F372658
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 264 | 190 | 244 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300025918|Ga0207662_10496288|Ga0207662_104962881 |
| Length | 245 |
| Sequence | MKAAVLVFPGSNREGDVAQAIELVTGRRPQMIWHGDGDFEKTDLIVLPGGFSYGDYLRCGAMAAQSPVMAEVKKRAAQGVPVLAICNGFQIAAEAGLVPGVLMRNEKLKFICGDVHLKVETSQSLFTNRYQAGQVIKVPVAHAEGNYFAEPAVIAQLEADRQIIFRYTDASGEVVDAANPNGSKASIAGLCNEARNIVGLMPHPERACESILGSADGLAIFESAVAALKTGLFGGPSGSALQAVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 2 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 3 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 4 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 5 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 6 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 7 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 8 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 9 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 10 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 11 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 12 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 13 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 14 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 15 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 16 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 17 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 18 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 91 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 120 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 121 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 125 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 128 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 141 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 142 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 143 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 144 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 145 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 146 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 176 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 177 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 179 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 180 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 181 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 182 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 183 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 184 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 185 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 186 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 187 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 188 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 189 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 190 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.42 |
| Metatranscriptomes | 0 |
| Isolates | 7.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.77 |
| Nodule | 3.79 |
| Rhizoplane | 0 |
| Rhizosphere | 74.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10083518 | 3300003187 | Bacteria | 915 |
| 2 | JGI25406J46586_10000219 | 3300003203 | Bacteria | 25317 |
| 3 | Ga0055535_1004887 | 3300003761 | Bacteria | 3104 |
| 4 | Ga0055541_1001293 | 3300003841 | Bacteria | 5490 |
| 5 | Ga0070658_10008327 | 3300005327 | Bacteria | 8339 |
| 6 | Ga0070676_10102271 | 3300005328 | Bacteria | 1772 |
| 7 | Ga0070690_100461373 | 3300005330 | Bacteria | 944 |
| 8 | Ga0070670_100202793 | 3300005331 | Bacteria | 1724 |
| 9 | Ga0070666_10010654 | 3300005335 | Bacteria | 5756 |
| 10 | Ga0070680_100015841 | 3300005336 | Bacteria | 5918 |
| 11 | Ga0070680_100522819 | 3300005336 | Bacteria | 1016 |
| 12 | Ga0070682_100296567 | 3300005337 | Bacteria | 1184 |
| 13 | Ga0070689_100565925 | 3300005340 | Bacteria | 981 |
| 14 | Ga0070691_10160120 | 3300005341 | Bacteria | 1160 |
| 15 | Ga0070668_100145528 | 3300005347 | Bacteria | 1913 |
| 16 | Ga0070674_100202871 | 3300005356 | Bacteria | 1532 |
| 17 | Ga0070688_100316234 | 3300005365 | Bacteria | 1133 |
| 18 | Ga0070659_100599583 | 3300005366 | Bacteria | 946 |
| 19 | Ga0070713_100098663 | 3300005436 | Bacteria | 2526 |
| 20 | Ga0070710_10122507 | 3300005437 | Bacteria | 1575 |
| 21 | Ga0070701_10216630 | 3300005438 | Bacteria | 1140 |
| 22 | Ga0070708_100701296 | 3300005445 | Bacteria | 953 |
| 23 | Ga0070678_100212458 | 3300005456 | Bacteria | 1604 |
| 24 | Ga0070681_10029061 | 3300005458 | Bacteria | 5550 |
| 25 | Ga0070685_10024538 | 3300005466 | Bacteria | 3313 |
| 26 | Ga0070706_100347490 | 3300005467 | Bacteria | 1382 |
| 27 | Ga0070698_100015620 | 3300005471 | Bacteria | 8018 |
| 28 | Ga0070699_100057798 | 3300005518 | Bacteria | 3359 |
| 29 | Ga0070679_100002889 | 3300005530 | Bacteria | 15609 |
| 30 | Ga0070697_100072310 | 3300005536 | Bacteria | 2830 |
| 31 | Ga0068853_100443856 | 3300005539 | Bacteria | 1220 |
| 32 | Ga0070665_100002041 | 3300005548 | Bacteria | 22725 |
| 33 | Ga0070665_100036248 | 3300005548 | Bacteria | 4962 |
| 34 | Ga0070665_100044210 | 3300005548 | Bacteria | 4473 |
| 35 | Ga0070665_100493404 | 3300005548 | Bacteria | 1236 |
| 36 | Ga0070665_100549037 | 3300005548 | Bacteria | 1167 |
| 37 | Ga0068855_100498471 | 3300005563 | Bacteria | 1323 |
| 38 | Ga0068857_100041147 | 3300005577 | Bacteria | 4098 |
| 39 | Ga0068856_100025379 | 3300005614 | Bacteria | 5779 |
| 40 | Ga0068856_100219317 | 3300005614 | Bacteria | 1917 |
| 41 | Ga0068852_100089471 | 3300005616 | Bacteria | 2752 |
| 42 | Ga0068852_100250718 | 3300005616 | Bacteria | 1696 |
| 43 | Ga0068852_100436752 | 3300005616 | Bacteria | 1293 |
| 44 | Ga0068859_100181338 | 3300005617 | Bacteria | 2188 |
| 45 | Ga0068864_100258895 | 3300005618 | Bacteria | 1618 |
| 46 | Ga0068860_100001632 | 3300005843 | Bacteria | 24029 |
| 47 | Ga0068860_100015356 | 3300005843 | Bacteria | 7481 |
| 48 | Ga0068860_100317506 | 3300005843 | Bacteria | 1529 |
| 49 | Ga0068862_100182252 | 3300005844 | Bacteria | 1885 |
| 50 | Ga0081455_10000434 | 3300005937 | Bacteria | 54939 |
| 51 | Ga0081455_10002143 | 3300005937 | Bacteria | 23543 |
| 52 | Ga0081455_10007176 | 3300005937 | Bacteria | 11778 |
| 53 | Ga0081539_10000207 | 3300005985 | Bacteria | 136970 |
| 54 | Ga0081539_10009772 | 3300005985 | Bacteria | 7934 |
| 55 | Ga0081539_10011462 | 3300005985 | Bacteria | 7001 |
| 56 | Ga0075365_10029237 | 3300006038 | Bacteria | 3520 |
| 57 | Ga0075365_10326099 | 3300006038 | Bacteria | 1081 |
| 58 | Ga0075368_10124368 | 3300006042 | Bacteria | 1069 |
| 59 | Ga0075362_10029282 | 3300006177 | Bacteria | 2372 |
| 60 | Ga0075362_10052564 | 3300006177 | Bacteria | 1826 |
| 61 | Ga0075362_10122617 | 3300006177 | Bacteria | 1231 |
| 62 | Ga0075367_10221399 | 3300006178 | Bacteria | 1184 |
| 63 | Ga0075367_10378253 | 3300006178 | Bacteria | 895 |
| 64 | Ga0075369_10000336 | 3300006186 | Bacteria | 14025 |
| 65 | Ga0075366_10013866 | 3300006195 | Bacteria | 4594 |
| 66 | Ga0075366_10091553 | 3300006195 | Bacteria | 1821 |
| 67 | Ga0075366_10188225 | 3300006195 | Bacteria | 1254 |
| 68 | Ga0075431_100598402 | 3300006847 | Bacteria | 1087 |
| 69 | Ga0075434_100009006 | 3300006871 | Bacteria | 9298 |
| 70 | Ga0068865_100082298 | 3300006881 | Bacteria | 2314 |
| 71 | Ga0075436_100005370 | 3300006914 | Bacteria | 8820 |
| 72 | Ga0097620_100181331 | 3300006931 | Bacteria | 2188 |
| 73 | Ga0097620_100256367 | 3300006931 | Bacteria | 1840 |
| 74 | Ga0105240_10346169 | 3300009093 | Bacteria | 1687 |
| 75 | Ga0111539_10544564 | 3300009094 | Bacteria | 1352 |
| 76 | Ga0114129_10590848 | 3300009147 | Bacteria | 1440 |
| 77 | Ga0105243_10549941 | 3300009148 | Bacteria | 1103 |
| 78 | Ga0105241_10634333 | 3300009174 | Bacteria | 969 |
| 79 | Ga0105241_10660131 | 3300009174 | Bacteria | 951 |
| 80 | Ga0105248_10936393 | 3300009177 | Bacteria | 978 |
| 81 | Ga0105237_10186207 | 3300009545 | Bacteria | 2076 |
| 82 | Ga0105237_10467239 | 3300009545 | Bacteria | 1268 |
| 83 | Ga0105238_10001577 | 3300009551 | Bacteria | 22832 |
| 84 | Ga0105238_10272840 | 3300009551 | Bacteria | 1672 |
| 85 | Ga0105238_10473689 | 3300009551 | Bacteria | 1251 |
| 86 | Ga0105249_10514479 | 3300009553 | Bacteria | 1244 |
| 87 | Ga0105035_107265 | 3300009988 | Bacteria | 930 |
| 88 | Ga0105239_10212405 | 3300010375 | Bacteria | 2169 |
| 89 | Ga0157370_10009458 | 3300013104 | Bacteria | 10410 |
| 90 | Ga0157369_10038152 | 3300013105 | Bacteria | 5254 |
| 91 | Ga0157369_10197245 | 3300013105 | Bacteria | 2113 |
| 92 | Ga0163162_10783964 | 3300013306 | Bacteria | 1071 |
| 93 | Ga0157372_10363751 | 3300013307 | Bacteria | 1686 |
| 94 | Ga0157375_10785570 | 3300013308 | Bacteria | 1101 |
| 95 | Ga0163163_10544599 | 3300014325 | Bacteria | 1223 |
| 96 | Ga0182008_10180163 | 3300014497 | Bacteria | 1069 |
| 97 | Ga0213876_10021715 | 3300021384 | Bacteria | 3395 |
| 98 | Ga0213876_10133145 | 3300021384 | Bacteria | 1322 |
| 99 | Ga0213871_10006183 | 3300021441 | Bacteria | 2520 |
| 100 | Ga0209566_100126 | 3300025225 | Bacteria | 94445 |
| 101 | Ga0209025_1017865 | 3300025294 | Bacteria | 4064 |
| 102 | Ga0209025_1022468 | 3300025294 | Bacteria | 3341 |
| 103 | Ga0207692_10062829 | 3300025898 | Bacteria | 1928 |
| 104 | Ga0207680_10249545 | 3300025903 | Bacteria | 1225 |
| 105 | Ga0207647_10113892 | 3300025904 | Bacteria | 1598 |
| 106 | Ga0207705_10041156 | 3300025909 | Bacteria | 3314 |
| 107 | Ga0207705_10080570 | 3300025909 | Bacteria | 2372 |
| 108 | Ga0207654_10401028 | 3300025911 | Bacteria | 954 |
| 109 | Ga0207707_10013882 | 3300025912 | Bacteria | 7024 |
| 110 | Ga0207695_10067173 | 3300025913 | Bacteria | 3679 |
| 111 | Ga0207695_10249637 | 3300025913 | Bacteria | 1674 |
| 112 | Ga0207695_10522547 | 3300025913 | Bacteria | 1069 |
| 113 | Ga0207693_10166805 | 3300025915 | Bacteria | 1734 |
| 114 | Ga0207660_10035823 | 3300025917 | Bacteria | 3447 |
| 115 | Ga0207662_10479674 | 3300025918 | Bacteria | 854 |
| 116 | Ga0207662_10496288 | 3300025918 | Bacteria | 840 |
| 117 | Ga0207652_10027622 | 3300025921 | Bacteria | 4729 |
| 118 | Ga0207681_10070672 | 3300025923 | Bacteria | 2432 |
| 119 | Ga0207694_10003346 | 3300025924 | Bacteria | 12758 |
| 120 | Ga0207644_10135246 | 3300025931 | Bacteria | 1892 |
| 121 | Ga0207690_10208686 | 3300025932 | Bacteria | 1488 |
| 122 | Ga0207686_10057773 | 3300025934 | Bacteria | 2444 |
| 123 | Ga0207670_10268145 | 3300025936 | Bacteria | 1326 |
| 124 | Ga0207704_10090676 | 3300025938 | Bacteria | 2007 |
| 125 | Ga0207661_10878856 | 3300025944 | Bacteria | 825 |
| 126 | Ga0207679_10229242 | 3300025945 | Bacteria | 1567 |
| 127 | Ga0207674_10032698 | 3300026116 | Bacteria | 5453 |
| 128 | Ga0207674_10190346 | 3300026116 | Bacteria | 2001 |
| 129 | Ga0207683_10232883 | 3300026121 | Bacteria | 1680 |
| 130 | Ga0207698_10474666 | 3300026142 | Bacteria | 1212 |
| 131 | Ga0268266_10001996 | 3300028379 | Bacteria | 22830 |
| 132 | Ga0268266_10009478 | 3300028379 | Bacteria | 8567 |
| 133 | Ga0268266_10186323 | 3300028379 | Bacteria | 1892 |
| 134 | Ga0268266_10346541 | 3300028379 | Bacteria | 1395 |
| 135 | Ga0268266_10850555 | 3300028379 | Bacteria | 882 |
| 136 | Ga0268265_10688481 | 3300028380 | Bacteria | 986 |
| 137 | Ga0268264_10001466 | 3300028381 | Bacteria | 22037 |
| 138 | Ga0316576_10023481 | 3300031727 | Bacteria | 4296 |
| 139 | Ga0307516_10335911 | 3300031730 | Bacteria | 1179 |
| 140 | Ga0307410_10527151 | 3300031852 | Bacteria | 976 |
| 141 | Ga0307412_10452619 | 3300031911 | Bacteria | 1058 |
| 142 | Ga0307415_100411968 | 3300032126 | Bacteria | 1157 |
| 143 | Ga0316583_10096292 | 3300032133 | Bacteria | 1032 |
| 144 | Ga0373923_0059864 | 3300035111 | Bacteria | 1615 |
| 145 | Ga0373941_0151644 | 3300035115 | Bacteria | 851 |
| 146 | Ga0316574_0151000 | 3300035398 | Bacteria | 1497 |
| 147 | Ga0373935_0373484 | 3300035692 | Bacteria | 1020 |
| 148 | Ga0373947_0335811 | 3300035725 | Bacteria | 1012 |
| 149 | Ga0373937_0317985 | 3300036401 | Bacteria | 1473 |
| 150 | Ga0316584_0005789 | 3300036712 | Bacteria | 8336 |
| 151 | Ga0395899_0027167 | 3300037312 | Bacteria | 4317 |
| 152 | Ga0395899_0075637 | 3300037312 | Bacteria | 2458 |
| 153 | Ga0395899_0134515 | 3300037312 | Bacteria | 1763 |
| 154 | Ga0395899_0178224 | 3300037312 | Bacteria | 1493 |
| 155 | Ga0395900_0035147 | 3300037418 | Bacteria | 5162 |
| 156 | Ga0395900_0038828 | 3300037418 | Bacteria | 4908 |
| 157 | Ga0395900_0102804 | 3300037418 | Bacteria | 2935 |
| 158 | Ga0395900_0247013 | 3300037418 | Bacteria | 1787 |
| 159 | Ga0395898_0016415 | 3300037466 | Bacteria | 7578 |
| 160 | Ga0395898_0030276 | 3300037466 | Bacteria | 5417 |
| 161 | Ga0395901_0001851 | 3300038443 | Bacteria | 21879 |
| 162 | Ga0395901_0008119 | 3300038443 | Bacteria | 10600 |
| 163 | Ga0395901_0034540 | 3300038443 | Bacteria | 5222 |
| 164 | Ga0395901_0055930 | 3300038443 | Bacteria | 4104 |
| 165 | Ga0395901_0076455 | 3300038443 | Bacteria | 3493 |
| 166 | Ga0400483_012628 | 3300039062 | Bacteria | 3065 |
| 167 | Ga0400483_052111 | 3300039062 | Bacteria | 2721 |
| 168 | Ga0400483_149301 | 3300039062 | Bacteria | 4392 |
| 169 | Ga0436365_0376694 | 3300039437 | Bacteria | 6274 |
| 170 | Ga0436365_0672716 | 3300039437 | Bacteria | 2585 |
| 171 | Ga0436365_1360918 | 3300039437 | Bacteria | 2123 |
| 172 | Ga0436360_0369505 | 3300039438 | Bacteria | 4319 |
| 173 | Ga0436360_0730862 | 3300039438 | Bacteria | 1074 |
| 174 | Ga0436360_1264475 | 3300039438 | Bacteria | 2587 |
| 175 | Ga0436361_0171581 | 3300039447 | Bacteria | 898 |
| 176 | Ga0436361_0388962 | 3300039447 | Bacteria | 3113 |
| 177 | Ga0436361_1163612 | 3300039447 | Bacteria | 1508 |
| 178 | Ga0436363_0362619 | 3300039450 | Bacteria | 1386 |
| 179 | Ga0436362_0677078 | 3300039453 | Bacteria | 1068 |
| 180 | Ga0439459_0039049 | 3300042438 | Bacteria | 1001 |
| 181 | Ga0466965_0387277 | 3300044683 | Bacteria | 771 |
| 182 | Ga0466963_0174923 | 3300044694 | Bacteria | 1497 |
| 183 | Ga0466963_0360648 | 3300044694 | Bacteria | 1024 |
| 184 | Ga0466957_0363101 | 3300044842 | Bacteria | 984 |
| 185 | Ga0466960_0287310 | 3300044901 | Bacteria | 923 |
| 186 | Ga0451576_0001200 | 3300045051 | Bacteria | 46344 |
| 187 | Ga0466967_0082808 | 3300045976 | Bacteria | 2900 |
| 188 | Ga0495617_119140 | 3300046452 | Bacteria | 851 |
| 189 | Ga0495608_0332007 | 3300046511 | Bacteria | 938 |
| 190 | Ga0495635_0109208 | 3300046663 | Bacteria | 1890 |
| 191 | Ga0495657_0134658 | 3300046675 | Bacteria | 1545 |
| 192 | Ga0495669_0136956 | 3300046684 | Bacteria | 1155 |
| 193 | Ga0495684_0048400 | 3300047471 | Bacteria | 3251 |
| 194 | Ga0495602_0070082 | 3300048088 | Bacteria | 3003 |
| 195 | Ga0495626_0128531 | 3300048091 | Bacteria | 1084 |
| 196 | Ga0496119_0003988 | 3300048922 | Bacteria | 14944 |
| 197 | Ga0496126_0694911 | 3300048929 | Bacteria | 791 |
| 198 | Ga0501032_0169566 | 3300049569 | Bacteria | 1432 |
| 199 | Ga0501033_0026408 | 3300049570 | Bacteria | 4372 |
| 200 | Ga0501033_0045085 | 3300049570 | Bacteria | 3282 |
| 201 | Ga0501033_0083345 | 3300049570 | Bacteria | 2344 |
| 202 | Ga0501033_0444818 | 3300049570 | Bacteria | 901 |
| 203 | Ga0501034_0004242 | 3300049571 | Bacteria | 15992 |
| 204 | Ga0501034_0037546 | 3300049571 | Bacteria | 4905 |
| 205 | Ga0501034_0082176 | 3300049571 | Unclassified | 3224 |
| 206 | Ga0501034_0418246 | 3300049571 | Bacteria | 1262 |
| 207 | Ga0501036_0297230 | 3300049572 | Bacteria | 1351 |
| 208 | Ga0501036_0374384 | 3300049572 | Bacteria | 1189 |
| 209 | Ga0501037_0415800 | 3300049573 | Bacteria | 921 |
| 210 | Ga0501040_0325473 | 3300049576 | Bacteria | 1100 |
| 211 | Ga0501043_0493724 | 3300049579 | Bacteria | 915 |
| 212 | Ga0501046_0332035 | 3300049580 | Bacteria | 1106 |
| 213 | Ga0501047_0430425 | 3300049581 | Bacteria | 1150 |
| 214 | Ga0501047_0680678 | 3300049581 | Bacteria | 847 |
| 215 | Ga0501068_0244956 | 3300049584 | Bacteria | 1141 |
| 216 | Ga0501070_0072638 | 3300049586 | Bacteria | 2848 |
| 217 | Ga0501072_0476030 | 3300049588 | Bacteria | 988 |
| 218 | Ga0501083_0023099 | 3300049744 | Bacteria | 4315 |
| 219 | Ga0501035_0043153 | 3300049822 | Bacteria | 4065 |
| 220 | Ga0501035_0104550 | 3300049822 | Bacteria | 2483 |
| 221 | Ga0501044_0101315 | 3300049823 | Bacteria | 2897 |
| 222 | Ga0501044_0117070 | 3300049823 | Bacteria | 2669 |
| 223 | nmdc:mga03683_27877_c1 | 3300050489 | Bacteria | 2241 |
| 224 | nmdc:mga03683_98994_c1 | 3300050489 | Bacteria | 1280 |
| 225 | nmdc:mga0yw44_65149_c1 | 3300050492 | Bacteria | 2245 |
| 226 | nmdc:mga0yw44_99739_c1 | 3300050492 | Bacteria | 1848 |
| 227 | nmdc:mga0k408_263206_c1 | 3300050493 | Bacteria | 1030 |
| 228 | nmdc:mga0k408_42473_c2 | 3300050493 | Bacteria | 2002 |
| 229 | nmdc:mga06z11_347000_c1 | 3300050494 | Bacteria | 888 |
| 230 | nmdc:mga06z11_69100_c1 | 3300050494 | Bacteria | 1864 |
| 231 | nmdc:mga07m45_48677_c1 | 3300050496 | Bacteria | 2384 |
| 232 | nmdc:mga0sz30_41844_c1 | 3300050516 | Bacteria | 1525 |
| 233 | nmdc:mga0sz30_4363_c1 | 3300050516 | Bacteria | 5108 |
| 234 | Ga0500646_0062843 | 3300053090 | Bacteria | 1097 |
| 235 | Ga0500647_0029848 | 3300053091 | Bacteria | 2588 |
| 236 | Ga0500647_0032251 | 3300053091 | Bacteria | 2496 |
| 237 | Ga0500651_0269936 | 3300053093 | Bacteria | 984 |
| 238 | Ga0500641_0089335 | 3300053096 | Bacteria | 1314 |
| 239 | Ga0500595_056680 | 3300053119 | Bacteria | 1196 |
| 240 | Ga0500658_0243289 | 3300053134 | Bacteria | 826 |
| 241 | Ga0500568_0003910 | 3300053139 | Bacteria | 8106 |
| 242 | Ga0500616_0003394 | 3300053153 | Bacteria | 12221 |
| 243 | Ga0500616_0047233 | 3300053153 | Bacteria | 2286 |
| 244 | Ga0530510_0206537 | 3300061734 | Bacteria | 1459 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035111 | Ga0373923_0059864 | Ga0373923_0059864_10_621 | 193 |
| 2 | 3300044683 | Ga0466965_0387277 | Ga0466965_0387277_150_761 | 193 |
| 3 | 3300053096 | Ga0500641_0089335 | Ga0500641_0089335_18_629 | 193 |
| 4 | 3300049572 | Ga0501036_0297230 | Ga0501036_0297230_153_854 | 210 |
| 5 | iso_pu_bacteria | 2894772417 | 2894774394 | 217 |
| 6 | 3300005336 | Ga0070680_100522819 | Ga0070680_1005228191 | 218 |
| 7 | 3300005616 | Ga0068852_100250718 | Ga0068852_1002507182 | 218 |
| 8 | 3300036401 | Ga0373937_0317985 | Ga0373937_0317985_131_814 | 218 |
| 9 | 3300039438 | Ga0436360_0730862 | Ga0436360_0730862_45_728 | 218 |
| 10 | 3300039447 | Ga0436361_0388962 | Ga0436361_0388962_1138_1821 | 218 |
| 11 | 3300046663 | Ga0495635_0109208 | Ga0495635_0109208_450_1133 | 218 |
| 12 | 3300046675 | Ga0495657_0134658 | Ga0495657_0134658_352_1035 | 218 |
| 13 | 3300047471 | Ga0495684_0048400 | Ga0495684_0048400_1827_2510 | 218 |
| 14 | 3300048088 | Ga0495602_0070082 | Ga0495602_0070082_397_1080 | 218 |
| 15 | 3300048922 | Ga0496119_0003988 | Ga0496119_0003988_4424_5107 | 218 |
| 16 | 3300048929 | Ga0496126_0694911 | Ga0496126_0694911_29_712 | 218 |
| 17 | iso_pu_bacteria | 2842775625 | 2842777951 | 218 |
| 18 | iso_pu_bacteria | 2883577096 | 2883578433 | 218 |
| 19 | 3300045051 | Ga0451576_0001200 | Ga0451576_0001200_20521_21213 | 219 |
| 20 | iso_pu_bacteria | 2513237139 | 2513878047 | 219 |
| 21 | iso_pu_bacteria | 2513237161 | 2514012655 | 219 |
| 22 | iso_pu_bacteria | 2617270735 | 2617352570 | 219 |
| 23 | iso_pu_bacteria | 2802429603 | 2805920007 | 219 |
| 24 | iso_pu_bacteria | 2824671348 | 2824674272 | 219 |
| 25 | iso_pu_bacteria | 2824687955 | 2824690894 | 219 |
| 26 | iso_pu_bacteria | 2824773399 | 2824778207 | 219 |
| 27 | iso_pu_bacteria | 2838122688 | 2838127459 | 219 |
| 28 | iso_pu_bacteria | 2841941048 | 2841941587 | 219 |
| 29 | iso_pu_bacteria | 2841949485 | 2841952396 | 219 |
| 30 | iso_pu_bacteria | 2841966195 | 2841967733 | 219 |
| 31 | iso_pu_bacteria | 2841974524 | 2841982104 | 219 |
| 32 | iso_pu_bacteria | 2841983080 | 2841986420 | 219 |
| 33 | iso_pu_bacteria | 2847939898 | 2847945052 | 219 |
| 34 | iso_pu_bacteria | 2929199973 | 2929204056 | 219 |
| 35 | iso_pu_bacteria | 8055909800 | 8055911414 | 219 |
| 36 | 3300005327 | Ga0070658_10008327 | Ga0070658_100083279 | 220 |
| 37 | 3300005330 | Ga0070690_100461373 | Ga0070690_1004613732 | 220 |
| 38 | 3300005331 | Ga0070670_100202793 | Ga0070670_1002027932 | 220 |
| 39 | 3300005336 | Ga0070680_100015841 | Ga0070680_1000158412 | 220 |
| 40 | 3300005340 | Ga0070689_100565925 | Ga0070689_1005659251 | 220 |
| 41 | 3300005341 | Ga0070691_10160120 | Ga0070691_101601202 | 220 |
| 42 | 3300005356 | Ga0070674_100202871 | Ga0070674_1002028713 | 220 |
| 43 | 3300005366 | Ga0070659_100599583 | Ga0070659_1005995832 | 220 |
| 44 | 3300005436 | Ga0070713_100098663 | Ga0070713_1000986632 | 220 |
| 45 | 3300005437 | Ga0070710_10122507 | Ga0070710_101225073 | 220 |
| 46 | 3300005438 | Ga0070701_10216630 | Ga0070701_102166302 | 220 |
| 47 | 3300005445 | Ga0070708_100701296 | Ga0070708_1007012961 | 220 |
| 48 | 3300005456 | Ga0070678_100212458 | Ga0070678_1002124583 | 220 |
| 49 | 3300005458 | Ga0070681_10029061 | Ga0070681_100290614 | 220 |
| 50 | 3300005467 | Ga0070706_100347490 | Ga0070706_1003474902 | 220 |
| 51 | 3300005471 | Ga0070698_100015620 | Ga0070698_1000156205 | 220 |
| 52 | 3300005518 | Ga0070699_100057798 | Ga0070699_1000577984 | 220 |
| 53 | 3300005530 | Ga0070679_100002889 | Ga0070679_10000288912 | 220 |
| 54 | 3300005536 | Ga0070697_100072310 | Ga0070697_1000723103 | 220 |
| 55 | 3300005539 | Ga0068853_100443856 | Ga0068853_1004438562 | 220 |
| 56 | 3300005548 | Ga0070665_100044210 | Ga0070665_1000442103 | 220 |
| 57 | 3300005548 | Ga0070665_100493404 | Ga0070665_1004934042 | 220 |
| 58 | 3300005548 | Ga0070665_100549037 | Ga0070665_1005490372 | 220 |
| 59 | 3300005563 | Ga0068855_100498471 | Ga0068855_1004984712 | 220 |
| 60 | 3300005577 | Ga0068857_100041147 | Ga0068857_1000411474 | 220 |
| 61 | 3300005614 | Ga0068856_100025379 | Ga0068856_1000253794 | 220 |
| 62 | 3300005614 | Ga0068856_100219317 | Ga0068856_1002193172 | 220 |
| 63 | 3300005616 | Ga0068852_100436752 | Ga0068852_1004367522 | 220 |
| 64 | 3300005617 | Ga0068859_100181338 | Ga0068859_1001813383 | 220 |
| 65 | 3300005618 | Ga0068864_100258895 | Ga0068864_1002588952 | 220 |
| 66 | 3300005843 | Ga0068860_100015356 | Ga0068860_1000153564 | 220 |
| 67 | 3300005843 | Ga0068860_100317506 | Ga0068860_1003175062 | 220 |
| 68 | 3300005844 | Ga0068862_100182252 | Ga0068862_1001822522 | 220 |
| 69 | 3300005937 | Ga0081455_10000434 | Ga0081455_1000043427 | 220 |
| 70 | 3300005937 | Ga0081455_10002143 | Ga0081455_100021432 | 220 |
| 71 | 3300005937 | Ga0081455_10007176 | Ga0081455_1000717613 | 220 |
| 72 | 3300005985 | Ga0081539_10009772 | Ga0081539_100097724 | 220 |
| 73 | 3300005985 | Ga0081539_10011462 | Ga0081539_100114627 | 220 |
| 74 | 3300006038 | Ga0075365_10029237 | Ga0075365_100292374 | 220 |
| 75 | 3300006038 | Ga0075365_10326099 | Ga0075365_103260993 | 220 |
| 76 | 3300006042 | Ga0075368_10124368 | Ga0075368_101243682 | 220 |
| 77 | 3300006177 | Ga0075362_10029282 | Ga0075362_100292821 | 220 |
| 78 | 3300006177 | Ga0075362_10052564 | Ga0075362_100525642 | 220 |
| 79 | 3300006177 | Ga0075362_10122617 | Ga0075362_101226172 | 220 |
| 80 | 3300006178 | Ga0075367_10221399 | Ga0075367_102213991 | 220 |
| 81 | 3300006178 | Ga0075367_10378253 | Ga0075367_103782532 | 220 |
| 82 | 3300006186 | Ga0075369_10000336 | Ga0075369_100003365 | 220 |
| 83 | 3300006195 | Ga0075366_10013866 | Ga0075366_100138664 | 220 |
| 84 | 3300006195 | Ga0075366_10091553 | Ga0075366_100915532 | 220 |
| 85 | 3300006195 | Ga0075366_10188225 | Ga0075366_101882253 | 220 |
| 86 | 3300006847 | Ga0075431_100598402 | Ga0075431_1005984022 | 220 |
| 87 | 3300006931 | Ga0097620_100181331 | Ga0097620_1001813312 | 220 |
| 88 | 3300006931 | Ga0097620_100256367 | Ga0097620_1002563672 | 220 |
| 89 | 3300009093 | Ga0105240_10346169 | Ga0105240_103461693 | 220 |
| 90 | 3300009094 | Ga0111539_10544564 | Ga0111539_105445642 | 220 |
| 91 | 3300009147 | Ga0114129_10590848 | Ga0114129_105908482 | 220 |
| 92 | 3300009148 | Ga0105243_10549941 | Ga0105243_105499412 | 220 |
| 93 | 3300009174 | Ga0105241_10660131 | Ga0105241_106601312 | 220 |
| 94 | 3300009177 | Ga0105248_10936393 | Ga0105248_109363931 | 220 |
| 95 | 3300009545 | Ga0105237_10467239 | Ga0105237_104672392 | 220 |
| 96 | 3300009551 | Ga0105238_10272840 | Ga0105238_102728402 | 220 |
| 97 | 3300009551 | Ga0105238_10473689 | Ga0105238_104736892 | 220 |
| 98 | 3300009553 | Ga0105249_10514479 | Ga0105249_105144792 | 220 |
| 99 | 3300009988 | Ga0105035_107265 | Ga0105035_1072652 | 220 |
| 100 | 3300013104 | Ga0157370_10009458 | Ga0157370_100094588 | 220 |
| 101 | 3300013105 | Ga0157369_10038152 | Ga0157369_100381524 | 220 |
| 102 | 3300013105 | Ga0157369_10197245 | Ga0157369_101972452 | 220 |
| 103 | 3300013306 | Ga0163162_10783964 | Ga0163162_107839643 | 220 |
| 104 | 3300013307 | Ga0157372_10363751 | Ga0157372_103637512 | 220 |
| 105 | 3300013308 | Ga0157375_10785570 | Ga0157375_107855701 | 220 |
| 106 | 3300014497 | Ga0182008_10180163 | Ga0182008_101801631 | 220 |
| 107 | 3300021384 | Ga0213876_10021715 | Ga0213876_100217153 | 220 |
| 108 | 3300021441 | Ga0213871_10006183 | Ga0213871_100061832 | 220 |
| 109 | 3300025898 | Ga0207692_10062829 | Ga0207692_100628293 | 220 |
| 110 | 3300025903 | Ga0207680_10249545 | Ga0207680_102495452 | 220 |
| 111 | 3300025904 | Ga0207647_10113892 | Ga0207647_101138922 | 220 |
| 112 | 3300025909 | Ga0207705_10041156 | Ga0207705_100411562 | 220 |
| 113 | 3300025911 | Ga0207654_10401028 | Ga0207654_104010282 | 220 |
| 114 | 3300025912 | Ga0207707_10013882 | Ga0207707_100138826 | 220 |
| 115 | 3300025913 | Ga0207695_10067173 | Ga0207695_100671732 | 220 |
| 116 | 3300025913 | Ga0207695_10249637 | Ga0207695_102496372 | 220 |
| 117 | 3300025915 | Ga0207693_10166805 | Ga0207693_101668052 | 220 |
| 118 | 3300025917 | Ga0207660_10035823 | Ga0207660_100358234 | 220 |
| 119 | 3300025921 | Ga0207652_10027622 | Ga0207652_100276224 | 220 |
| 120 | 3300025923 | Ga0207681_10070672 | Ga0207681_100706723 | 220 |
| 121 | 3300025931 | Ga0207644_10135246 | Ga0207644_101352462 | 220 |
| 122 | 3300025932 | Ga0207690_10208686 | Ga0207690_102086862 | 220 |
| 123 | 3300025936 | Ga0207670_10268145 | Ga0207670_102681452 | 220 |
| 124 | 3300025944 | Ga0207661_10878856 | Ga0207661_108788562 | 220 |
| 125 | 3300025945 | Ga0207679_10229242 | Ga0207679_102292422 | 220 |
| 126 | 3300026116 | Ga0207674_10032698 | Ga0207674_100326984 | 220 |
| 127 | 3300026116 | Ga0207674_10190346 | Ga0207674_101903462 | 220 |
| 128 | 3300026121 | Ga0207683_10232883 | Ga0207683_102328832 | 220 |
| 129 | 3300026142 | Ga0207698_10474666 | Ga0207698_104746662 | 220 |
| 130 | 3300028379 | Ga0268266_10186323 | Ga0268266_101863233 | 220 |
| 131 | 3300028379 | Ga0268266_10346541 | Ga0268266_103465413 | 220 |
| 132 | 3300028379 | Ga0268266_10850555 | Ga0268266_108505552 | 220 |
| 133 | 3300028380 | Ga0268265_10688481 | Ga0268265_106884811 | 220 |
| 134 | 3300031911 | Ga0307412_10452619 | Ga0307412_104526192 | 220 |
| 135 | 3300032126 | Ga0307415_100411968 | Ga0307415_1004119682 | 220 |
| 136 | 3300035115 | Ga0373941_0151644 | Ga0373941_0151644_72_761 | 220 |
| 137 | 3300035692 | Ga0373935_0373484 | Ga0373935_0373484_275_964 | 220 |
| 138 | 3300035725 | Ga0373947_0335811 | Ga0373947_0335811_49_738 | 220 |
| 139 | 3300037312 | Ga0395899_0027167 | Ga0395899_0027167_22_711 | 220 |
| 140 | 3300037312 | Ga0395899_0075637 | Ga0395899_0075637_200_889 | 220 |
| 141 | 3300037312 | Ga0395899_0178224 | Ga0395899_0178224_536_1225 | 220 |
| 142 | 3300037418 | Ga0395900_0035147 | Ga0395900_0035147_3024_3713 | 220 |
| 143 | 3300037418 | Ga0395900_0038828 | Ga0395900_0038828_4043_4732 | 220 |
| 144 | 3300037418 | Ga0395900_0102804 | Ga0395900_0102804_983_1672 | 220 |
| 145 | 3300037418 | Ga0395900_0247013 | Ga0395900_0247013_629_1318 | 220 |
| 146 | 3300037466 | Ga0395898_0016415 | Ga0395898_0016415_3299_3988 | 220 |
| 147 | 3300037466 | Ga0395898_0030276 | Ga0395898_0030276_3176_3865 | 220 |
| 148 | 3300038443 | Ga0395901_0001851 | Ga0395901_0001851_19411_20100 | 220 |
| 149 | 3300038443 | Ga0395901_0008119 | Ga0395901_0008119_8312_9001 | 220 |
| 150 | 3300038443 | Ga0395901_0034540 | Ga0395901_0034540_1138_1827 | 220 |
| 151 | 3300038443 | Ga0395901_0055930 | Ga0395901_0055930_1814_2503 | 220 |
| 152 | 3300039437 | Ga0436365_0376694 | Ga0436365_0376694_3035_3721 | 220 |
| 153 | 3300039438 | Ga0436360_0369505 | Ga0436360_0369505_233_922 | 220 |
| 154 | 3300039447 | Ga0436361_0171581 | Ga0436361_0171581_106_795 | 220 |
| 155 | 3300039447 | Ga0436361_1163612 | Ga0436361_1163612_530_1219 | 220 |
| 156 | 3300039453 | Ga0436362_0677078 | Ga0436362_0677078_210_911 | 220 |
| 157 | 3300042438 | Ga0439459_0039049 | Ga0439459_0039049_183_872 | 220 |
| 158 | 3300044694 | Ga0466963_0174923 | Ga0466963_0174923_391_1080 | 220 |
| 159 | 3300044694 | Ga0466963_0360648 | Ga0466963_0360648_18_710 | 220 |
| 160 | 3300044842 | Ga0466957_0363101 | Ga0466957_0363101_30_719 | 220 |
| 161 | 3300045976 | Ga0466967_0082808 | Ga0466967_0082808_1869_2558 | 220 |
| 162 | 3300046511 | Ga0495608_0332007 | Ga0495608_0332007_237_926 | 220 |
| 163 | 3300046684 | Ga0495669_0136956 | Ga0495669_0136956_56_745 | 220 |
| 164 | 3300048091 | Ga0495626_0128531 | Ga0495626_0128531_314_1003 | 220 |
| 165 | 3300049569 | Ga0501032_0169566 | Ga0501032_0169566_276_965 | 220 |
| 166 | 3300049570 | Ga0501033_0083345 | Ga0501033_0083345_215_877 | 220 |
| 167 | 3300049570 | Ga0501033_0444818 | Ga0501033_0444818_140_829 | 220 |
| 168 | 3300049571 | Ga0501034_0004242 | Ga0501034_0004242_15228_15917 | 220 |
| 169 | 3300049571 | Ga0501034_0037546 | Ga0501034_0037546_552_1241 | 220 |
| 170 | 3300049572 | Ga0501036_0374384 | Ga0501036_0374384_124_813 | 220 |
| 171 | 3300049573 | Ga0501037_0415800 | Ga0501037_0415800_45_734 | 220 |
| 172 | 3300049579 | Ga0501043_0493724 | Ga0501043_0493724_205_894 | 220 |
| 173 | 3300049580 | Ga0501046_0332035 | Ga0501046_0332035_283_972 | 220 |
| 174 | 3300049581 | Ga0501047_0430425 | Ga0501047_0430425_89_778 | 220 |
| 175 | 3300049584 | Ga0501068_0244956 | Ga0501068_0244956_56_745 | 220 |
| 176 | 3300049588 | Ga0501072_0476030 | Ga0501072_0476030_245_937 | 220 |
| 177 | 3300049823 | Ga0501044_0117070 | Ga0501044_0117070_1434_2123 | 220 |
| 178 | 3300050489 | nmdc:mga03683_27877_c1 | nmdc:mga03683_27877_c1_67_756 | 220 |
| 179 | 3300050489 | nmdc:mga03683_98994_c1 | nmdc:mga03683_98994_c1_414_1103 | 220 |
| 180 | 3300050492 | nmdc:mga0yw44_65149_c1 | nmdc:mga0yw44_65149_c1_1075_1764 | 220 |
| 181 | 3300050492 | nmdc:mga0yw44_99739_c1 | nmdc:mga0yw44_99739_c1_236_925 | 220 |
| 182 | 3300050493 | nmdc:mga0k408_263206_c1 | nmdc:mga0k408_263206_c1_111_800 | 220 |
| 183 | 3300050493 | nmdc:mga0k408_42473_c2 | nmdc:mga0k408_42473_c2_1019_1708 | 220 |
| 184 | 3300050494 | nmdc:mga06z11_347000_c1 | nmdc:mga06z11_347000_c1_48_737 | 220 |
| 185 | 3300050494 | nmdc:mga06z11_69100_c1 | nmdc:mga06z11_69100_c1_877_1566 | 220 |
| 186 | 3300050496 | nmdc:mga07m45_48677_c1 | nmdc:mga07m45_48677_c1_656_1345 | 220 |
| 187 | 3300050516 | nmdc:mga0sz30_41844_c1 | nmdc:mga0sz30_41844_c1_120_809 | 220 |
| 188 | 3300050516 | nmdc:mga0sz30_4363_c1 | nmdc:mga0sz30_4363_c1_3757_4446 | 220 |
| 189 | 3300053090 | Ga0500646_0062843 | Ga0500646_0062843_85_774 | 220 |
| 190 | 3300053091 | Ga0500647_0029848 | Ga0500647_0029848_1499_2188 | 220 |
| 191 | 3300053093 | Ga0500651_0269936 | Ga0500651_0269936_87_776 | 220 |
| 192 | 3300053119 | Ga0500595_056680 | Ga0500595_056680_376_1065 | 220 |
| 193 | 3300053134 | Ga0500658_0243289 | Ga0500658_0243289_130_816 | 220 |
| 194 | 3300053139 | Ga0500568_0003910 | Ga0500568_0003910_354_1040 | 220 |
| 195 | 3300053153 | Ga0500616_0003394 | Ga0500616_0003394_708_1397 | 220 |
| 196 | 3300005548 | Ga0070665_100036248 | Ga0070665_1000362482 | 221 |
| 197 | 3300009174 | Ga0105241_10634333 | Ga0105241_106343332 | 221 |
| 198 | 3300009545 | Ga0105237_10186207 | Ga0105237_101862072 | 221 |
| 199 | 3300009551 | Ga0105238_10001577 | Ga0105238_1000157727 | 221 |
| 200 | 3300010375 | Ga0105239_10212405 | Ga0105239_102124053 | 221 |
| 201 | 3300014325 | Ga0163163_10544599 | Ga0163163_105445991 | 221 |
| 202 | 3300021384 | Ga0213876_10133145 | Ga0213876_101331452 | 221 |
| 203 | 3300025913 | Ga0207695_10522547 | Ga0207695_105225472 | 221 |
| 204 | 3300025924 | Ga0207694_10003346 | Ga0207694_1000334613 | 221 |
| 205 | 3300028379 | Ga0268266_10009478 | Ga0268266_100094789 | 221 |
| 206 | 3300031727 | Ga0316576_10023481 | Ga0316576_100234812 | 221 |
| 207 | 3300036712 | Ga0316584_0005789 | Ga0316584_0005789_3465_4133 | 221 |
| 208 | 3300037312 | Ga0395899_0134515 | Ga0395899_0134515_42_707 | 221 |
| 209 | 3300038443 | Ga0395901_0076455 | Ga0395901_0076455_2062_2727 | 221 |
| 210 | 3300039062 | Ga0400483_052111 | Ga0400483_052111_761_1426 | 221 |
| 211 | 3300039062 | Ga0400483_149301 | Ga0400483_149301_105_770 | 221 |
| 212 | 3300039437 | Ga0436365_1360918 | Ga0436365_1360918_291_986 | 221 |
| 213 | 3300039438 | Ga0436360_1264475 | Ga0436360_1264475_844_1536 | 221 |
| 214 | 3300039450 | Ga0436363_0362619 | Ga0436363_0362619_212_904 | 221 |
| 215 | 3300049570 | Ga0501033_0045085 | Ga0501033_0045085_331_1023 | 221 |
| 216 | 3300049581 | Ga0501047_0680678 | Ga0501047_0680678_141_833 | 221 |
| 217 | 3300053091 | Ga0500647_0032251 | Ga0500647_0032251_1575_2240 | 221 |
| 218 | 3300003203 | JGI25406J46586_10000219 | JGI25406J46586_1000021916 | 222 |
| 219 | 3300005985 | Ga0081539_10000207 | Ga0081539_1000020797 | 222 |
| 220 | 3300039062 | Ga0400483_012628 | Ga0400483_012628_2284_2958 | 222 |
| 221 | 3300025918 | Ga0207662_10479674 | Ga0207662_104796742 | 223 |
| 222 | 3300044901 | Ga0466960_0287310 | Ga0466960_0287310_191_910 | 223 |
| 223 | 3300049570 | Ga0501033_0026408 | Ga0501033_0026408_1962_2663 | 223 |
| 224 | 3300049571 | Ga0501034_0082176 | Ga0501034_0082176_1441_2142 | 223 |
| 225 | 3300049571 | Ga0501034_0418246 | Ga0501034_0418246_477_1178 | 223 |
| 226 | 3300049576 | Ga0501040_0325473 | Ga0501040_0325473_19_717 | 223 |
| 227 | 3300049586 | Ga0501070_0072638 | Ga0501070_0072638_440_1141 | 223 |
| 228 | 3300049822 | Ga0501035_0043153 | Ga0501035_0043153_722_1423 | 223 |
| 229 | 3300049822 | Ga0501035_0104550 | Ga0501035_0104550_641_1342 | 223 |
| 230 | 3300049823 | Ga0501044_0101315 | Ga0501044_0101315_1768_2469 | 223 |
| 231 | 3300035398 | Ga0316574_0151000 | Ga0316574_0151000_43_747 | 224 |
| 232 | 3300039437 | Ga0436365_0672716 | Ga0436365_0672716_317_1018 | 224 |
| 233 | 3300046452 | Ga0495617_119140 | Ga0495617_119140_123_827 | 224 |
| 234 | 3300053153 | Ga0500616_0047233 | Ga0500616_0047233_748_1452 | 224 |
| 235 | iso_pu_bacteria | 8057733483 | 8057736573 | 224 |
| 236 | 3300005843 | Ga0068860_100001632 | Ga0068860_1000016322 | 226 |
| 237 | 3300028381 | Ga0268264_10001466 | Ga0268264_1000146613 | 226 |
| 238 | 3300031730 | Ga0307516_10335911 | Ga0307516_103359112 | 226 |
| 239 | 3300061734 | Ga0530510_0206537 | Ga0530510_0206537_170_886 | 226 |
| 240 | 3300006871 | Ga0075434_100009006 | Ga0075434_1000090067 | 227 |
| 241 | 3300006881 | Ga0068865_100082298 | Ga0068865_1000822984 | 227 |
| 242 | 3300006914 | Ga0075436_100005370 | Ga0075436_1000053707 | 227 |
| 243 | 3300025938 | Ga0207704_10090676 | Ga0207704_100906762 | 227 |
| 244 | 3300031852 | Ga0307410_10527151 | Ga0307410_105271512 | 227 |
| 245 | 3300032133 | Ga0316583_10096292 | Ga0316583_100962922 | 227 |
| 246 | 3300003187 | JGI25151J46595_10083518 | JGI25151J46595_100835181 | 228 |
| 247 | 3300003761 | Ga0055535_1004887 | Ga0055535_10048873 | 228 |
| 248 | 3300003841 | Ga0055541_1001293 | Ga0055541_10012933 | 228 |
| 249 | 3300005328 | Ga0070676_10102271 | Ga0070676_101022712 | 228 |
| 250 | 3300005335 | Ga0070666_10010654 | Ga0070666_100106542 | 228 |
| 251 | 3300005337 | Ga0070682_100296567 | Ga0070682_1002965672 | 228 |
| 252 | 3300005347 | Ga0070668_100145528 | Ga0070668_1001455282 | 228 |
| 253 | 3300005365 | Ga0070688_100316234 | Ga0070688_1003162342 | 228 |
| 254 | 3300005466 | Ga0070685_10024538 | Ga0070685_100245384 | 228 |
| 255 | 3300005548 | Ga0070665_100002041 | Ga0070665_10000204124 | 228 |
| 256 | 3300005616 | Ga0068852_100089471 | Ga0068852_1000894714 | 228 |
| 257 | 3300025225 | Ga0209566_100126 | Ga0209566_10012626 | 228 |
| 258 | 3300025294 | Ga0209025_1017865 | Ga0209025_10178653 | 228 |
| 259 | 3300025294 | Ga0209025_1022468 | Ga0209025_10224683 | 228 |
| 260 | 3300025909 | Ga0207705_10080570 | Ga0207705_100805703 | 228 |
| 261 | 3300025918 | Ga0207662_10496288 | Ga0207662_104962881 | 228 |
| 262 | 3300025934 | Ga0207686_10057773 | Ga0207686_100577733 | 228 |
| 263 | 3300028379 | Ga0268266_10001996 | Ga0268266_1000199624 | 228 |
| 264 | 3300049744 | Ga0501083_0023099 | Ga0501083_0023099_3314_4036 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d54-assembly3.cif.gz_D | structure of purlqs from thermotoga maritima | 0.9404 | 2 | 216 |
| 3d54-assembly3.cif.gz_D | structure of purlqs from thermotoga maritima | 0.9189 | 2 | 216 |
| 1t3t-assembly1.cif.gz_A | structure of formylglycinamide synthetase | 0.8663 | 2 | 214 |
| 4l78-assembly1.cif.gz_A | xenon trapping and statistical coupling analysis uncover regions important for structure and function of multidomain protein stpurl | 0.866 | 2 | 214 |
| 4lgy-assembly1.cif.gz_A | importance of hydrophobic cavities in allosteric regulation of formylglycinamide synthetase: insight from xenon trapping and statistical coupling analysis | 0.8628 | 2 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZJ1_1_219_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9593 | 1 | 217 | 3.40.50.880 |
| af_P9WHL5_1_222_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9568 | 2 | 215 | 3.40.50.880 |
| af_Q59042_1_229_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9562 | 1 | 215 | 3.40.50.880 |
| af_Q2FZJ1_1_219_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9465 | 1 | 217 | 3.40.50.880 |
| 3d54L00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.941 | 2 | 216 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I7LA57-F1-model_v4 | Multifunctional fusion protein [Includes: Phosphoribosylformylglycinamidine synthase subunit PurL (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit II) (Glutamine amidotransferase PurL) (Phosphoribosylformylglycinamidine synthase subunit II) (FGAR amidotransferase II) (FGAR-AT II); Phosphoribosylformylglycinamidine synthase subunit PurQ (Formylglycinamide ribonucleotide amidotransferase subunit I) (Glutaminase PurQ) (Phosphoribosylformylglycinamidine synthase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (EC 3.5.1.2)] | 0.9774 | 1 | 215 |
GO:0000287
GO:0004359 GO:0004642 GO:0005524 GO:0005737 GO:0006189 GO:0006541 |
| AF-A0A2V8MWT8-F1-model_v4 | Multifunctional fusion protein [Includes: Phosphoribosylformylglycinamidine synthase subunit PurL (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit II) (Glutamine amidotransferase PurL) (Phosphoribosylformylglycinamidine synthase subunit II) (FGAR amidotransferase II) (FGAR-AT II); Phosphoribosylformylglycinamidine synthase subunit PurQ (Formylglycinamide ribonucleotide amidotransferase subunit I) (Glutaminase PurQ) (Phosphoribosylformylglycinamidine synthase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (EC 3.5.1.2)] | 0.9752 | 1 | 222 |
GO:0000287
GO:0004359 GO:0004642 GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A0N0I5B5-F1-model_v4 | deleted | 0.9745 | 69 | 224 |
|
| AF-Q3EWN9-F1-model_v4 | deleted | 0.9737 | 69 | 224 |
|
| AF-A0A1D4RLC1-F1-model_v4 | Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3) | 0.9736 | 63 | 220 |
GO:0004642
GO:0005524 GO:0005737 GO:0006189 GO:0006541 GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar