F372658

General Info

Members Datasets Scaffolds Average Seq Length
264 190 244 229

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10496288|Ga0207662_104962881
Length 245
Sequence MKAAVLVFPGSNREGDVAQAIELVTGRRPQMIWHGDGDFEKTDLIVLPGGFSYGDYLRCGAMAAQSPVMAEVKKRAAQGVPVLAICNGFQIAAEAGLVPGVLMRNEKLKFICGDVHLKVETSQSLFTNRYQAGQVIKVPVAHAEGNYFAEPAVIAQLEADRQIIFRYTDASGEVVDAANPNGSKASIAGLCNEARNIVGLMPHPERACESILGSADGLAIFESAVAALKTGLFGGPSGSALQAVG

Samples

Sample ID Description Type Environment
1 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
2 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
3 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
4 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
5 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
6 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
7 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
8 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
9 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
10 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
11 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
12 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
13 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
14 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
15 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
16 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
17 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
18 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
180 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
181 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
190 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.42
Metatranscriptomes 0
Isolates 7.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 3.79
Rhizoplane 0
Rhizosphere 74.24
Stem 0
Stem Tuber 0
Unclassified 7.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10083518 3300003187 Bacteria 915
2 JGI25406J46586_10000219 3300003203 Bacteria 25317
3 Ga0055535_1004887 3300003761 Bacteria 3104
4 Ga0055541_1001293 3300003841 Bacteria 5490
5 Ga0070658_10008327 3300005327 Bacteria 8339
6 Ga0070676_10102271 3300005328 Bacteria 1772
7 Ga0070690_100461373 3300005330 Bacteria 944
8 Ga0070670_100202793 3300005331 Bacteria 1724
9 Ga0070666_10010654 3300005335 Bacteria 5756
10 Ga0070680_100015841 3300005336 Bacteria 5918
11 Ga0070680_100522819 3300005336 Bacteria 1016
12 Ga0070682_100296567 3300005337 Bacteria 1184
13 Ga0070689_100565925 3300005340 Bacteria 981
14 Ga0070691_10160120 3300005341 Bacteria 1160
15 Ga0070668_100145528 3300005347 Bacteria 1913
16 Ga0070674_100202871 3300005356 Bacteria 1532
17 Ga0070688_100316234 3300005365 Bacteria 1133
18 Ga0070659_100599583 3300005366 Bacteria 946
19 Ga0070713_100098663 3300005436 Bacteria 2526
20 Ga0070710_10122507 3300005437 Bacteria 1575
21 Ga0070701_10216630 3300005438 Bacteria 1140
22 Ga0070708_100701296 3300005445 Bacteria 953
23 Ga0070678_100212458 3300005456 Bacteria 1604
24 Ga0070681_10029061 3300005458 Bacteria 5550
25 Ga0070685_10024538 3300005466 Bacteria 3313
26 Ga0070706_100347490 3300005467 Bacteria 1382
27 Ga0070698_100015620 3300005471 Bacteria 8018
28 Ga0070699_100057798 3300005518 Bacteria 3359
29 Ga0070679_100002889 3300005530 Bacteria 15609
30 Ga0070697_100072310 3300005536 Bacteria 2830
31 Ga0068853_100443856 3300005539 Bacteria 1220
32 Ga0070665_100002041 3300005548 Bacteria 22725
33 Ga0070665_100036248 3300005548 Bacteria 4962
34 Ga0070665_100044210 3300005548 Bacteria 4473
35 Ga0070665_100493404 3300005548 Bacteria 1236
36 Ga0070665_100549037 3300005548 Bacteria 1167
37 Ga0068855_100498471 3300005563 Bacteria 1323
38 Ga0068857_100041147 3300005577 Bacteria 4098
39 Ga0068856_100025379 3300005614 Bacteria 5779
40 Ga0068856_100219317 3300005614 Bacteria 1917
41 Ga0068852_100089471 3300005616 Bacteria 2752
42 Ga0068852_100250718 3300005616 Bacteria 1696
43 Ga0068852_100436752 3300005616 Bacteria 1293
44 Ga0068859_100181338 3300005617 Bacteria 2188
45 Ga0068864_100258895 3300005618 Bacteria 1618
46 Ga0068860_100001632 3300005843 Bacteria 24029
47 Ga0068860_100015356 3300005843 Bacteria 7481
48 Ga0068860_100317506 3300005843 Bacteria 1529
49 Ga0068862_100182252 3300005844 Bacteria 1885
50 Ga0081455_10000434 3300005937 Bacteria 54939
51 Ga0081455_10002143 3300005937 Bacteria 23543
52 Ga0081455_10007176 3300005937 Bacteria 11778
53 Ga0081539_10000207 3300005985 Bacteria 136970
54 Ga0081539_10009772 3300005985 Bacteria 7934
55 Ga0081539_10011462 3300005985 Bacteria 7001
56 Ga0075365_10029237 3300006038 Bacteria 3520
57 Ga0075365_10326099 3300006038 Bacteria 1081
58 Ga0075368_10124368 3300006042 Bacteria 1069
59 Ga0075362_10029282 3300006177 Bacteria 2372
60 Ga0075362_10052564 3300006177 Bacteria 1826
61 Ga0075362_10122617 3300006177 Bacteria 1231
62 Ga0075367_10221399 3300006178 Bacteria 1184
63 Ga0075367_10378253 3300006178 Bacteria 895
64 Ga0075369_10000336 3300006186 Bacteria 14025
65 Ga0075366_10013866 3300006195 Bacteria 4594
66 Ga0075366_10091553 3300006195 Bacteria 1821
67 Ga0075366_10188225 3300006195 Bacteria 1254
68 Ga0075431_100598402 3300006847 Bacteria 1087
69 Ga0075434_100009006 3300006871 Bacteria 9298
70 Ga0068865_100082298 3300006881 Bacteria 2314
71 Ga0075436_100005370 3300006914 Bacteria 8820
72 Ga0097620_100181331 3300006931 Bacteria 2188
73 Ga0097620_100256367 3300006931 Bacteria 1840
74 Ga0105240_10346169 3300009093 Bacteria 1687
75 Ga0111539_10544564 3300009094 Bacteria 1352
76 Ga0114129_10590848 3300009147 Bacteria 1440
77 Ga0105243_10549941 3300009148 Bacteria 1103
78 Ga0105241_10634333 3300009174 Bacteria 969
79 Ga0105241_10660131 3300009174 Bacteria 951
80 Ga0105248_10936393 3300009177 Bacteria 978
81 Ga0105237_10186207 3300009545 Bacteria 2076
82 Ga0105237_10467239 3300009545 Bacteria 1268
83 Ga0105238_10001577 3300009551 Bacteria 22832
84 Ga0105238_10272840 3300009551 Bacteria 1672
85 Ga0105238_10473689 3300009551 Bacteria 1251
86 Ga0105249_10514479 3300009553 Bacteria 1244
87 Ga0105035_107265 3300009988 Bacteria 930
88 Ga0105239_10212405 3300010375 Bacteria 2169
89 Ga0157370_10009458 3300013104 Bacteria 10410
90 Ga0157369_10038152 3300013105 Bacteria 5254
91 Ga0157369_10197245 3300013105 Bacteria 2113
92 Ga0163162_10783964 3300013306 Bacteria 1071
93 Ga0157372_10363751 3300013307 Bacteria 1686
94 Ga0157375_10785570 3300013308 Bacteria 1101
95 Ga0163163_10544599 3300014325 Bacteria 1223
96 Ga0182008_10180163 3300014497 Bacteria 1069
97 Ga0213876_10021715 3300021384 Bacteria 3395
98 Ga0213876_10133145 3300021384 Bacteria 1322
99 Ga0213871_10006183 3300021441 Bacteria 2520
100 Ga0209566_100126 3300025225 Bacteria 94445
101 Ga0209025_1017865 3300025294 Bacteria 4064
102 Ga0209025_1022468 3300025294 Bacteria 3341
103 Ga0207692_10062829 3300025898 Bacteria 1928
104 Ga0207680_10249545 3300025903 Bacteria 1225
105 Ga0207647_10113892 3300025904 Bacteria 1598
106 Ga0207705_10041156 3300025909 Bacteria 3314
107 Ga0207705_10080570 3300025909 Bacteria 2372
108 Ga0207654_10401028 3300025911 Bacteria 954
109 Ga0207707_10013882 3300025912 Bacteria 7024
110 Ga0207695_10067173 3300025913 Bacteria 3679
111 Ga0207695_10249637 3300025913 Bacteria 1674
112 Ga0207695_10522547 3300025913 Bacteria 1069
113 Ga0207693_10166805 3300025915 Bacteria 1734
114 Ga0207660_10035823 3300025917 Bacteria 3447
115 Ga0207662_10479674 3300025918 Bacteria 854
116 Ga0207662_10496288 3300025918 Bacteria 840
117 Ga0207652_10027622 3300025921 Bacteria 4729
118 Ga0207681_10070672 3300025923 Bacteria 2432
119 Ga0207694_10003346 3300025924 Bacteria 12758
120 Ga0207644_10135246 3300025931 Bacteria 1892
121 Ga0207690_10208686 3300025932 Bacteria 1488
122 Ga0207686_10057773 3300025934 Bacteria 2444
123 Ga0207670_10268145 3300025936 Bacteria 1326
124 Ga0207704_10090676 3300025938 Bacteria 2007
125 Ga0207661_10878856 3300025944 Bacteria 825
126 Ga0207679_10229242 3300025945 Bacteria 1567
127 Ga0207674_10032698 3300026116 Bacteria 5453
128 Ga0207674_10190346 3300026116 Bacteria 2001
129 Ga0207683_10232883 3300026121 Bacteria 1680
130 Ga0207698_10474666 3300026142 Bacteria 1212
131 Ga0268266_10001996 3300028379 Bacteria 22830
132 Ga0268266_10009478 3300028379 Bacteria 8567
133 Ga0268266_10186323 3300028379 Bacteria 1892
134 Ga0268266_10346541 3300028379 Bacteria 1395
135 Ga0268266_10850555 3300028379 Bacteria 882
136 Ga0268265_10688481 3300028380 Bacteria 986
137 Ga0268264_10001466 3300028381 Bacteria 22037
138 Ga0316576_10023481 3300031727 Bacteria 4296
139 Ga0307516_10335911 3300031730 Bacteria 1179
140 Ga0307410_10527151 3300031852 Bacteria 976
141 Ga0307412_10452619 3300031911 Bacteria 1058
142 Ga0307415_100411968 3300032126 Bacteria 1157
143 Ga0316583_10096292 3300032133 Bacteria 1032
144 Ga0373923_0059864 3300035111 Bacteria 1615
145 Ga0373941_0151644 3300035115 Bacteria 851
146 Ga0316574_0151000 3300035398 Bacteria 1497
147 Ga0373935_0373484 3300035692 Bacteria 1020
148 Ga0373947_0335811 3300035725 Bacteria 1012
149 Ga0373937_0317985 3300036401 Bacteria 1473
150 Ga0316584_0005789 3300036712 Bacteria 8336
151 Ga0395899_0027167 3300037312 Bacteria 4317
152 Ga0395899_0075637 3300037312 Bacteria 2458
153 Ga0395899_0134515 3300037312 Bacteria 1763
154 Ga0395899_0178224 3300037312 Bacteria 1493
155 Ga0395900_0035147 3300037418 Bacteria 5162
156 Ga0395900_0038828 3300037418 Bacteria 4908
157 Ga0395900_0102804 3300037418 Bacteria 2935
158 Ga0395900_0247013 3300037418 Bacteria 1787
159 Ga0395898_0016415 3300037466 Bacteria 7578
160 Ga0395898_0030276 3300037466 Bacteria 5417
161 Ga0395901_0001851 3300038443 Bacteria 21879
162 Ga0395901_0008119 3300038443 Bacteria 10600
163 Ga0395901_0034540 3300038443 Bacteria 5222
164 Ga0395901_0055930 3300038443 Bacteria 4104
165 Ga0395901_0076455 3300038443 Bacteria 3493
166 Ga0400483_012628 3300039062 Bacteria 3065
167 Ga0400483_052111 3300039062 Bacteria 2721
168 Ga0400483_149301 3300039062 Bacteria 4392
169 Ga0436365_0376694 3300039437 Bacteria 6274
170 Ga0436365_0672716 3300039437 Bacteria 2585
171 Ga0436365_1360918 3300039437 Bacteria 2123
172 Ga0436360_0369505 3300039438 Bacteria 4319
173 Ga0436360_0730862 3300039438 Bacteria 1074
174 Ga0436360_1264475 3300039438 Bacteria 2587
175 Ga0436361_0171581 3300039447 Bacteria 898
176 Ga0436361_0388962 3300039447 Bacteria 3113
177 Ga0436361_1163612 3300039447 Bacteria 1508
178 Ga0436363_0362619 3300039450 Bacteria 1386
179 Ga0436362_0677078 3300039453 Bacteria 1068
180 Ga0439459_0039049 3300042438 Bacteria 1001
181 Ga0466965_0387277 3300044683 Bacteria 771
182 Ga0466963_0174923 3300044694 Bacteria 1497
183 Ga0466963_0360648 3300044694 Bacteria 1024
184 Ga0466957_0363101 3300044842 Bacteria 984
185 Ga0466960_0287310 3300044901 Bacteria 923
186 Ga0451576_0001200 3300045051 Bacteria 46344
187 Ga0466967_0082808 3300045976 Bacteria 2900
188 Ga0495617_119140 3300046452 Bacteria 851
189 Ga0495608_0332007 3300046511 Bacteria 938
190 Ga0495635_0109208 3300046663 Bacteria 1890
191 Ga0495657_0134658 3300046675 Bacteria 1545
192 Ga0495669_0136956 3300046684 Bacteria 1155
193 Ga0495684_0048400 3300047471 Bacteria 3251
194 Ga0495602_0070082 3300048088 Bacteria 3003
195 Ga0495626_0128531 3300048091 Bacteria 1084
196 Ga0496119_0003988 3300048922 Bacteria 14944
197 Ga0496126_0694911 3300048929 Bacteria 791
198 Ga0501032_0169566 3300049569 Bacteria 1432
199 Ga0501033_0026408 3300049570 Bacteria 4372
200 Ga0501033_0045085 3300049570 Bacteria 3282
201 Ga0501033_0083345 3300049570 Bacteria 2344
202 Ga0501033_0444818 3300049570 Bacteria 901
203 Ga0501034_0004242 3300049571 Bacteria 15992
204 Ga0501034_0037546 3300049571 Bacteria 4905
205 Ga0501034_0082176 3300049571 Unclassified 3224
206 Ga0501034_0418246 3300049571 Bacteria 1262
207 Ga0501036_0297230 3300049572 Bacteria 1351
208 Ga0501036_0374384 3300049572 Bacteria 1189
209 Ga0501037_0415800 3300049573 Bacteria 921
210 Ga0501040_0325473 3300049576 Bacteria 1100
211 Ga0501043_0493724 3300049579 Bacteria 915
212 Ga0501046_0332035 3300049580 Bacteria 1106
213 Ga0501047_0430425 3300049581 Bacteria 1150
214 Ga0501047_0680678 3300049581 Bacteria 847
215 Ga0501068_0244956 3300049584 Bacteria 1141
216 Ga0501070_0072638 3300049586 Bacteria 2848
217 Ga0501072_0476030 3300049588 Bacteria 988
218 Ga0501083_0023099 3300049744 Bacteria 4315
219 Ga0501035_0043153 3300049822 Bacteria 4065
220 Ga0501035_0104550 3300049822 Bacteria 2483
221 Ga0501044_0101315 3300049823 Bacteria 2897
222 Ga0501044_0117070 3300049823 Bacteria 2669
223 nmdc:mga03683_27877_c1 3300050489 Bacteria 2241
224 nmdc:mga03683_98994_c1 3300050489 Bacteria 1280
225 nmdc:mga0yw44_65149_c1 3300050492 Bacteria 2245
226 nmdc:mga0yw44_99739_c1 3300050492 Bacteria 1848
227 nmdc:mga0k408_263206_c1 3300050493 Bacteria 1030
228 nmdc:mga0k408_42473_c2 3300050493 Bacteria 2002
229 nmdc:mga06z11_347000_c1 3300050494 Bacteria 888
230 nmdc:mga06z11_69100_c1 3300050494 Bacteria 1864
231 nmdc:mga07m45_48677_c1 3300050496 Bacteria 2384
232 nmdc:mga0sz30_41844_c1 3300050516 Bacteria 1525
233 nmdc:mga0sz30_4363_c1 3300050516 Bacteria 5108
234 Ga0500646_0062843 3300053090 Bacteria 1097
235 Ga0500647_0029848 3300053091 Bacteria 2588
236 Ga0500647_0032251 3300053091 Bacteria 2496
237 Ga0500651_0269936 3300053093 Bacteria 984
238 Ga0500641_0089335 3300053096 Bacteria 1314
239 Ga0500595_056680 3300053119 Bacteria 1196
240 Ga0500658_0243289 3300053134 Bacteria 826
241 Ga0500568_0003910 3300053139 Bacteria 8106
242 Ga0500616_0003394 3300053153 Bacteria 12221
243 Ga0500616_0047233 3300053153 Bacteria 2286
244 Ga0530510_0206537 3300061734 Bacteria 1459

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035111 Ga0373923_0059864 Ga0373923_0059864_10_621 193
2 3300044683 Ga0466965_0387277 Ga0466965_0387277_150_761 193
3 3300053096 Ga0500641_0089335 Ga0500641_0089335_18_629 193
4 3300049572 Ga0501036_0297230 Ga0501036_0297230_153_854 210
5 iso_pu_bacteria 2894772417 2894774394 217
6 3300005336 Ga0070680_100522819 Ga0070680_1005228191 218
7 3300005616 Ga0068852_100250718 Ga0068852_1002507182 218
8 3300036401 Ga0373937_0317985 Ga0373937_0317985_131_814 218
9 3300039438 Ga0436360_0730862 Ga0436360_0730862_45_728 218
10 3300039447 Ga0436361_0388962 Ga0436361_0388962_1138_1821 218
11 3300046663 Ga0495635_0109208 Ga0495635_0109208_450_1133 218
12 3300046675 Ga0495657_0134658 Ga0495657_0134658_352_1035 218
13 3300047471 Ga0495684_0048400 Ga0495684_0048400_1827_2510 218
14 3300048088 Ga0495602_0070082 Ga0495602_0070082_397_1080 218
15 3300048922 Ga0496119_0003988 Ga0496119_0003988_4424_5107 218
16 3300048929 Ga0496126_0694911 Ga0496126_0694911_29_712 218
17 iso_pu_bacteria 2842775625 2842777951 218
18 iso_pu_bacteria 2883577096 2883578433 218
19 3300045051 Ga0451576_0001200 Ga0451576_0001200_20521_21213 219
20 iso_pu_bacteria 2513237139 2513878047 219
21 iso_pu_bacteria 2513237161 2514012655 219
22 iso_pu_bacteria 2617270735 2617352570 219
23 iso_pu_bacteria 2802429603 2805920007 219
24 iso_pu_bacteria 2824671348 2824674272 219
25 iso_pu_bacteria 2824687955 2824690894 219
26 iso_pu_bacteria 2824773399 2824778207 219
27 iso_pu_bacteria 2838122688 2838127459 219
28 iso_pu_bacteria 2841941048 2841941587 219
29 iso_pu_bacteria 2841949485 2841952396 219
30 iso_pu_bacteria 2841966195 2841967733 219
31 iso_pu_bacteria 2841974524 2841982104 219
32 iso_pu_bacteria 2841983080 2841986420 219
33 iso_pu_bacteria 2847939898 2847945052 219
34 iso_pu_bacteria 2929199973 2929204056 219
35 iso_pu_bacteria 8055909800 8055911414 219
36 3300005327 Ga0070658_10008327 Ga0070658_100083279 220
37 3300005330 Ga0070690_100461373 Ga0070690_1004613732 220
38 3300005331 Ga0070670_100202793 Ga0070670_1002027932 220
39 3300005336 Ga0070680_100015841 Ga0070680_1000158412 220
40 3300005340 Ga0070689_100565925 Ga0070689_1005659251 220
41 3300005341 Ga0070691_10160120 Ga0070691_101601202 220
42 3300005356 Ga0070674_100202871 Ga0070674_1002028713 220
43 3300005366 Ga0070659_100599583 Ga0070659_1005995832 220
44 3300005436 Ga0070713_100098663 Ga0070713_1000986632 220
45 3300005437 Ga0070710_10122507 Ga0070710_101225073 220
46 3300005438 Ga0070701_10216630 Ga0070701_102166302 220
47 3300005445 Ga0070708_100701296 Ga0070708_1007012961 220
48 3300005456 Ga0070678_100212458 Ga0070678_1002124583 220
49 3300005458 Ga0070681_10029061 Ga0070681_100290614 220
50 3300005467 Ga0070706_100347490 Ga0070706_1003474902 220
51 3300005471 Ga0070698_100015620 Ga0070698_1000156205 220
52 3300005518 Ga0070699_100057798 Ga0070699_1000577984 220
53 3300005530 Ga0070679_100002889 Ga0070679_10000288912 220
54 3300005536 Ga0070697_100072310 Ga0070697_1000723103 220
55 3300005539 Ga0068853_100443856 Ga0068853_1004438562 220
56 3300005548 Ga0070665_100044210 Ga0070665_1000442103 220
57 3300005548 Ga0070665_100493404 Ga0070665_1004934042 220
58 3300005548 Ga0070665_100549037 Ga0070665_1005490372 220
59 3300005563 Ga0068855_100498471 Ga0068855_1004984712 220
60 3300005577 Ga0068857_100041147 Ga0068857_1000411474 220
61 3300005614 Ga0068856_100025379 Ga0068856_1000253794 220
62 3300005614 Ga0068856_100219317 Ga0068856_1002193172 220
63 3300005616 Ga0068852_100436752 Ga0068852_1004367522 220
64 3300005617 Ga0068859_100181338 Ga0068859_1001813383 220
65 3300005618 Ga0068864_100258895 Ga0068864_1002588952 220
66 3300005843 Ga0068860_100015356 Ga0068860_1000153564 220
67 3300005843 Ga0068860_100317506 Ga0068860_1003175062 220
68 3300005844 Ga0068862_100182252 Ga0068862_1001822522 220
69 3300005937 Ga0081455_10000434 Ga0081455_1000043427 220
70 3300005937 Ga0081455_10002143 Ga0081455_100021432 220
71 3300005937 Ga0081455_10007176 Ga0081455_1000717613 220
72 3300005985 Ga0081539_10009772 Ga0081539_100097724 220
73 3300005985 Ga0081539_10011462 Ga0081539_100114627 220
74 3300006038 Ga0075365_10029237 Ga0075365_100292374 220
75 3300006038 Ga0075365_10326099 Ga0075365_103260993 220
76 3300006042 Ga0075368_10124368 Ga0075368_101243682 220
77 3300006177 Ga0075362_10029282 Ga0075362_100292821 220
78 3300006177 Ga0075362_10052564 Ga0075362_100525642 220
79 3300006177 Ga0075362_10122617 Ga0075362_101226172 220
80 3300006178 Ga0075367_10221399 Ga0075367_102213991 220
81 3300006178 Ga0075367_10378253 Ga0075367_103782532 220
82 3300006186 Ga0075369_10000336 Ga0075369_100003365 220
83 3300006195 Ga0075366_10013866 Ga0075366_100138664 220
84 3300006195 Ga0075366_10091553 Ga0075366_100915532 220
85 3300006195 Ga0075366_10188225 Ga0075366_101882253 220
86 3300006847 Ga0075431_100598402 Ga0075431_1005984022 220
87 3300006931 Ga0097620_100181331 Ga0097620_1001813312 220
88 3300006931 Ga0097620_100256367 Ga0097620_1002563672 220
89 3300009093 Ga0105240_10346169 Ga0105240_103461693 220
90 3300009094 Ga0111539_10544564 Ga0111539_105445642 220
91 3300009147 Ga0114129_10590848 Ga0114129_105908482 220
92 3300009148 Ga0105243_10549941 Ga0105243_105499412 220
93 3300009174 Ga0105241_10660131 Ga0105241_106601312 220
94 3300009177 Ga0105248_10936393 Ga0105248_109363931 220
95 3300009545 Ga0105237_10467239 Ga0105237_104672392 220
96 3300009551 Ga0105238_10272840 Ga0105238_102728402 220
97 3300009551 Ga0105238_10473689 Ga0105238_104736892 220
98 3300009553 Ga0105249_10514479 Ga0105249_105144792 220
99 3300009988 Ga0105035_107265 Ga0105035_1072652 220
100 3300013104 Ga0157370_10009458 Ga0157370_100094588 220
101 3300013105 Ga0157369_10038152 Ga0157369_100381524 220
102 3300013105 Ga0157369_10197245 Ga0157369_101972452 220
103 3300013306 Ga0163162_10783964 Ga0163162_107839643 220
104 3300013307 Ga0157372_10363751 Ga0157372_103637512 220
105 3300013308 Ga0157375_10785570 Ga0157375_107855701 220
106 3300014497 Ga0182008_10180163 Ga0182008_101801631 220
107 3300021384 Ga0213876_10021715 Ga0213876_100217153 220
108 3300021441 Ga0213871_10006183 Ga0213871_100061832 220
109 3300025898 Ga0207692_10062829 Ga0207692_100628293 220
110 3300025903 Ga0207680_10249545 Ga0207680_102495452 220
111 3300025904 Ga0207647_10113892 Ga0207647_101138922 220
112 3300025909 Ga0207705_10041156 Ga0207705_100411562 220
113 3300025911 Ga0207654_10401028 Ga0207654_104010282 220
114 3300025912 Ga0207707_10013882 Ga0207707_100138826 220
115 3300025913 Ga0207695_10067173 Ga0207695_100671732 220
116 3300025913 Ga0207695_10249637 Ga0207695_102496372 220
117 3300025915 Ga0207693_10166805 Ga0207693_101668052 220
118 3300025917 Ga0207660_10035823 Ga0207660_100358234 220
119 3300025921 Ga0207652_10027622 Ga0207652_100276224 220
120 3300025923 Ga0207681_10070672 Ga0207681_100706723 220
121 3300025931 Ga0207644_10135246 Ga0207644_101352462 220
122 3300025932 Ga0207690_10208686 Ga0207690_102086862 220
123 3300025936 Ga0207670_10268145 Ga0207670_102681452 220
124 3300025944 Ga0207661_10878856 Ga0207661_108788562 220
125 3300025945 Ga0207679_10229242 Ga0207679_102292422 220
126 3300026116 Ga0207674_10032698 Ga0207674_100326984 220
127 3300026116 Ga0207674_10190346 Ga0207674_101903462 220
128 3300026121 Ga0207683_10232883 Ga0207683_102328832 220
129 3300026142 Ga0207698_10474666 Ga0207698_104746662 220
130 3300028379 Ga0268266_10186323 Ga0268266_101863233 220
131 3300028379 Ga0268266_10346541 Ga0268266_103465413 220
132 3300028379 Ga0268266_10850555 Ga0268266_108505552 220
133 3300028380 Ga0268265_10688481 Ga0268265_106884811 220
134 3300031911 Ga0307412_10452619 Ga0307412_104526192 220
135 3300032126 Ga0307415_100411968 Ga0307415_1004119682 220
136 3300035115 Ga0373941_0151644 Ga0373941_0151644_72_761 220
137 3300035692 Ga0373935_0373484 Ga0373935_0373484_275_964 220
138 3300035725 Ga0373947_0335811 Ga0373947_0335811_49_738 220
139 3300037312 Ga0395899_0027167 Ga0395899_0027167_22_711 220
140 3300037312 Ga0395899_0075637 Ga0395899_0075637_200_889 220
141 3300037312 Ga0395899_0178224 Ga0395899_0178224_536_1225 220
142 3300037418 Ga0395900_0035147 Ga0395900_0035147_3024_3713 220
143 3300037418 Ga0395900_0038828 Ga0395900_0038828_4043_4732 220
144 3300037418 Ga0395900_0102804 Ga0395900_0102804_983_1672 220
145 3300037418 Ga0395900_0247013 Ga0395900_0247013_629_1318 220
146 3300037466 Ga0395898_0016415 Ga0395898_0016415_3299_3988 220
147 3300037466 Ga0395898_0030276 Ga0395898_0030276_3176_3865 220
148 3300038443 Ga0395901_0001851 Ga0395901_0001851_19411_20100 220
149 3300038443 Ga0395901_0008119 Ga0395901_0008119_8312_9001 220
150 3300038443 Ga0395901_0034540 Ga0395901_0034540_1138_1827 220
151 3300038443 Ga0395901_0055930 Ga0395901_0055930_1814_2503 220
152 3300039437 Ga0436365_0376694 Ga0436365_0376694_3035_3721 220
153 3300039438 Ga0436360_0369505 Ga0436360_0369505_233_922 220
154 3300039447 Ga0436361_0171581 Ga0436361_0171581_106_795 220
155 3300039447 Ga0436361_1163612 Ga0436361_1163612_530_1219 220
156 3300039453 Ga0436362_0677078 Ga0436362_0677078_210_911 220
157 3300042438 Ga0439459_0039049 Ga0439459_0039049_183_872 220
158 3300044694 Ga0466963_0174923 Ga0466963_0174923_391_1080 220
159 3300044694 Ga0466963_0360648 Ga0466963_0360648_18_710 220
160 3300044842 Ga0466957_0363101 Ga0466957_0363101_30_719 220
161 3300045976 Ga0466967_0082808 Ga0466967_0082808_1869_2558 220
162 3300046511 Ga0495608_0332007 Ga0495608_0332007_237_926 220
163 3300046684 Ga0495669_0136956 Ga0495669_0136956_56_745 220
164 3300048091 Ga0495626_0128531 Ga0495626_0128531_314_1003 220
165 3300049569 Ga0501032_0169566 Ga0501032_0169566_276_965 220
166 3300049570 Ga0501033_0083345 Ga0501033_0083345_215_877 220
167 3300049570 Ga0501033_0444818 Ga0501033_0444818_140_829 220
168 3300049571 Ga0501034_0004242 Ga0501034_0004242_15228_15917 220
169 3300049571 Ga0501034_0037546 Ga0501034_0037546_552_1241 220
170 3300049572 Ga0501036_0374384 Ga0501036_0374384_124_813 220
171 3300049573 Ga0501037_0415800 Ga0501037_0415800_45_734 220
172 3300049579 Ga0501043_0493724 Ga0501043_0493724_205_894 220
173 3300049580 Ga0501046_0332035 Ga0501046_0332035_283_972 220
174 3300049581 Ga0501047_0430425 Ga0501047_0430425_89_778 220
175 3300049584 Ga0501068_0244956 Ga0501068_0244956_56_745 220
176 3300049588 Ga0501072_0476030 Ga0501072_0476030_245_937 220
177 3300049823 Ga0501044_0117070 Ga0501044_0117070_1434_2123 220
178 3300050489 nmdc:mga03683_27877_c1 nmdc:mga03683_27877_c1_67_756 220
179 3300050489 nmdc:mga03683_98994_c1 nmdc:mga03683_98994_c1_414_1103 220
180 3300050492 nmdc:mga0yw44_65149_c1 nmdc:mga0yw44_65149_c1_1075_1764 220
181 3300050492 nmdc:mga0yw44_99739_c1 nmdc:mga0yw44_99739_c1_236_925 220
182 3300050493 nmdc:mga0k408_263206_c1 nmdc:mga0k408_263206_c1_111_800 220
183 3300050493 nmdc:mga0k408_42473_c2 nmdc:mga0k408_42473_c2_1019_1708 220
184 3300050494 nmdc:mga06z11_347000_c1 nmdc:mga06z11_347000_c1_48_737 220
185 3300050494 nmdc:mga06z11_69100_c1 nmdc:mga06z11_69100_c1_877_1566 220
186 3300050496 nmdc:mga07m45_48677_c1 nmdc:mga07m45_48677_c1_656_1345 220
187 3300050516 nmdc:mga0sz30_41844_c1 nmdc:mga0sz30_41844_c1_120_809 220
188 3300050516 nmdc:mga0sz30_4363_c1 nmdc:mga0sz30_4363_c1_3757_4446 220
189 3300053090 Ga0500646_0062843 Ga0500646_0062843_85_774 220
190 3300053091 Ga0500647_0029848 Ga0500647_0029848_1499_2188 220
191 3300053093 Ga0500651_0269936 Ga0500651_0269936_87_776 220
192 3300053119 Ga0500595_056680 Ga0500595_056680_376_1065 220
193 3300053134 Ga0500658_0243289 Ga0500658_0243289_130_816 220
194 3300053139 Ga0500568_0003910 Ga0500568_0003910_354_1040 220
195 3300053153 Ga0500616_0003394 Ga0500616_0003394_708_1397 220
196 3300005548 Ga0070665_100036248 Ga0070665_1000362482 221
197 3300009174 Ga0105241_10634333 Ga0105241_106343332 221
198 3300009545 Ga0105237_10186207 Ga0105237_101862072 221
199 3300009551 Ga0105238_10001577 Ga0105238_1000157727 221
200 3300010375 Ga0105239_10212405 Ga0105239_102124053 221
201 3300014325 Ga0163163_10544599 Ga0163163_105445991 221
202 3300021384 Ga0213876_10133145 Ga0213876_101331452 221
203 3300025913 Ga0207695_10522547 Ga0207695_105225472 221
204 3300025924 Ga0207694_10003346 Ga0207694_1000334613 221
205 3300028379 Ga0268266_10009478 Ga0268266_100094789 221
206 3300031727 Ga0316576_10023481 Ga0316576_100234812 221
207 3300036712 Ga0316584_0005789 Ga0316584_0005789_3465_4133 221
208 3300037312 Ga0395899_0134515 Ga0395899_0134515_42_707 221
209 3300038443 Ga0395901_0076455 Ga0395901_0076455_2062_2727 221
210 3300039062 Ga0400483_052111 Ga0400483_052111_761_1426 221
211 3300039062 Ga0400483_149301 Ga0400483_149301_105_770 221
212 3300039437 Ga0436365_1360918 Ga0436365_1360918_291_986 221
213 3300039438 Ga0436360_1264475 Ga0436360_1264475_844_1536 221
214 3300039450 Ga0436363_0362619 Ga0436363_0362619_212_904 221
215 3300049570 Ga0501033_0045085 Ga0501033_0045085_331_1023 221
216 3300049581 Ga0501047_0680678 Ga0501047_0680678_141_833 221
217 3300053091 Ga0500647_0032251 Ga0500647_0032251_1575_2240 221
218 3300003203 JGI25406J46586_10000219 JGI25406J46586_1000021916 222
219 3300005985 Ga0081539_10000207 Ga0081539_1000020797 222
220 3300039062 Ga0400483_012628 Ga0400483_012628_2284_2958 222
221 3300025918 Ga0207662_10479674 Ga0207662_104796742 223
222 3300044901 Ga0466960_0287310 Ga0466960_0287310_191_910 223
223 3300049570 Ga0501033_0026408 Ga0501033_0026408_1962_2663 223
224 3300049571 Ga0501034_0082176 Ga0501034_0082176_1441_2142 223
225 3300049571 Ga0501034_0418246 Ga0501034_0418246_477_1178 223
226 3300049576 Ga0501040_0325473 Ga0501040_0325473_19_717 223
227 3300049586 Ga0501070_0072638 Ga0501070_0072638_440_1141 223
228 3300049822 Ga0501035_0043153 Ga0501035_0043153_722_1423 223
229 3300049822 Ga0501035_0104550 Ga0501035_0104550_641_1342 223
230 3300049823 Ga0501044_0101315 Ga0501044_0101315_1768_2469 223
231 3300035398 Ga0316574_0151000 Ga0316574_0151000_43_747 224
232 3300039437 Ga0436365_0672716 Ga0436365_0672716_317_1018 224
233 3300046452 Ga0495617_119140 Ga0495617_119140_123_827 224
234 3300053153 Ga0500616_0047233 Ga0500616_0047233_748_1452 224
235 iso_pu_bacteria 8057733483 8057736573 224
236 3300005843 Ga0068860_100001632 Ga0068860_1000016322 226
237 3300028381 Ga0268264_10001466 Ga0268264_1000146613 226
238 3300031730 Ga0307516_10335911 Ga0307516_103359112 226
239 3300061734 Ga0530510_0206537 Ga0530510_0206537_170_886 226
240 3300006871 Ga0075434_100009006 Ga0075434_1000090067 227
241 3300006881 Ga0068865_100082298 Ga0068865_1000822984 227
242 3300006914 Ga0075436_100005370 Ga0075436_1000053707 227
243 3300025938 Ga0207704_10090676 Ga0207704_100906762 227
244 3300031852 Ga0307410_10527151 Ga0307410_105271512 227
245 3300032133 Ga0316583_10096292 Ga0316583_100962922 227
246 3300003187 JGI25151J46595_10083518 JGI25151J46595_100835181 228
247 3300003761 Ga0055535_1004887 Ga0055535_10048873 228
248 3300003841 Ga0055541_1001293 Ga0055541_10012933 228
249 3300005328 Ga0070676_10102271 Ga0070676_101022712 228
250 3300005335 Ga0070666_10010654 Ga0070666_100106542 228
251 3300005337 Ga0070682_100296567 Ga0070682_1002965672 228
252 3300005347 Ga0070668_100145528 Ga0070668_1001455282 228
253 3300005365 Ga0070688_100316234 Ga0070688_1003162342 228
254 3300005466 Ga0070685_10024538 Ga0070685_100245384 228
255 3300005548 Ga0070665_100002041 Ga0070665_10000204124 228
256 3300005616 Ga0068852_100089471 Ga0068852_1000894714 228
257 3300025225 Ga0209566_100126 Ga0209566_10012626 228
258 3300025294 Ga0209025_1017865 Ga0209025_10178653 228
259 3300025294 Ga0209025_1022468 Ga0209025_10224683 228
260 3300025909 Ga0207705_10080570 Ga0207705_100805703 228
261 3300025918 Ga0207662_10496288 Ga0207662_104962881 228
262 3300025934 Ga0207686_10057773 Ga0207686_100577733 228
263 3300028379 Ga0268266_10001996 Ga0268266_1000199624 228
264 3300049744 Ga0501083_0023099 Ga0501083_0023099_3314_4036 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

1

225

0.91

PF01965

DJ-1_PfpI

DJ-1/PfpI family

28

104

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9404 2 216
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9189 2 216
1t3t-assembly1.cif.gz_A structure of formylglycinamide synthetase 0.8663 2 214
4l78-assembly1.cif.gz_A xenon trapping and statistical coupling analysis uncover regions important for structure and function of multidomain protein stpurl 0.866 2 214
4lgy-assembly1.cif.gz_A importance of hydrophobic cavities in allosteric regulation of formylglycinamide synthetase: insight from xenon trapping and statistical coupling analysis 0.8628 2 214
ID Description Score Start End Superfamily
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9593 1 217 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9568 2 215 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9562 1 215 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9465 1 217 3.40.50.880
3d54L00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.941 2 216 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1I7LA57-F1-model_v4 Multifunctional fusion protein [Includes: Phosphoribosylformylglycinamidine synthase subunit PurL (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit II) (Glutamine amidotransferase PurL) (Phosphoribosylformylglycinamidine synthase subunit II) (FGAR amidotransferase II) (FGAR-AT II); Phosphoribosylformylglycinamidine synthase subunit PurQ (Formylglycinamide ribonucleotide amidotransferase subunit I) (Glutaminase PurQ) (Phosphoribosylformylglycinamidine synthase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (EC 3.5.1.2)] 0.9774 1 215 GO:0000287
GO:0004359
GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
AF-A0A2V8MWT8-F1-model_v4 Multifunctional fusion protein [Includes: Phosphoribosylformylglycinamidine synthase subunit PurL (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit II) (Glutamine amidotransferase PurL) (Phosphoribosylformylglycinamidine synthase subunit II) (FGAR amidotransferase II) (FGAR-AT II); Phosphoribosylformylglycinamidine synthase subunit PurQ (Formylglycinamide ribonucleotide amidotransferase subunit I) (Glutaminase PurQ) (Phosphoribosylformylglycinamidine synthase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (EC 3.5.1.2)] 0.9752 1 222 GO:0000287
GO:0004359
GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A0N0I5B5-F1-model_v4 deleted 0.9745 69 224
AF-Q3EWN9-F1-model_v4 deleted 0.9737 69 224
AF-A0A1D4RLC1-F1-model_v4 Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3) 0.9736 63 220 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
GO:0016787

Feature Viewer

pLDDT pTM Quality
91.59 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map