F372789

General Info

Members Datasets Scaffolds Average Seq Length
264 176 236 490

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0032051|Ga0453684_0032051_2454_3965
Length 503
Sequence VTAAGQAQPVSAAAPPGPREPGWAISAYHDTAEIYRQLDALVAQPLRPLRRDRMAEVLASLDRRCAGSRRLAEEARRHIPGGVQHNLAFNYPFPLAVARADGAHLWDVDGNRYVDFLQAGGPTVLGSNHEPVRRKVIELLETCGPVTGLLHEYEVKLAALVSRFMPAVEQFRMLGSGTESVMAAIRAARVFTGKKKIIKSGGAYHGWSDALVYGMHIPGTGRLEAAGIPASASRHTQEFFPNDLDGLRRKLRWNRLRGGTAAVIVEPLGPESGTRPVPFGFAAALRALCDEFGALLIFDEVVTGFRVGMGGAQGYFGVKPDLTVFGKCIAGGYPMAGGLGGRREVMATLAAGLXXKKIGGRAYVGGTLSANPLSCVAGYHALLEMERLDAPAVAGRAGDRLTRGLQEIVRRRGLPFVAYNQGSIVHLETSGVMLLDLRSPLRLARELSPRKHMLEEMGAAYLNEGVVTLAGSRMYTSIADTDPVIDDALERLDRVLGAVEGAA

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
7 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
8 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
9 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
10 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
11 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
12 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
18 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
19 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
20 2831864461 Roseateles noduli HZ7 Isolate Nodule
21 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
22 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
23 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
24 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
25 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
26 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
27 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
28 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
35 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
103 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
126 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
127 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
128 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
131 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
132 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
133 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
134 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
135 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
163 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
171 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
172 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
173 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.39
Metatranscriptomes 0
Isolates 10.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 31.44
Nodule 1.14
Rhizoplane 1.89
Rhizosphere 44.7
Stem 0
Stem Tuber 0
Unclassified 20.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000726 3300001979 Bacteria 14365
2 JGI25156J39149_1001798 3300002705 Bacteria 8413
3 JGI25162J39368_1002094 3300002737 Bacteria 8536
4 JGI25154J39366_1003917 3300002738 Bacteria 2874
5 JGI25157J39369_1001643 3300002741 Bacteria 7673
6 JGI25164J39214_1000182 3300002772 Bacteria 55944
7 JGI25152J39213_1004790 3300002773 Bacteria 4152
8 JGI25151J46595_10000484 3300003187 Bacteria 37639
9 JGI25165J46597_1000272 3300003214 Bacteria 66655
10 JGI25153J46596_10000338 3300003215 Bacteria 33480
11 JGI25153J46596_10002611 3300003215 Bacteria 10306
12 rootH1_10001291 3300003316 Bacteria 29451
13 rootH1_10002207 3300003316 Bacteria 7018
14 rootL2_10000467 3300003322 Bacteria 50803
15 rootL2_10001624 3300003322 Bacteria 45830
16 rootH1_10002449 3300003323 Bacteria 17912
17 rootH1_10044720 3300003323 Bacteria 3909
18 Ga0055525_1000494 3300003759 Bacteria 20236
19 Ga0055527_1000044 3300003760 Bacteria 111829
20 Ga0055527_1002946 3300003760 Bacteria 2675
21 Ga0055535_1000736 3300003761 Bacteria 24606
22 Ga0055535_1000746 3300003761 Bacteria 24306
23 Ga0055535_1001528 3300003761 Bacteria 11400
24 Ga0055542_1000108 3300003762 Bacteria 111829
25 Ga0055542_1000211 3300003762 Bacteria 71209
26 Ga0055542_1001187 3300003762 Bacteria 14856
27 Ga0055529_1000546 3300003763 Bacteria 32071
28 Ga0055529_1000564 3300003763 Bacteria 30665
29 Ga0055526_1002682 3300003771 Bacteria 11876
30 Ga0055526_1011167 3300003771 Bacteria 4083
31 Ga0055524_1000580 3300003775 Bacteria 26894
32 Ga0055531_10011339 3300003794 Bacteria 4314
33 Ga0055543_1001809 3300004625 Bacteria 7871
34 Ga0065165_1000024 3300005262 Bacteria 247672
35 Ga0070714_100002569 3300005435 Bacteria 13377
36 Ga0068867_100022031 3300005459 Bacteria 4552
37 Ga0068852_100002408 3300005616 Bacteria 12888
38 Ga0070717_10151889 3300006028 Bacteria 2004
39 Ga0075365_10017379 3300006038 Bacteria 4399
40 Ga0075364_10009370 3300006051 Bacteria 5870
41 Ga0075432_10000531 3300006058 Bacteria 11432
42 Ga0075432_10000766 3300006058 Bacteria 9992
43 Ga0075362_10001247 3300006177 Bacteria 8033
44 Ga0075367_10013345 3300006178 Bacteria 4414
45 Ga0075366_10002070 3300006195 Bacteria 10179
46 Ga0075366_10005381 3300006195 Bacteria 6937
47 Ga0075366_10005747 3300006195 Bacteria 6734
48 Ga0075366_10017997 3300006195 Bacteria 4077
49 Ga0075370_10002803 3300006353 Bacteria 8171
50 Ga0075370_10004958 3300006353 Bacteria 6542
51 Ga0099823_1000002 3300006944 Bacteria 212272
52 Ga0105244_10014815 3300009036 Bacteria 4494
53 Ga0105240_10010061 3300009093 Bacteria 13317
54 Ga0105243_10000697 3300009148 Bacteria 32602
55 Ga0105243_10003002 3300009148 Bacteria 13936
56 Ga0105242_10213106 3300009176 Bacteria 1722
57 Ga0105239_10028121 3300010375 Bacteria 6187
58 Ga0157319_1000011 3300012497 Bacteria 180060
59 Ga0157371_10010366 3300013102 Bacteria 7268
60 Ga0157369_10007768 3300013105 Bacteria 12339
61 Ga0213872_10004024 3300021361 Bacteria 7930
62 Ga0213872_10061435 3300021361 Bacteria 1699
63 Ga0209672_100024 3300025228 Bacteria 367869
64 Ga0209672_100098 3300025228 Bacteria 110776
65 Ga0209672_101535 3300025228 Bacteria 8008
66 Ga0209563_100067 3300025230 Bacteria 256096
67 Ga0207427_100095 3300025231 Bacteria 125731
68 Ga0209437_100209 3300025233 Bacteria 110324
69 Ga0209258_100047 3300025242 Bacteria 367869
70 Ga0209258_100055 3300025242 Bacteria 337291
71 Ga0209258_100135 3300025242 Bacteria 170832
72 Ga0209646_1001912 3300025246 Bacteria 5063
73 Ga0209026_1001138 3300025250 Bacteria 12515
74 Ga0209148_1000054 3300025254 Bacteria 367869
75 Ga0209148_1000058 3300025254 Bacteria 357482
76 Ga0209148_1000102 3300025254 Bacteria 216658
77 Ga0209759_1004909 3300025256 Bacteria 4840
78 Ga0209759_1005587 3300025256 Bacteria 4364
79 Ga0209129_1000122 3300025258 Bacteria 135306
80 Ga0209129_1000651 3300025258 Bacteria 23242
81 Ga0209233_1000197 3300025261 Bacteria 125745
82 Ga0209455_1000018 3300025272 Bacteria 718034
83 Ga0209455_1000052 3300025272 Bacteria 367804
84 Ga0209455_1003685 3300025272 Bacteria 5304
85 Ga0209673_1003651 3300025273 Bacteria 8895
86 Ga0209673_1010696 3300025273 Bacteria 3845
87 Ga0209673_1014953 3300025273 Bacteria 2976
88 Ga0209025_1000207 3300025294 Bacteria 140774
89 Ga0209564_1000005 3300025295 Bacteria 1147192
90 Ga0209564_1000266 3300025295 Bacteria 110519
91 Ga0209758_1000078 3300025297 Bacteria 266153
92 Ga0209758_1000091 3300025297 Bacteria 242583
93 Ga0209050_1002477 3300025298 Bacteria 15691
94 Ga0209256_1000659 3300025299 Bacteria 46883
95 Ga0209051_1003283 3300025303 Bacteria 10725
96 Ga0209051_1019433 3300025303 Bacteria 2963
97 Ga0209257_1001562 3300025304 Bacteria 26463
98 Ga0207655_1000059 3300025728 Bacteria 265297
99 Ga0207695_10060082 3300025913 Bacteria 3937
100 Ga0207664_10048191 3300025929 Bacteria 3350
101 Ga0207686_10012723 3300025934 Bacteria 4632
102 Ga0207709_10001749 3300025935 Bacteria 14609
103 Ga0207709_10008254 3300025935 Bacteria 5768
104 Ga0207651_10130065 3300025960 Bacteria 1925
105 Ga0207674_10067465 3300026116 Bacteria 3601
106 Ga0207675_100070591 3300026118 Bacteria 3265
107 Ga0207698_10014466 3300026142 Bacteria 5247
108 Ga0209389_1000340 3300027296 Bacteria 28501
109 Ga0209813_10003758 3300027866 Bacteria 3578
110 Ga0209974_10005570 3300027876 Bacteria 4426
111 Ga0207428_10001871 3300027907 Bacteria 21433
112 Ga0307517_10001740 3300028786 Bacteria 35898
113 Ga0307515_10000282 3300028794 Bacteria 125216
114 Ga0307515_10000837 3300028794 Bacteria 70694
115 Ga0307515_10001476 3300028794 Bacteria 52884
116 Ga0307515_10017078 3300028794 Bacteria 13249
117 Ga0307515_10031199 3300028794 Bacteria 8897
118 Ga0265325_10058175 3300031241 Bacteria 1970
119 Ga0307513_10006752 3300031456 Bacteria 14966
120 Ga0307513_10053991 3300031456 Bacteria 4312
121 Ga0307509_10001779 3300031507 Bacteria 35792
122 Ga0307509_10001917 3300031507 Bacteria 34353
123 Ga0307509_10016276 3300031507 Bacteria 8612
124 Ga0307509_10044938 3300031507 Bacteria 4768
125 Ga0307408_100000219 3300031548 Bacteria 61012
126 Ga0307508_10000016 3300031616 Bacteria 206976
127 Ga0307508_10001829 3300031616 Bacteria 23544
128 Ga0307508_10069963 3300031616 Bacteria 3081
129 Ga0307514_10001033 3300031649 Bacteria 40119
130 Ga0307514_10001530 3300031649 Bacteria 27605
131 Ga0307514_10126962 3300031649 Bacteria 1765
132 Ga0307516_10005067 3300031730 Bacteria 15943
133 Ga0307406_10000604 3300031901 Bacteria 20514
134 Ga0307416_100002714 3300032002 Bacteria 10258
135 Ga0307507_10000140 3300033179 Bacteria 125574
136 Ga0307510_10127926 3300033180 Bacteria 2223
137 Ga0373931_0017908 3300035691 Bacteria 3512
138 Ga0395899_0001036 3300037312 Bacteria 25311
139 Ga0395899_0002939 3300037312 Bacteria 13660
140 Ga0395900_0001093 3300037418 Bacteria 34498
141 Ga0395898_0000132 3300037466 Bacteria 192211
142 Ga0395898_0005516 3300037466 Bacteria 13655
143 Ga0395905_0027534 3300037471 Bacteria 5361
144 Ga0395905_0044975 3300037471 Bacteria 4141
145 Ga0395901_0004026 3300038443 Bacteria 14802
146 Ga0400484_00907 3300038725 Bacteria 4720
147 Ga0400484_03537 3300038725 Bacteria 7914
148 Ga0400490_14606 3300038726 Bacteria 18655
149 Ga0400491_19342 3300038727 Bacteria 17826
150 Ga0400483_132239 3300039062 Bacteria 3597
151 Ga0400483_215542 3300039062 Bacteria 14582
152 Ga0436361_0079343 3300039447 Bacteria 2519
153 Ga0436361_0388217 3300039447 Bacteria 8339
154 Ga0436361_0974442 3300039447 Bacteria 19775
155 Ga0436361_0991661 3300039447 Bacteria 6861
156 Ga0436361_1011934 3300039447 Bacteria 2392
157 Ga0439456_005568 3300042013 Bacteria 2558
158 Ga0450911_000022 3300042115 Bacteria 91239
159 Ga0450919_000455 3300042121 Bacteria 5085
160 Ga0450888_001281 3300042126 Bacteria 2399
161 Ga0450891_000277 3300042129 Bacteria 5194
162 Ga0450904_000091 3300042139 Bacteria 20642
163 Ga0439446_0000335 3300042156 Bacteria 9068
164 Ga0439446_0000932 3300042156 Bacteria 6317
165 Ga0439446_0025728 3300042156 Bacteria 1683
166 Ga0439459_0001610 3300042438 Bacteria 3362
167 Ga0439464_0010317 3300042439 Bacteria 2466
168 Ga0450918_000056 3300042531 Bacteria 22747
169 Ga0450893_0000263 3300042532 Bacteria 7129
170 Ga0450893_0000504 3300042532 Bacteria 5540
171 Ga0451577_0001066 3300042876 Bacteria 39535
172 Ga0451577_0008032 3300042876 Bacteria 10301
173 Ga0466969_0000001 3300044656 Bacteria 189617
174 Ga0466969_0006009 3300044656 Bacteria 6462
175 Ga0466969_0024424 3300044656 Bacteria 3109
176 Ga0466966_0106485 3300044684 Bacteria 1730
177 Ga0466961_0001897 3300044693 Bacteria 13019
178 Ga0466961_0011899 3300044693 Bacteria 5561
179 Ga0466961_0019347 3300044693 Bacteria 4380
180 Ga0466961_0042950 3300044693 Bacteria 2896
181 Ga0466963_0010562 3300044694 Bacteria 5595
182 Ga0453684_0000731 3300044712 Bacteria 115326
183 Ga0453684_0002022 3300044712 Bacteria 51826
184 Ga0453684_0003135 3300044712 Bacteria 38072
185 Ga0453684_0008015 3300044712 Bacteria 19121
186 Ga0453684_0017806 3300044712 Bacteria 10964
187 Ga0453684_0032051 3300044712 Bacteria 7368
188 Ga0453684_0034462 3300044712 Bacteria 7027
189 Ga0453684_0040533 3300044712 Bacteria 6321
190 Ga0453684_0041698 3300044712 Bacteria 6201
191 Ga0453684_0074103 3300044712 Bacteria 4288
192 Ga0453684_0127361 3300044712 Bacteria 3062
193 Ga0466971_0001184 3300044719 Bacteria 10826
194 Ga0466971_0016590 3300044719 Bacteria 3252
195 Ga0466970_0016056 3300044765 Bacteria 3855
196 Ga0466959_0001176 3300045049 Bacteria 15770
197 Ga0466959_0008453 3300045049 Bacteria 7280
198 Ga0466959_0008674 3300045049 Bacteria 7196
199 Ga0466959_0023676 3300045049 Bacteria 4545
200 Ga0466959_0035306 3300045049 Bacteria 3699
201 Ga0451576_0001688 3300045051 Bacteria 36559
202 Ga0451576_0002708 3300045051 Bacteria 25749
203 Ga0451576_0214498 3300045051 Bacteria 2010
204 Ga0466958_0020527 3300045836 Bacteria 3854
205 Ga0495592_0000387 3300046454 Bacteria 34389
206 Ga0495632_0002307 3300046519 Bacteria 14690
207 Ga0495632_0011298 3300046519 Bacteria 5219
208 Ga0495632_0024164 3300046519 Bacteria 3234
209 Ga0495654_0000238 3300046530 Bacteria 51636
210 Ga0495625_0003792 3300046660 Bacteria 14645
211 Ga0495670_0007194 3300046691 Bacteria 5477
212 Ga0495683_0002839 3300047323 Bacteria 10255
213 Ga0496104_0165939 3300048907 Bacteria 2118
214 Ga0496105_0044626 3300048908 Bacteria 3657
215 Ga0496113_0108795 3300048916 Bacteria 2155
216 Ga0496124_0036896 3300048927 Bacteria 4257
217 Ga0501265_001899 3300049762 Bacteria 2379
218 Ga0501226_000004 3300049853 Bacteria 284656
219 nmdc:mga00v17_7475_c1 3300050491 Bacteria 5833
220 nmdc:mga0k408_1853_c1 3300050493 Bacteria 11360
221 nmdc:mga0k408_9410_c1 3300050493 Bacteria 5266
222 nmdc:mga06z11_9506_c1 3300050494 Bacteria 4099
223 nmdc:mga04h51_17634_c1 3300050495 Bacteria 2091
224 nmdc:mga07m45_1432_c1 3300050496 Bacteria 10939
225 nmdc:mga07m45_345_c1 3300050496 Bacteria 18914
226 nmdc:mga07m45_513_c1 3300050496 Bacteria 16432
227 nmdc:mga07m45_6877_c1 3300050496 Bacteria 5785
228 Ga0500578_0000013 3300053086 Bacteria 185921
229 Ga0500646_0016280 3300053090 Bacteria 1941
230 Ga0500651_0003007 3300053093 Bacteria 9096
231 Ga0500628_002285 3300053129 Bacteria 3194
232 Ga0500652_000278 3300053131 Bacteria 19044
233 Ga0500622_0001029 3300053156 Bacteria 23369
234 Ga0500622_0009966 3300053156 Bacteria 5240
235 Ga0500587_000096 3300053739 Bacteria 7634
236 Ga0466962_0029030 3300061719 Bacteria 2647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0388217 Ga0436361_0388217_667_2127 458
2 3300026118 Ga0207675_100070591 Ga0207675_1000705913 468
3 3300042139 Ga0450904_000091 Ga0450904_000091_17859_19316 468
4 3300042013 Ga0439456_005568 Ga0439456_005568_787_2247 469
5 3300042115 Ga0450911_000022 Ga0450911_000022_69629_71089 469
6 3300042156 Ga0439446_0000932 Ga0439446_0000932_3554_5014 469
7 3300042532 Ga0450893_0000504 Ga0450893_0000504_3469_4929 469
8 3300049853 Ga0501226_000004 Ga0501226_000004_240292_241752 469
9 3300042156 Ga0439446_0000335 Ga0439446_0000335_7577_9043 470
10 3300044712 Ga0453684_0034462 Ga0453684_0034462_2711_4198 472
11 3300044712 Ga0453684_0127361 Ga0453684_0127361_878_2353 472
12 iso_pu_bacteria 2886848708 2886854103 472
13 3300044712 Ga0453684_0008015 Ga0453684_0008015_4407_5894 473
14 3300003322 rootL2_10001624 rootL2_1000162430 476
15 3300003775 Ga0055524_1000580 Ga0055524_100058026 476
16 3300003794 Ga0055531_10011339 Ga0055531_100113393 476
17 3300012497 Ga0157319_1000011 Ga0157319_100001138 476
18 3300039447 Ga0436361_0991661 Ga0436361_0991661_221_1681 479
19 iso_pu_bacteria 2831864461 2831869596 479
20 3300039447 Ga0436361_0079343 Ga0436361_0079343_47_1507 480
21 3300003215 JGI25153J46596_10002611 JGI25153J46596_100026116 482
22 3300009093 Ga0105240_10010061 Ga0105240_100100612 482
23 3300010375 Ga0105239_10028121 Ga0105239_100281215 482
24 3300025297 Ga0209758_1000078 Ga0209758_1000078157 482
25 3300025913 Ga0207695_10060082 Ga0207695_100600822 482
26 3300031241 Ga0265325_10058175 Ga0265325_100581752 482
27 3300037312 Ga0395899_0002939 Ga0395899_0002939_5088_6542 482
28 3300037418 Ga0395900_0001093 Ga0395900_0001093_10283_11737 482
29 3300037466 Ga0395898_0005516 Ga0395898_0005516_2929_4383 482
30 3300038443 Ga0395901_0004026 Ga0395901_0004026_3019_4473 482
31 3300038725 Ga0400484_00907 Ga0400484_00907_865_2319 482
32 3300038725 Ga0400484_03537 Ga0400484_03537_4292_5746 482
33 3300038726 Ga0400490_14606 Ga0400490_14606_6873_8327 482
34 3300038727 Ga0400491_19342 Ga0400491_19342_10317_11771 482
35 3300039062 Ga0400483_132239 Ga0400483_132239_1189_2643 482
36 3300039062 Ga0400483_215542 Ga0400483_215542_8875_10329 482
37 3300044656 Ga0466969_0024424 Ga0466969_0024424_1254_2702 482
38 3300045049 Ga0466959_0008453 Ga0466959_0008453_3453_4901 482
39 3300045049 Ga0466959_0008674 Ga0466959_0008674_1332_2780 482
40 iso_pu_bacteria 2808606373 2808906502 482
41 iso_pu_bacteria 2823421272 2823422083 482
42 3300003771 Ga0055526_1002682 Ga0055526_100268210 483
43 3300025273 Ga0209673_1010696 Ga0209673_10106963 483
44 3300025295 Ga0209564_1000005 Ga0209564_1000005549 483
45 3300046691 Ga0495670_0007194 Ga0495670_0007194_3800_5251 483
46 3300053156 Ga0500622_0009966 Ga0500622_0009966_3293_4744 483
47 3300009176 Ga0105242_10213106 Ga0105242_102131062 484
48 3300025934 Ga0207686_10012723 Ga0207686_100127235 484
49 3300025935 Ga0207709_10001749 Ga0207709_100017499 484
50 3300035691 Ga0373931_0017908 Ga0373931_0017908_1813_3297 484
51 3300044712 Ga0453684_0000731 Ga0453684_0000731_50784_52238 484
52 3300044712 Ga0453684_0002022 Ga0453684_0002022_18294_19799 484
53 3300044712 Ga0453684_0003135 Ga0453684_0003135_8968_10485 484
54 3300048907 Ga0496104_0165939 Ga0496104_0165939_582_2042 484
55 3300048908 Ga0496105_0044626 Ga0496105_0044626_1520_2980 484
56 3300028794 Ga0307515_10000282 Ga0307515_1000028289 485
57 3300031456 Ga0307513_10006752 Ga0307513_1000675210 485
58 3300031649 Ga0307514_10001033 Ga0307514_100010338 486
59 3300031649 Ga0307514_10001530 Ga0307514_1000153019 486
60 3300044693 Ga0466961_0042950 Ga0466961_0042950_918_2381 487
61 3300045049 Ga0466959_0001176 Ga0466959_0001176_5170_6633 487
62 iso_pu_bacteria 2585428057 2587730906 487
63 3300044712 Ga0453684_0040533 Ga0453684_0040533_2988_4484 488
64 iso_pu_bacteria 2551306416 2553007970 488
65 iso_pu_bacteria 2599185155 2599329946 488
66 iso_pu_bacteria 2860867994 2860871290 488
67 iso_pu_bacteria 2917832318 2917832562 488
68 iso_pu_bacteria 2923510766 2923515697 488
69 iso_pu_bacteria 2946006987 2946009671 488
70 3300013102 Ga0157371_10010366 Ga0157371_100103663 489
71 3300013105 Ga0157369_10007768 Ga0157369_100077686 489
72 3300021361 Ga0213872_10004024 Ga0213872_100040246 489
73 3300021361 Ga0213872_10061435 Ga0213872_100614352 489
74 3300033179 Ga0307507_10000140 Ga0307507_1000014066 489
75 3300039447 Ga0436361_0974442 Ga0436361_0974442_5567_7051 489
76 3300039447 Ga0436361_1011934 Ga0436361_1011934_96_1580 489
77 3300044693 Ga0466961_0011899 Ga0466961_0011899_788_2305 489
78 3300044712 Ga0453684_0032051 Ga0453684_0032051_2454_3965 489
79 3300044719 Ga0466971_0001184 Ga0466971_0001184_1266_2783 489
80 iso_pu_bacteria 2510065053 2510281878 489
81 iso_pu_bacteria 2510065055 2510291960 489
82 iso_pu_bacteria 2510065058 2510310026 489
83 iso_pu_bacteria 2585428062 2587754951 489
84 iso_pu_bacteria 2643221544 2643746241 489
85 iso_pu_bacteria 2773857672 2774129945 489
86 iso_pu_bacteria 2974298342 2974300325 489
87 iso_pu_bacteria 2984499530 2984502740 489
88 3300002705 JGI25156J39149_1001798 JGI25156J39149_10017983 490
89 3300002737 JGI25162J39368_1002094 JGI25162J39368_10020943 490
90 3300002738 JGI25154J39366_1003917 JGI25154J39366_10039172 490
91 3300002741 JGI25157J39369_1001643 JGI25157J39369_10016435 490
92 3300002772 JGI25164J39214_1000182 JGI25164J39214_100018224 490
93 3300003214 JGI25165J46597_1000272 JGI25165J46597_100027237 490
94 3300003316 rootH1_10001291 rootH1_100012918 490
95 3300003322 rootL2_10000467 rootL2_1000046716 490
96 3300003759 Ga0055525_1000494 Ga0055525_10004944 490
97 3300003760 Ga0055527_1000044 Ga0055527_10000444 490
98 3300003760 Ga0055527_1002946 Ga0055527_10029462 490
99 3300003761 Ga0055535_1000736 Ga0055535_10007367 490
100 3300003761 Ga0055535_1000746 Ga0055535_100074616 490
101 3300003761 Ga0055535_1001528 Ga0055535_10015283 490
102 3300003762 Ga0055542_1000108 Ga0055542_10001084 490
103 3300003762 Ga0055542_1000211 Ga0055542_100021110 490
104 3300003762 Ga0055542_1001187 Ga0055542_10011877 490
105 3300003763 Ga0055529_1000546 Ga0055529_100054622 490
106 3300003763 Ga0055529_1000564 Ga0055529_100056418 490
107 3300005435 Ga0070714_100002569 Ga0070714_1000025696 490
108 3300025228 Ga0209672_100024 Ga0209672_1000244 490
109 3300025228 Ga0209672_100098 Ga0209672_10009819 490
110 3300025228 Ga0209672_101535 Ga0209672_1015355 490
111 3300025230 Ga0209563_100067 Ga0209563_1000674 490
112 3300025231 Ga0207427_100095 Ga0207427_10009570 490
113 3300025233 Ga0209437_100209 Ga0209437_10020970 490
114 3300025242 Ga0209258_100047 Ga0209258_1000474 490
115 3300025242 Ga0209258_100055 Ga0209258_100055235 490
116 3300025242 Ga0209258_100135 Ga0209258_100135117 490
117 3300025246 Ga0209646_1001912 Ga0209646_10019122 490
118 3300025250 Ga0209026_1001138 Ga0209026_100113811 490
119 3300025254 Ga0209148_1000054 Ga0209148_10000544 490
120 3300025254 Ga0209148_1000058 Ga0209148_100005836 490
121 3300025254 Ga0209148_1000102 Ga0209148_1000102117 490
122 3300025256 Ga0209759_1004909 Ga0209759_10049094 490
123 3300025256 Ga0209759_1005587 Ga0209759_10055874 490
124 3300025261 Ga0209233_1000197 Ga0209233_100019770 490
125 3300025272 Ga0209455_1000018 Ga0209455_100001836 490
126 3300025272 Ga0209455_1000052 Ga0209455_10000524 490
127 3300025272 Ga0209455_1003685 Ga0209455_10036854 490
128 3300025929 Ga0207664_10048191 Ga0207664_100481912 490
129 3300037312 Ga0395899_0001036 Ga0395899_0001036_14565_16037 490
130 3300037466 Ga0395898_0000132 Ga0395898_0000132_28951_30423 490
131 3300037471 Ga0395905_0044975 Ga0395905_0044975_836_2308 490
132 3300042126 Ga0450888_001281 Ga0450888_001281_368_1840 490
133 3300042129 Ga0450891_000277 Ga0450891_000277_3641_5113 490
134 3300042438 Ga0439459_0001610 Ga0439459_0001610_761_2293 490
135 3300042532 Ga0450893_0000263 Ga0450893_0000263_790_2262 490
136 3300044656 Ga0466969_0006009 Ga0466969_0006009_895_2412 490
137 3300044684 Ga0466966_0106485 Ga0466966_0106485_184_1701 490
138 3300044693 Ga0466961_0001897 Ga0466961_0001897_4711_6183 490
139 3300045836 Ga0466958_0020527 Ga0466958_0020527_895_2412 490
140 3300050496 nmdc:mga07m45_345_c1 nmdc:mga07m45_345_c1_3915_5387 490
141 iso_pu_bacteria 2585428058 2587735762 490
142 iso_pu_bacteria 2643221592 2643970163 490
143 iso_pu_bacteria 2643221625 2644141170 490
144 iso_pu_bacteria 2643221648 2644274217 490
145 3300005616 Ga0068852_100002408 Ga0068852_1000024086 491
146 3300026142 Ga0207698_10014466 Ga0207698_100144663 491
147 3300042876 Ga0451577_0001066 Ga0451577_0001066_32452_33927 491
148 iso_pu_bacteria 2547132374 2548501684 491
149 iso_pu_bacteria 2588253510 2588293075 491
150 iso_pu_bacteria 2643221644 2644248530 491
151 iso_pu_bacteria 2643221717 2644645469 491
152 3300003316 rootH1_10002207 rootH1_1000220710 492
153 3300006058 Ga0075432_10000531 Ga0075432_100005317 492
154 3300027907 Ga0207428_10001871 Ga0207428_100018718 492
155 3300044719 Ga0466971_0016590 Ga0466971_0016590_601_2088 492
156 3300044765 Ga0466970_0016056 Ga0466970_0016056_2026_3513 492
157 3300045049 Ga0466959_0023676 Ga0466959_0023676_96_1583 492
158 3300046530 Ga0495654_0000238 Ga0495654_0000238_36969_38450 492
159 3300047323 Ga0495683_0002839 Ga0495683_0002839_7938_9419 492
160 3300048927 Ga0496124_0036896 Ga0496124_0036896_2755_4236 492
161 3300061719 Ga0466962_0029030 Ga0466962_0029030_1149_2636 492
162 iso_pu_bacteria 2919704043 2919707863 492
163 3300006028 Ga0070717_10151889 Ga0070717_101518892 493
164 3300006195 Ga0075366_10002070 Ga0075366_100020706 493
165 3300009036 Ga0105244_10014815 Ga0105244_100148152 493
166 3300025298 Ga0209050_1002477 Ga0209050_10024776 493
167 3300025303 Ga0209051_1019433 Ga0209051_10194332 493
168 3300025728 Ga0207655_1000059 Ga0207655_1000059201 493
169 3300028794 Ga0307515_10017078 Ga0307515_100170789 493
170 3300031456 Ga0307513_10053991 Ga0307513_100539913 493
171 3300031730 Ga0307516_10005067 Ga0307516_1000506712 493
172 3300046519 Ga0495632_0011298 Ga0495632_0011298_746_2227 493
173 3300046660 Ga0495625_0003792 Ga0495625_0003792_616_2097 493
174 3300049762 Ga0501265_001899 Ga0501265_001899_181_1662 493
175 3300050493 nmdc:mga0k408_1853_c1 nmdc:mga0k408_1853_c1_7056_8537 493
176 3300053739 Ga0500587_000096 Ga0500587_000096_5990_7471 493
177 3300003187 JGI25151J46595_10000484 JGI25151J46595_1000048439 494
178 3300006051 Ga0075364_10009370 Ga0075364_100093705 494
179 3300006058 Ga0075432_10000766 Ga0075432_100007667 494
180 3300006177 Ga0075362_10001247 Ga0075362_100012472 494
181 3300006178 Ga0075367_10013345 Ga0075367_100133454 494
182 3300006195 Ga0075366_10005381 Ga0075366_100053813 494
183 3300006195 Ga0075366_10005747 Ga0075366_100057473 494
184 3300006353 Ga0075370_10002803 Ga0075370_100028033 494
185 3300006353 Ga0075370_10004958 Ga0075370_100049584 494
186 3300009148 Ga0105243_10000697 Ga0105243_100006975 494
187 3300025258 Ga0209129_1000651 Ga0209129_100065123 494
188 3300025273 Ga0209673_1014953 Ga0209673_10149531 494
189 3300025294 Ga0209025_1000207 Ga0209025_100020771 494
190 3300025935 Ga0207709_10008254 Ga0207709_100082546 494
191 3300027866 Ga0209813_10003758 Ga0209813_100037584 494
192 3300037471 Ga0395905_0027534 Ga0395905_0027534_1145_2629 494
193 3300044656 Ga0466969_0000001 Ga0466969_0000001_176121_177605 494
194 3300044693 Ga0466961_0019347 Ga0466961_0019347_229_1713 494
195 3300045049 Ga0466959_0035306 Ga0466959_0035306_1173_2657 494
196 3300050491 nmdc:mga00v17_7475_c1 nmdc:mga00v17_7475_c1_3155_4639 494
197 3300050494 nmdc:mga06z11_9506_c1 nmdc:mga06z11_9506_c1_1843_3327 494
198 3300050495 nmdc:mga04h51_17634_c1 nmdc:mga04h51_17634_c1_306_1790 494
199 3300050496 nmdc:mga07m45_513_c1 nmdc:mga07m45_513_c1_3642_5126 494
200 3300050496 nmdc:mga07m45_6877_c1 nmdc:mga07m45_6877_c1_3145_4629 494
201 3300053086 Ga0500578_0000013 Ga0500578_0000013_96235_97719 494
202 3300053090 Ga0500646_0016280 Ga0500646_0016280_153_1637 494
203 3300053156 Ga0500622_0001029 Ga0500622_0001029_8481_9965 494
204 3300002773 JGI25152J39213_1004790 JGI25152J39213_10047904 495
205 3300003215 JGI25153J46596_10000338 JGI25153J46596_1000033827 495
206 3300003323 rootH1_10002449 rootH1_1000244912 495
207 3300003323 rootH1_10044720 rootH1_100447203 495
208 3300003771 Ga0055526_1011167 Ga0055526_10111674 495
209 3300004625 Ga0055543_1001809 Ga0055543_10018093 495
210 3300005262 Ga0065165_1000024 Ga0065165_1000024176 495
211 3300005459 Ga0068867_100022031 Ga0068867_1000220312 495
212 3300006195 Ga0075366_10017997 Ga0075366_100179972 495
213 3300006944 Ga0099823_1000002 Ga0099823_100000212 495
214 3300025258 Ga0209129_1000122 Ga0209129_100012243 495
215 3300025273 Ga0209673_1003651 Ga0209673_10036513 495
216 3300025295 Ga0209564_1000266 Ga0209564_100026672 495
217 3300025297 Ga0209758_1000091 Ga0209758_100009165 495
218 3300025299 Ga0209256_1000659 Ga0209256_100065913 495
219 3300025303 Ga0209051_1003283 Ga0209051_10032839 495
220 3300025304 Ga0209257_1001562 Ga0209257_10015623 495
221 3300026116 Ga0207674_10067465 Ga0207674_100674652 495
222 3300027296 Ga0209389_1000340 Ga0209389_100034023 495
223 3300027876 Ga0209974_10005570 Ga0209974_100055703 495
224 3300028786 Ga0307517_10001740 Ga0307517_1000174016 495
225 3300028794 Ga0307515_10000837 Ga0307515_1000083734 495
226 3300028794 Ga0307515_10001476 Ga0307515_1000147640 495
227 3300028794 Ga0307515_10031199 Ga0307515_100311993 495
228 3300031507 Ga0307509_10001779 Ga0307509_100017797 495
229 3300031507 Ga0307509_10001917 Ga0307509_1000191725 495
230 3300031507 Ga0307509_10016276 Ga0307509_100162765 495
231 3300031507 Ga0307509_10044938 Ga0307509_100449383 495
232 3300031616 Ga0307508_10000016 Ga0307508_10000016120 495
233 3300031616 Ga0307508_10001829 Ga0307508_100018296 495
234 3300031616 Ga0307508_10069963 Ga0307508_100699632 495
235 3300031649 Ga0307514_10126962 Ga0307514_101269622 495
236 3300033180 Ga0307510_10127926 Ga0307510_101279262 495
237 3300042121 Ga0450919_000455 Ga0450919_000455_3316_4803 495
238 3300042156 Ga0439446_0025728 Ga0439446_0025728_17_1504 495
239 3300042531 Ga0450918_000056 Ga0450918_000056_9808_11295 495
240 3300044694 Ga0466963_0010562 Ga0466963_0010562_3952_5463 495
241 3300044712 Ga0453684_0017806 Ga0453684_0017806_228_1715 495
242 3300045051 Ga0451576_0001688 Ga0451576_0001688_6773_8260 495
243 3300045051 Ga0451576_0214498 Ga0451576_0214498_142_1629 495
244 3300046454 Ga0495592_0000387 Ga0495592_0000387_4754_6241 495
245 3300046519 Ga0495632_0002307 Ga0495632_0002307_3505_5001 495
246 3300046519 Ga0495632_0024164 Ga0495632_0024164_1085_2572 495
247 3300048916 Ga0496113_0108795 Ga0496113_0108795_79_1596 495
248 3300050496 nmdc:mga07m45_1432_c1 nmdc:mga07m45_1432_c1_3219_4706 495
249 3300053093 Ga0500651_0003007 Ga0500651_0003007_542_2038 495
250 3300053129 Ga0500628_002285 Ga0500628_002285_241_1737 495
251 3300053131 Ga0500652_000278 Ga0500652_000278_4828_6324 495
252 3300006038 Ga0075365_10017379 Ga0075365_100173793 496
253 3300009148 Ga0105243_10003002 Ga0105243_100030029 496
254 3300032002 Ga0307416_100002714 Ga0307416_1000027145 496
255 3300042439 Ga0439464_0010317 Ga0439464_0010317_731_2221 496
256 3300050493 nmdc:mga0k408_9410_c1 nmdc:mga0k408_9410_c1_2667_4157 496
257 3300001979 JGI24740J21852_10000726 JGI24740J21852_100007266 497
258 3300025960 Ga0207651_10130065 Ga0207651_101300652 497
259 3300031548 Ga0307408_100000219 Ga0307408_10000021940 497
260 3300031901 Ga0307406_10000604 Ga0307406_1000060414 497
261 3300042876 Ga0451577_0008032 Ga0451577_0008032_2055_3563 497
262 3300044712 Ga0453684_0041698 Ga0453684_0041698_1635_3143 497
263 3300044712 Ga0453684_0074103 Ga0453684_0074103_2077_3585 497
264 3300045051 Ga0451576_0002708 Ga0451576_0002708_1632_3140 497

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

88

494

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g1f-assembly3.cif.gz_E crystal structure of d-phenylglycine aninotransferase (d-phgat) from pseudomonas stutzeri with plp internal aldimine 0.8886 50 492
2hp1-assembly1.cif.gz_B inter-subunit signaling in gsam 0.8854 58 493
2hoy-assembly1.cif.gz_A inter-subunit signaling in gsam 0.8851 58 493
2cfb-assembly1.cif.gz_A-2 glutamate-1-semialdehyde 2,1-aminomutase from thermosynechococcus elongatus 0.8851 87 493
4e77-assembly1.cif.gz_A-2 2.0a crystal structure of a glutamate-1-semialdehyde aminotransferase from yersinia pestis co92 0.8844 60 493
ID Description Score Start End Superfamily
6dvsA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9158 123 375 3.40.640.10
4e77A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9128 123 375 3.40.640.10
6dvsA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8991 123 375 3.40.640.10
4e77A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8969 123 375 3.40.640.10
af_O94492_88_328_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8958 122 375 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A0J6FU68-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (Glutamate-1-semialdehyde aminotransferase) 0.9682 16 493 GO:0008483
GO:0030170
AF-A0A0J6FU68-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (Glutamate-1-semialdehyde aminotransferase) 0.9584 16 493 GO:0008483
GO:0030170
AF-A0A3D2TPH4-F1-model_v4 Aspartate aminotransferase family protein 0.9564 13 492 GO:0008483
GO:0030170
AF-A0A3N5S519-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9526 25 492 GO:0008483
GO:0030170
AF-A0A7X8HRL4-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9517 220 493 GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
79.76 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map