307510_10047305 Ga0307510_100473053 280
86 3300013306 Ga0163162_10000030 Ga0163162_1000003044 281
87 3300037471 Ga0395905_0013795 Ga0395905_0013795_6619_7491 281
88 3300044656 Ga0466969_0001104 Ga0466969_0001104_10046_10924 281
89 3300044684 Ga0466966_0000078 Ga0466966_0000078_61125_62003 281
90 3300044693 Ga0466961_0120228 Ga0466961_0120228_458_1336 281
91 3300044694 Ga0466963_0030682 Ga0466963_0030682_1840_2718 281
92 3300044719 Ga0466971_0003602 Ga0466971_0003602_2832_3710 281
93 3300061719 Ga0466962_0003230 Ga0466962_0003230_2908_3786 281
94 3300005329 Ga0070683_100223573 Ga0070683_1002235732 282
95 3300005458 Ga0070681_10216031 Ga0070681_102160312 282
96 3300005530 Ga0070679_100162395 Ga0070679_1001623953 282
97 3300005535 Ga0070684_100139973 Ga0070684_1001399733 282
98 3300005844 Ga0068862_100034217 Ga0068862_1000342175 282
99 3300006846 Ga0075430_100073991 Ga0075430_1000739913 282
100 3300006847 Ga0075431_100007796 Ga0075431_1000077964 282
101 3300009093 Ga0105240_10243704 Ga0105240_102437042 282
102 3300013307 Ga0157372_10027255 Ga0157372_100272556 282
103 3300014969 Ga0157376_10002972 Ga0157376_100029723 282
104 3300025912 Ga0207707_10027493 Ga0207707_100274932 282
105 3300025924 Ga0207694_10306308 Ga0207694_103063081 282
106 3300025934 Ga0207686_10002065 Ga0207686_100020654 282
107 3300050509 nmdc:mga0qj67_86689_c1 nmdc:mga0qj67_86689_c1_1411_2286 282
108 3300050510 nmdc:mga06r32_332724_c1 nmdc:mga06r32_332724_c1_219_1094 282
109 3300003323 rootH1_10149343 rootH1_101493436 283
110 3300005548 Ga0070665_100033767 Ga0070665_1000337671 283
111 3300005563 Ga0068855_100010142 Ga0068855_10001014211 283
112 3300006881 Ga0068865_100012021 Ga0068865_1000120214 283
113 3300009093 Ga0105240_10101701 Ga0105240_101017013 283
114 3300009545 Ga0105237_10178336 Ga0105237_101783363 283
115 3300013104 Ga0157370_10031127 Ga0157370_100311274 283
116 3300013306 Ga0163162_10003881 Ga0163162_1000388110 283
117 3300013308 Ga0157375_10020662 Ga0157375_100206624 283
118 3300025938 Ga0207704_10018945 Ga0207704_100189453 283
119 3300025949 Ga0207667_10010882 Ga0207667_1001088210 283
120 3300044684 Ga0466966_0050870 Ga0466966_0050870_264_1196 283
121 3300048922 Ga0496119_0052678 Ga0496119_0052678_1323_2264 283
122 3300050493 nmdc:mga0k408_8593_c1 nmdc:mga0k408_8593_c1_203_1105 283
123 3300003323 rootH1_10036714 rootH1_1003671410 284
124 3300006028 Ga0070717_10333572 Ga0070717_103335722 284
125 3300006880 Ga0075429_100090704 Ga0075429_1000907044 284
126 3300013306 Ga0163162_10099075 Ga0163162_100990752 284
127 3300031507 Ga0307509_10003077 Ga0307509_1000307722 284
128 3300035724 Ga0373933_0070944 Ga0373933_0070944_580_1461 284
129 3300047318 Ga0495636_0036846 Ga0495636_0036846_156_1049 284
130 3300050508 nmdc:mga09592_23686_c1 nmdc:mga09592_23686_c1_1382_2242 284
131 3300053092 Ga0500583_0009854 Ga0500583_0009854_1886_2746 284
132 3300005331 Ga0070670_100128888 Ga0070670_1001288882 285
133 3300005336 Ga0070680_100012257 Ga0070680_1000122577 285
134 3300005339 Ga0070660_100207972 Ga0070660_1002079722 285
135 3300005340 Ga0070689_100034725 Ga0070689_1000347253 285
136 3300005347 Ga0070668_100116780 Ga0070668_1001167801 285
137 3300005367 Ga0070667_100019182 Ga0070667_1000191824 285
138 3300005539 Ga0068853_100054219 Ga0068853_1000542193 285
139 3300005548 Ga0070665_100103737 Ga0070665_1001037372 285
140 3300005614 Ga0068856_100158061 Ga0068856_1001580612 285
141 3300005617 Ga0068859_100000036 Ga0068859_10000003661 285
142 3300005618 Ga0068864_100154742 Ga0068864_1001547423 285
143 3300005841 Ga0068863_100128487 Ga0068863_1001284871 285
144 3300005842 Ga0068858_100085979 Ga0068858_1000859794 285
145 3300005842 Ga0068858_100237201 Ga0068858_1002372011 285
146 3300005844 Ga0068862_100000058 Ga0068862_10000005870 285
147 3300006028 Ga0070717_10168026 Ga0070717_101680262 285
148 3300006195 Ga0075366_10010931 Ga0075366_100109314 285
149 3300006931 Ga0097620_100000036 Ga0097620_10000003692 285
150 3300006931 Ga0097620_100266423 Ga0097620_1002664232 285
151 3300009098 Ga0105245_10000009 Ga0105245_1000000955 285
152 3300009545 Ga0105237_10044650 Ga0105237_100446504 285
153 3300010375 Ga0105239_10277647 Ga0105239_102776472 285
154 3300014968 Ga0157379_10169434 Ga0157379_101694342 285
155 3300014969 Ga0157376_10039953 Ga0157376_100399536 285
156 3300014969 Ga0157376_10261045 Ga0157376_102610451 285
157 3300025912 Ga0207707_10052202 Ga0207707_100522023 285
158 3300025917 Ga0207660_10035005 Ga0207660_100350053 285
159 3300025918 Ga0207662_10118103 Ga0207662_101181032 285
160 3300025921 Ga0207652_10054490 Ga0207652_100544903 285
161 3300025927 Ga0207687_10000045 Ga0207687_1000004586 285
162 3300025941 Ga0207711_10339000 Ga0207711_103390001 285
163 3300025986 Ga0207658_10040656 Ga0207658_100406562 285
164 3300026023 Ga0207677_10219177 Ga0207677_102191772 285
165 3300026088 Ga0207641_10129105 Ga0207641_101291051 285
166 3300026088 Ga0207641_10142694 Ga0207641_101426943 285
167 3300028380 Ga0268265_10000075 Ga0268265_1000007557 285
168 3300028800 Ga0265338_10052697 Ga0265338_100526972 285
169 3300031507 Ga0307509_10063327 Ga0307509_100633273 285
170 3300035090 Ga0373949_0000494 Ga0373949_0000494_4742_5665 285
171 3300035241 Ga0373961_0000003 Ga0373961_0000003_63509_64381 285
172 3300046459 Ga0495629_0211910 Ga0495629_0211910_40_1068 285
173 3300046472 Ga0495580_0050918 Ga0495580_0050918_327_1355 285
174 3300046683 Ga0495658_0039095 Ga0495658_0039095_717_1745 285
175 3300047673 Ga0495593_0127726 Ga0495593_0127726_57_1085 285
176 3300050508 nmdc:mga09592_361121_c1 nmdc:mga09592_361121_c1_25_888 285
177 3300005436 Ga0070713_100082378 Ga0070713_1000823782 286
178 3300005439 Ga0070711_100060308 Ga0070711_1000603083 286
179 3300005548 Ga0070665_100248239 Ga0070665_1002482392 286
180 3300007076 Ga0075435_100171942 Ga0075435_1001719422 286
181 3300007076 Ga0075435_100375045 Ga0075435_1003750452 286
182 3300007265 Ga0099794_10025692 Ga0099794_100256924 286
183 3300007265 Ga0099794_10078018 Ga0099794_100780182 286
184 3300007788 Ga0099795_10005677 Ga0099795_100056775 286
185 3300009093 Ga0105240_10050251 Ga0105240_100502516 286
186 3300010159 Ga0099796_10004526 Ga0099796_100045263 286
187 3300025913 Ga0207695_10030082 Ga0207695_100300823 286
188 3300025924 Ga0207694_10307901 Ga0207694_103079011 286
189 3300028017 Ga0265356_1008232 Ga0265356_10082322 286
190 3300028573 Ga0265334_10016258 Ga0265334_100162582 286
191 3300005518 Ga0070699_100153038 Ga0070699_1001530382 287
192 3300007265 Ga0099794_10043305 Ga0099794_100433052 287
193 3300027671 Ga0209588_1019423 Ga0209588_10194232 287
194 3300031507 Ga0307509_10000226 Ga0307509_1000022612 287
195 3300046689 Ga0495613_0174280 Ga0495613_0174280_254_1183 287
196 3300048917 Ga0496114_0054347 Ga0496114_0054347_1142_2011 287
197 3300048918 Ga0496115_0064976 Ga0496115_0064976_1195_2064 287
198 3300050513 nmdc:mga0rr50_485712_c1 nmdc:mga0rr50_485712_c1_31_915 287
199 3300005471 Ga0070698_100135795 Ga0070698_1001357953 288
200 3300009177 Ga0105248_10018835 Ga0105248_100188355 288
201 3300025931 Ga0207644_10244978 Ga0207644_102449783 288
202 3300025941 Ga0207711_10054683 Ga0207711_100546833 288
203 3300028794 Ga0307515_10020599 Ga0307515_1002059912 288
204 3300031247 Ga0265340_10040164 Ga0265340_100401642 288
205 3300031249 Ga0265339_10002670 Ga0265339_100026704 288
206 3300031344 Ga0265316_10003172 Ga0265316_1000317215 288
207 3300031711 Ga0265314_10000001 Ga0265314_100000012786 288
208 3300045976 Ga0466967_0280778 Ga0466967_0280778_583_1491 288
209 3300047472 Ga0495686_0027796 Ga0495686_0027796_2673_3578 288
210 3300048914 Ga0496111_0313313 Ga0496111_0313313_67_1011 288
211 3300048915 Ga0496112_0007912 Ga0496112_0007912_1198_2142 288
212 3300048916 Ga0496113_0025370 Ga0496113_0025370_1830_2774 288
213 3300005340 Ga0070689_100457853 Ga0070689_1004578531 289
214 3300026118 Ga0207675_100057932 Ga0207675_1000579324 289
215 3300028577 Ga0265318_10001596 Ga0265318_100015963 289
216 3300028794 Ga0307515_10000006 Ga0307515_10000006208 289
217 3300028800 Ga0265338_10198312 Ga0265338_101983122 289
218 3300031241 Ga0265325_10001184 Ga0265325_1000118416 289
219 3300031249 Ga0265339_10155998 Ga0265339_101559981 289
220 3300031344 Ga0265316_10001021 Ga0265316_1000102112 289
221 3300031595 Ga0265313_10024054 Ga0265313_100240542 289
222 3300031711 Ga0265314_10056599 Ga0265314_100565992 289
223 3300031712 Ga0265342_10014781 Ga0265342_100147813 289
224 3300037466 Ga0395898_0166690 Ga0395898_0166690_454_1368 289
225 3300005336 Ga0070680_100177613 Ga0070680_1001776132 290
226 3300009551 Ga0105238_10185709 Ga0105238_101857093 290
227 3300025917 Ga0207660_10120661 Ga0207660_101206612 290
228 3300025921 Ga0207652_10005665 Ga0207652_100056653 290
229 3300046516 Ga0495628_0234089 Ga0495628_0234089_11_922 290
230 3300046679 Ga0495623_0078399 Ga0495623_0078399_732_1751 290
231 3300048088 Ga0495602_0093942 Ga0495602_0093942_557_1465 290
232 3300005355 Ga0070671_100006429 Ga0070671_1000064296 291
233 3300005367 Ga0070667_100046083 Ga0070667_1000460834 291
234 3300005548 Ga0070665_100328553 Ga0070665_1003285532 291
235 3300005617 Ga0068859_100027775 Ga0068859_1000277754 291
236 3300005841 Ga0068863_100023966 Ga0068863_1000239663 291
237 3300005842 Ga0068858_100000418 Ga0068858_10000041834 291
238 3300005843 Ga0068860_100080546 Ga0068860_1000805463 291
239 3300006931 Ga0097620_100027775 Ga0097620_1000277754 291
240 3300009092 Ga0105250_10029200 Ga0105250_100292002 291
241 3300009101 Ga0105247_10000267 Ga0105247_1000026718 291
242 3300009177 Ga0105248_10067163 Ga0105248_100671633 291
243 3300014325 Ga0163163_10016883 Ga0163163_100168836 291
244 3300014968 Ga0157379_10014623 Ga0157379_100146236 291
245 3300025711 Ga0207696_1050363 Ga0207696_10503631 291
246 3300025900 Ga0207710_10001263 Ga0207710_100012639 291
247 3300025931 Ga0207644_10012632 Ga0207644_100126322 291
248 3300026035 Ga0207703_10008627 Ga0207703_100086278 291
249 3300028381 Ga0268264_10024055 Ga0268264_100240553 291
250 3300030521 Ga0307511_10000035 Ga0307511_1000003567 291
251 3300048905 Ga0496102_0051666 Ga0496102_0051666_210_1223 291
252 3300048909 Ga0496106_0049727 Ga0496106_0049727_707_1720 291
253 3300048918 Ga0496115_0161293 Ga0496115_0161293_331_1236 291
254 3300048924 Ga0496121_0016441 Ga0496121_0016441_1392_2405 291
255 3300048928 Ga0496125_0015552 Ga0496125_0015552_3558_4571 291
256 3300021361 Ga0213872_10019761 Ga0213872_100197611 292
257 3300028786 Ga0307517_10049143 Ga0307517_100491432 293
258 3300031507 Ga0307509_10155449 Ga0307509_101554492 293
259 3300053156 Ga0500622_0067249 Ga0500622_0067249_858_1757 293
260 3300005295 Ga0065707_10107689 Ga0065707_101076892 294
261 3300005354 Ga0070675_100027211 Ga0070675_1000272112 296
262 3300009094 Ga0111539_10269824 Ga0111539_102698241 296
263 3300003322 rootL2_10142956 rootL2_101429562 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

57

125

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

150

201

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9827 117 167
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9811 112 168
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9659 112 169
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9641 119 169
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9632 113 170
ID Description Score Start End Superfamily
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9827 117 167 1.10.10.10
4cxfA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9812 119 169 1.10.10.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9811 112 168 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9678 119 168 1.10.10.10
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9659 112 169 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0Q7TRW0-F1-model_v4 RNA polymerase subunit sigma-70 0.844 15 299 GO:0003677
GO:0006352
GO:0016987
AF-A0A1E5XTP0-F1-model_v4 RNA polymerase subunit sigma-70 0.8294 17 301 GO:0003677
GO:0006352
GO:0016987
AF-A0A0Q7TRW0-F1-model_v4 RNA polymerase subunit sigma-70 0.8143 15 299 GO:0003677
GO:0006352
GO:0016987
AF-A0A6A7M8E9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.806 12 297 GO:0003677
GO:0006352
GO:0016987
AF-A0A7C3MLF6-F1-model_v4 RNA polymerase sigma factor 0.806 20 171 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
81.26 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map