F372791

General Info

Members Datasets Scaffolds Average Seq Length
264 166 259 161

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_1760604|Ga0453684_1760604_108_590
Length 160
Sequence MFNMKFYDFIVKGRAGEDVSLSTYKGKVLLVVNTATGCGFTPQYEGLQKLYDTHKDKGFEILDFPCNQFANQAPGTIDEIQSFCTLNYGTTFPRFAKVDVNGKNASDLFKFLKKEKKAMLGSSIKWNFTKFLIDREGNVVKRFAPTDTPESIENDILALL

Samples

Sample ID Description Type Environment
1 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
2 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
3 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
4 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
5 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
52 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
53 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
103 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0.38
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 3.03
Rhizoplane 1.52
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1017803 3300001915 Bacteria 1143
2 JGI24740J21852_10027576 3300001979 Bacteria 1888
3 JGI25153J46596_10016912 3300003215 Bacteria 2896
4 rootH1_10071887 3300003316 Bacteria 3295
5 Ga0055530_10000740 3300003791 Bacteria 27171
6 Ga0055531_10000966 3300003794 Bacteria 23016
7 Ga0065165_1000277 3300005262 Bacteria 87540
8 Ga0070658_10003021 3300005327 Bacteria 13917
9 Ga0070658_10073678 3300005327 Bacteria 2800
10 Ga0070658_10282805 3300005327 Bacteria 1412
11 Ga0070658_10784911 3300005327 Bacteria 827
12 Ga0070683_100046850 3300005329 Bacteria 3995
13 Ga0070683_100097053 3300005329 Bacteria 2772
14 Ga0070680_100000239 3300005336 Bacteria 36253
15 Ga0070680_100080800 3300005336 Bacteria 2681
16 Ga0070680_100133209 3300005336 Bacteria 2080
17 Ga0070660_100072587 3300005339 Bacteria 2690
18 Ga0070691_10011694 3300005341 Bacteria 4014
19 Ga0070691_10172543 3300005341 Bacteria 1121
20 Ga0070661_100037635 3300005344 Bacteria 3520
21 Ga0070692_10016497 3300005345 Bacteria 3513
22 Ga0070692_10027670 3300005345 Bacteria 2812
23 Ga0070659_100139619 3300005366 Bacteria 1972
24 Ga0070659_100297372 3300005366 Bacteria 1345
25 Ga0070705_101376934 3300005440 Bacteria 587
26 Ga0070663_100002008 3300005455 Bacteria 11363
27 Ga0070681_10000008 3300005458 Bacteria 151355
28 Ga0070681_10000066 3300005458 Bacteria 75733
29 Ga0070681_10166741 3300005458 Bacteria 2125
30 Ga0070681_10630803 3300005458 Bacteria 986
31 Ga0070679_100000195 3300005530 Bacteria 49445
32 Ga0070679_100376006 3300005530 Bacteria 1367
33 Ga0070679_100901845 3300005530 Bacteria 827
34 Ga0070684_100303052 3300005535 Bacteria 1466
35 Ga0068853_100134281 3300005539 Bacteria 2217
36 Ga0070696_100427899 3300005546 Bacteria 1041
37 Ga0070665_100008829 3300005548 Bacteria 10203
38 Ga0068855_100040747 3300005563 Bacteria 5510
39 Ga0068855_100052437 3300005563 Bacteria 4802
40 Ga0068855_100490379 3300005563 Bacteria 1336
41 Ga0070664_100085364 3300005564 Bacteria 2726
42 Ga0068857_100094227 3300005577 Bacteria 2681
43 Ga0068854_100038243 3300005578 Bacteria 3373
44 Ga0068854_100179631 3300005578 Bacteria 1652
45 Ga0068856_100221524 3300005614 Bacteria 1907
46 Ga0070702_100500925 3300005615 Bacteria 892
47 Ga0068852_100058812 3300005616 Bacteria 3331
48 Ga0068852_100197720 3300005616 Bacteria 1901
49 Ga0068864_100794968 3300005618 Bacteria 929
50 Ga0068851_10714176 3300005834 Bacteria 618
51 Ga0068863_101157575 3300005841 Bacteria 779
52 Ga0068858_100575128 3300005842 Bacteria 1092
53 Ga0068858_100751651 3300005842 Bacteria 950
54 Ga0068862_101316171 3300005844 Bacteria 724
55 Ga0081455_10120650 3300005937 Bacteria 2066
56 Ga0075365_11038839 3300006038 Bacteria 577
57 Ga0079104_1000148 3300006946 Bacteria 98364
58 Ga0079104_1000701 3300006946 Bacteria 30504
59 Ga0079104_1020620 3300006946 Bacteria 1811
60 Ga0079104_1051182 3300006946 Bacteria 919
61 Ga0105240_10082923 3300009093 Bacteria 3936
62 Ga0105240_10108871 3300009093 Bacteria 3356
63 Ga0105240_10153633 3300009093 Bacteria 2739
64 Ga0105240_10368440 3300009093 Bacteria 1625
65 Ga0105240_10853169 3300009093 Bacteria 983
66 Ga0105241_10673378 3300009174 Bacteria 942
67 Ga0105241_11047044 3300009174 Bacteria 766
68 Ga0105242_10119333 3300009176 Bacteria 2261
69 Ga0105248_10003505 3300009177 Bacteria 17414
70 Ga0105237_10039588 3300009545 Bacteria 4759
71 Ga0105238_10026712 3300009551 Bacteria 5885
72 Ga0105238_10080207 3300009551 Bacteria 3253
73 Ga0105249_10008497 3300009553 Bacteria 8949
74 Ga0157321_1004292 3300012487 Bacteria 890
75 Ga0157329_1029825 3300012491 Bacteria 561
76 Ga0157326_1008952 3300012513 Bacteria 1095
77 Ga0157373_10056498 3300013100 Bacteria 2787
78 Ga0157373_10066585 3300013100 Bacteria 2548
79 Ga0157373_10236665 3300013100 Bacteria 1290
80 Ga0157371_10053696 3300013102 Bacteria 2862
81 Ga0157371_10199543 3300013102 Bacteria 1434
82 Ga0157371_10677899 3300013102 Bacteria 771
83 Ga0157370_10003399 3300013104 Bacteria 18693
84 Ga0157370_10018257 3300013104 Bacteria 7054
85 Ga0157370_10036767 3300013104 Bacteria 4750
86 Ga0157370_10057881 3300013104 Bacteria 3684
87 Ga0157370_10339091 3300013104 Bacteria 1385
88 Ga0157370_10352817 3300013104 Bacteria 1356
89 Ga0157369_10079051 3300013105 Bacteria 3523
90 Ga0163162_10300248 3300013306 Bacteria 1738
91 Ga0163162_10462237 3300013306 Bacteria 1401
92 Ga0157372_10020057 3300013307 Bacteria 7209
93 Ga0157372_10230188 3300013307 Bacteria 2148
94 Ga0157372_10241676 3300013307 Bacteria 2095
95 Ga0157372_11281838 3300013307 Bacteria 846
96 Ga0157380_10309568 3300014326 Bacteria 1459
97 Ga0163161_10021750 3300017792 Bacteria 4510
98 Ga0163161_10174141 3300017792 Bacteria 1647
99 Ga0154015_1114383 3300020610 Bacteria 1257
100 Ga0209758_1001863 3300025297 Bacteria 23117
101 Ga0209050_1000200 3300025298 Bacteria 134115
102 Ga0209257_1000225 3300025304 Bacteria 134023
103 Ga0207647_10002914 3300025904 Bacteria 12881
104 Ga0207705_10004376 3300025909 Bacteria 10676
105 Ga0207705_10005548 3300025909 Bacteria 9434
106 Ga0207705_10147861 3300025909 Bacteria 1759
107 Ga0207705_10172411 3300025909 Bacteria 1629
108 Ga0207654_10785797 3300025911 Bacteria 687
109 Ga0207707_10000068 3300025912 Bacteria 103683
110 Ga0207707_10000442 3300025912 Bacteria 43048
111 Ga0207707_10042206 3300025912 Bacteria 3982
112 Ga0207707_10061429 3300025912 Bacteria 3269
113 Ga0207707_10333569 3300025912 Bacteria 1308
114 Ga0207707_10870985 3300025912 Bacteria 746
115 Ga0207695_10033314 3300025913 Bacteria 5621
116 Ga0207695_10094558 3300025913 Bacteria 2995
117 Ga0207695_10838138 3300025913 Bacteria 799
118 Ga0207671_10272604 3300025914 Bacteria 1333
119 Ga0207660_10000253 3300025917 Bacteria 34842
120 Ga0207660_10000502 3300025917 Bacteria 26090
121 Ga0207660_10055376 3300025917 Bacteria 2834
122 Ga0207660_10682631 3300025917 Bacteria 838
123 Ga0207657_10080408 3300025919 Bacteria 2739
124 Ga0207657_10083281 3300025919 Bacteria 2684
125 Ga0207649_10012812 3300025920 Bacteria 4665
126 Ga0207652_10000081 3300025921 Bacteria 103132
127 Ga0207652_10010550 3300025921 Bacteria 7436
128 Ga0207652_10051556 3300025921 Bacteria 3528
129 Ga0207652_10271627 3300025921 Bacteria 1529
130 Ga0207694_10008985 3300025924 Bacteria 7544
131 Ga0207694_10034284 3300025924 Bacteria 3892
132 Ga0207690_10009020 3300025932 Bacteria 5919
133 Ga0207690_10033331 3300025932 Bacteria 3312
134 Ga0207690_10265996 3300025932 Bacteria 1330
135 Ga0207686_10188671 3300025934 Bacteria 1468
136 Ga0207661_10030130 3300025944 Bacteria 4175
137 Ga0207679_10121201 3300025945 Bacteria 2082
138 Ga0207667_10001214 3300025949 Bacteria 32246
139 Ga0207667_10007552 3300025949 Bacteria 13046
140 Ga0207667_10012474 3300025949 Bacteria 9788
141 Ga0207712_10011103 3300025961 Bacteria 5733
142 Ga0207640_10061246 3300025981 Bacteria 2492
143 Ga0207640_10199176 3300025981 Bacteria 1516
144 Ga0207703_11587266 3300026035 Bacteria 629
145 Ga0207639_10021947 3300026041 Bacteria 4592
146 Ga0207678_10075764 3300026067 Bacteria 2882
147 Ga0207678_10086166 3300026067 Bacteria 2684
148 Ga0207702_10039782 3300026078 Bacteria 3941
149 Ga0207641_11278276 3300026088 Bacteria 734
150 Ga0207676_10709929 3300026095 Bacteria 975
151 Ga0207674_10113369 3300026116 Bacteria 2684
152 Ga0207698_10002064 3300026142 Bacteria 11849
153 Ga0209281_1000099 3300027111 Bacteria 225337
154 Ga0209281_1000140 3300027111 Bacteria 178506
155 Ga0209281_1019306 3300027111 Bacteria 1349
156 Ga0209281_1025346 3300027111 Bacteria 1105
157 Ga0268266_10007614 3300028379 Bacteria 9748
158 Ga0268265_10946641 3300028380 Bacteria 848
159 Ga0307508_10005455 3300031616 Bacteria 12092
160 Ga0307410_10416385 3300031852 Bacteria 1089
161 Ga0307414_10484947 3300032004 Bacteria 1091
162 Ga0307414_11290027 3300032004 Bacteria 677
163 Ga0307411_10738258 3300032005 Bacteria 861
164 Ga0395900_0005289 3300037418 Bacteria 13531
165 Ga0395900_0107061 3300037418 Bacteria 2872
166 Ga0395898_0440537 3300037466 Bacteria 1241
167 Ga0395901_0034161 3300038443 Bacteria 5251
168 Ga0451795_0861012 3300041456 Bacteria 940
169 Ga0451835_1024061 3300041492 Bacteria 539
170 Ga0451843_1069097 3300041509 Bacteria 1021
171 Ga0439432_023687 3300042006 Bacteria 2021
172 Ga0451577_0022765 3300042876 Bacteria 5720
173 Ga0466969_0004888 3300044656 Bacteria 7138
174 Ga0453683_0676691 3300044673 Bacteria 675
175 Ga0466966_0081019 3300044684 Bacteria 2021
176 Ga0466961_0000708 3300044693 Bacteria 20977
177 Ga0466964_0000409 3300044706 Bacteria 12991
178 Ga0453684_1607701 3300044712 Bacteria 667
179 Ga0453684_1760604 3300044712 Bacteria 631
180 Ga0466971_0038417 3300044719 Bacteria 2148
181 Ga0466970_0163513 3300044765 Bacteria 1231
182 Ga0466957_0187626 3300044842 Bacteria 1353
183 Ga0466959_0093346 3300045049 Bacteria 2159
184 Ga0451576_0257430 3300045051 Bacteria 1824
185 Ga0466958_0074924 3300045836 Bacteria 2075
186 Ga0466967_0485525 3300045976 Bacteria 1211
187 Ga0495627_012245 3300046453 Bacteria 3051
188 Ga0495627_184855 3300046453 Bacteria 576
189 Ga0495638_0017177 3300046460 Bacteria 4832
190 Ga0495664_0026901 3300046477 Bacteria 3352
191 Ga0495620_0166294 3300046515 Bacteria 856
192 Ga0495643_0032968 3300046522 Bacteria 2870
193 Ga0495663_0006824 3300046525 Bacteria 3150
194 Ga0495654_0019544 3300046530 Bacteria 3543
195 Ga0495654_0182487 3300046530 Bacteria 908
196 Ga0495609_0094298 3300046538 Bacteria 1300
197 Ga0495645_0155677 3300046543 Bacteria 1583
198 Ga0495633_0167653 3300046558 Bacteria 1012
199 Ga0495625_0064727 3300046660 Bacteria 2579
200 Ga0495625_0248801 3300046660 Bacteria 1154
201 Ga0495599_0702068 3300046678 Bacteria 583
202 Ga0495646_0145978 3300046680 Bacteria 1319
203 Ga0495600_0185186 3300046809 Bacteria 1341
204 Ga0495672_0001742 3300047320 Bacteria 21008
205 Ga0495672_0002675 3300047320 Bacteria 16052
206 Ga0495672_0049093 3300047320 Bacteria 2499
207 Ga0495686_0088736 3300047472 Bacteria 1879
208 Ga0495593_0179273 3300047673 Bacteria 1067
209 Ga0496104_0315832 3300048907 Bacteria 1475
210 Ga0496112_1590324 3300048915 Bacteria 567
211 Ga0496113_0620448 3300048916 Bacteria 865
212 Ga0496116_0167940 3300048919 Bacteria 1193
213 Ga0496117_0005378 3300048920 Bacteria 13483
214 Ga0496117_0084049 3300048920 Bacteria 2078
215 Ga0496118_0005983 3300048921 Bacteria 13577
216 Ga0496118_0091645 3300048921 Bacteria 2089
217 Ga0496118_0097482 3300048921 Bacteria 2000
218 Ga0496121_0038214 3300048924 Bacteria 4255
219 Ga0496122_0027811 3300048925 Bacteria 4821
220 Ga0496122_0089971 3300048925 Bacteria 2096
221 Ga0496123_0041065 3300048926 Bacteria 3212
222 Ga0496123_0087689 3300048926 Bacteria 1860
223 Ga0496124_0002663 3300048927 Bacteria 22910
224 Ga0496124_0071021 3300048927 Bacteria 2887
225 Ga0496124_0188345 3300048927 Bacteria 1581
226 Ga0496124_0193956 3300048927 Bacteria 1551
227 Ga0496124_0347428 3300048927 Bacteria 1050
228 Ga0496124_0552954 3300048927 Bacteria 759
229 Ga0496125_0189579 3300048928 Bacteria 1359
230 Ga0496126_0000056 3300048929 Bacteria 286295
231 Ga0496126_0396036 3300048929 Bacteria 1121
232 Ga0496126_0493384 3300048929 Bacteria 980
233 Ga0501031_0215447 3300049568 Bacteria 1251
234 Ga0501033_0044565 3300049570 Bacteria 3302
235 Ga0501037_0099403 3300049573 Bacteria 2101
236 Ga0501038_0137470 3300049574 Bacteria 2001
237 Ga0501047_0006075 3300049581 Bacteria 11350
238 Ga0501047_0040320 3300049581 Bacteria 4516
239 Ga0501069_0024424 3300049585 Bacteria 3296
240 Ga0501069_0069973 3300049585 Bacteria 1965
241 Ga0501069_0171967 3300049585 Bacteria 1250
242 Ga0501070_0097600 3300049586 Bacteria 2430
243 Ga0501070_0115830 3300049586 Bacteria 2213
244 Ga0501070_0477112 3300049586 Bacteria 1003
245 Ga0501071_0001798 3300049587 Bacteria 12670
246 Ga0501073_0015014 3300049589 Bacteria 5618
247 Ga0501074_0011401 3300049590 Bacteria 6462
248 Ga0501074_0024394 3300049590 Bacteria 4395
249 Ga0501076_0765582 3300049592 Bacteria 797
250 Ga0501079_0207879 3300049741 Bacteria 1529
251 Ga0501079_0373864 3300049741 Bacteria 1117
252 Ga0501080_0130738 3300049742 Bacteria 2324
253 Ga0501080_0157109 3300049742 Bacteria 2100
254 Ga0501083_0671676 3300049744 Bacteria 674
255 Ga0501035_1034953 3300049822 Bacteria 644
256 Ga0501044_0007834 3300049823 Bacteria 11743
257 Ga0501044_0117207 3300049823 Bacteria 2667
258 Ga0500626_062979 3300053128 Bacteria 1657
259 Ga0466962_0000339 3300061719 Bacteria 20068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0315832 Ga0496104_0315832_360_818 152
2 iso_pu_bacteria 2923525760 2923528686 154
3 iso_pu_bacteria 2576861471 2578457805 156
4 iso_pu_bacteria 2857442823 2857446690 156
5 iso_pu_bacteria 2919688452 2919691491 156
6 iso_pu_bacteria 2939622612 2939625512 156
7 3300006946 Ga0079104_1000148 Ga0079104_100014823 157
8 3300009176 Ga0105242_10119333 Ga0105242_101193334 157
9 3300025934 Ga0207686_10188671 Ga0207686_101886712 157
10 3300027111 Ga0209281_1000140 Ga0209281_100014076 157
11 3300044712 Ga0453684_1607701 Ga0453684_1607701_179_652 157
12 3300044712 Ga0453684_1760604 Ga0453684_1760604_108_590 157
13 3300045051 Ga0451576_0257430 Ga0451576_0257430_446_919 157
14 3300005458 Ga0070681_10630803 Ga0070681_106308031 158
15 3300006946 Ga0079104_1000701 Ga0079104_100070112 158
16 3300006946 Ga0079104_1020620 Ga0079104_10206202 158
17 3300006946 Ga0079104_1051182 Ga0079104_10511821 158
18 3300013100 Ga0157373_10236665 Ga0157373_102366651 158
19 3300025912 Ga0207707_10870985 Ga0207707_108709851 158
20 3300025921 Ga0207652_10271627 Ga0207652_102716272 158
21 3300027111 Ga0209281_1000099 Ga0209281_100009979 158
22 3300027111 Ga0209281_1019306 Ga0209281_10193061 158
23 3300027111 Ga0209281_1025346 Ga0209281_10253462 158
24 3300041456 Ga0451795_0861012 Ga0451795_0861012_21_497 158
25 3300046515 Ga0495620_0166294 Ga0495620_0166294_275_814 158
26 3300046530 Ga0495654_0019544 Ga0495654_0019544_2739_3278 158
27 3300048929 Ga0496126_0000056 Ga0496126_0000056_241630_242166 158
28 3300001979 JGI24740J21852_10027576 JGI24740J21852_100275761 159
29 3300003215 JGI25153J46596_10016912 JGI25153J46596_100169122 159
30 3300003316 rootH1_10071887 rootH1_100718872 159
31 3300003791 Ga0055530_10000740 Ga0055530_1000074018 159
32 3300003794 Ga0055531_10000966 Ga0055531_100009667 159
33 3300005262 Ga0065165_1000277 Ga0065165_100027715 159
34 3300005327 Ga0070658_10003021 Ga0070658_100030214 159
35 3300005327 Ga0070658_10073678 Ga0070658_100736781 159
36 3300005327 Ga0070658_10282805 Ga0070658_102828052 159
37 3300005327 Ga0070658_10784911 Ga0070658_107849112 159
38 3300005329 Ga0070683_100046850 Ga0070683_1000468502 159
39 3300005336 Ga0070680_100000239 Ga0070680_10000023925 159
40 3300005336 Ga0070680_100080800 Ga0070680_1000808002 159
41 3300005339 Ga0070660_100072587 Ga0070660_1000725873 159
42 3300005341 Ga0070691_10011694 Ga0070691_100116943 159
43 3300005344 Ga0070661_100037635 Ga0070661_1000376353 159
44 3300005345 Ga0070692_10016497 Ga0070692_100164973 159
45 3300005345 Ga0070692_10027670 Ga0070692_100276702 159
46 3300005366 Ga0070659_100139619 Ga0070659_1001396192 159
47 3300005366 Ga0070659_100297372 Ga0070659_1002973721 159
48 3300005440 Ga0070705_101376934 Ga0070705_1013769341 159
49 3300005455 Ga0070663_100002008 Ga0070663_1000020082 159
50 3300005458 Ga0070681_10000008 Ga0070681_1000000846 159
51 3300005458 Ga0070681_10000066 Ga0070681_1000006610 159
52 3300005530 Ga0070679_100000195 Ga0070679_10000019525 159
53 3300005530 Ga0070679_100901845 Ga0070679_1009018452 159
54 3300005535 Ga0070684_100303052 Ga0070684_1003030522 159
55 3300005539 Ga0068853_100134281 Ga0068853_1001342812 159
56 3300005546 Ga0070696_100427899 Ga0070696_1004278991 159
57 3300005563 Ga0068855_100040747 Ga0068855_1000407476 159
58 3300005563 Ga0068855_100052437 Ga0068855_1000524373 159
59 3300005563 Ga0068855_100490379 Ga0068855_1004903791 159
60 3300005564 Ga0070664_100085364 Ga0070664_1000853642 159
61 3300005577 Ga0068857_100094227 Ga0068857_1000942273 159
62 3300005578 Ga0068854_100038243 Ga0068854_1000382433 159
63 3300005578 Ga0068854_100179631 Ga0068854_1001796312 159
64 3300005614 Ga0068856_100221524 Ga0068856_1002215242 159
65 3300005616 Ga0068852_100058812 Ga0068852_1000588122 159
66 3300005616 Ga0068852_100197720 Ga0068852_1001977203 159
67 3300005834 Ga0068851_10714176 Ga0068851_107141761 159
68 3300005842 Ga0068858_100575128 Ga0068858_1005751281 159
69 3300005937 Ga0081455_10120650 Ga0081455_101206502 159
70 3300009093 Ga0105240_10108871 Ga0105240_101088712 159
71 3300009093 Ga0105240_10153633 Ga0105240_101536333 159
72 3300009093 Ga0105240_10368440 Ga0105240_103684402 159
73 3300009093 Ga0105240_10853169 Ga0105240_108531692 159
74 3300009177 Ga0105248_10003505 Ga0105248_100035051 159
75 3300009545 Ga0105237_10039588 Ga0105237_100395882 159
76 3300009551 Ga0105238_10026712 Ga0105238_100267125 159
77 3300012487 Ga0157321_1004292 Ga0157321_10042921 159
78 3300012491 Ga0157329_1029825 Ga0157329_10298251 159
79 3300012513 Ga0157326_1008952 Ga0157326_10089522 159
80 3300013100 Ga0157373_10056498 Ga0157373_100564983 159
81 3300013100 Ga0157373_10066585 Ga0157373_100665852 159
82 3300013102 Ga0157371_10053696 Ga0157371_100536963 159
83 3300013102 Ga0157371_10199543 Ga0157371_101995431 159
84 3300013102 Ga0157371_10677899 Ga0157371_106778991 159
85 3300013104 Ga0157370_10003399 Ga0157370_1000339913 159
86 3300013104 Ga0157370_10057881 Ga0157370_100578813 159
87 3300013104 Ga0157370_10339091 Ga0157370_103390911 159
88 3300013104 Ga0157370_10352817 Ga0157370_103528172 159
89 3300013105 Ga0157369_10079051 Ga0157369_100790513 159
90 3300013306 Ga0163162_10462237 Ga0163162_104622372 159
91 3300013307 Ga0157372_10020057 Ga0157372_100200574 159
92 3300013307 Ga0157372_10230188 Ga0157372_102301883 159
93 3300013307 Ga0157372_10241676 Ga0157372_102416762 159
94 3300013307 Ga0157372_11281838 Ga0157372_112818382 159
95 3300014326 Ga0157380_10309568 Ga0157380_103095682 159
96 3300020610 Ga0154015_1114383 Ga0154015_11143832 159
97 3300025297 Ga0209758_1001863 Ga0209758_10018637 159
98 3300025298 Ga0209050_1000200 Ga0209050_100020019 159
99 3300025304 Ga0209257_1000225 Ga0209257_100022519 159
100 3300025904 Ga0207647_10002914 Ga0207647_100029141 159
101 3300025909 Ga0207705_10004376 Ga0207705_100043763 159
102 3300025909 Ga0207705_10005548 Ga0207705_100055483 159
103 3300025909 Ga0207705_10147861 Ga0207705_101478612 159
104 3300025909 Ga0207705_10172411 Ga0207705_101724112 159
105 3300025912 Ga0207707_10000068 Ga0207707_1000006886 159
106 3300025912 Ga0207707_10000442 Ga0207707_100004422 159
107 3300025912 Ga0207707_10061429 Ga0207707_100614293 159
108 3300025912 Ga0207707_10333569 Ga0207707_103335691 159
109 3300025913 Ga0207695_10033314 Ga0207695_100333143 159
110 3300025913 Ga0207695_10838138 Ga0207695_108381381 159
111 3300025914 Ga0207671_10272604 Ga0207671_102726042 159
112 3300025917 Ga0207660_10000502 Ga0207660_100005027 159
113 3300025917 Ga0207660_10055376 Ga0207660_100553763 159
114 3300025917 Ga0207660_10682631 Ga0207660_106826312 159
115 3300025919 Ga0207657_10080408 Ga0207657_100804083 159
116 3300025919 Ga0207657_10083281 Ga0207657_100832812 159
117 3300025920 Ga0207649_10012812 Ga0207649_100128124 159
118 3300025921 Ga0207652_10000081 Ga0207652_1000008186 159
119 3300025921 Ga0207652_10051556 Ga0207652_100515563 159
120 3300025924 Ga0207694_10008985 Ga0207694_100089855 159
121 3300025932 Ga0207690_10009020 Ga0207690_100090203 159
122 3300025932 Ga0207690_10033331 Ga0207690_100333312 159
123 3300025932 Ga0207690_10265996 Ga0207690_102659962 159
124 3300025944 Ga0207661_10030130 Ga0207661_100301302 159
125 3300025945 Ga0207679_10121201 Ga0207679_101212013 159
126 3300025949 Ga0207667_10001214 Ga0207667_1000121413 159
127 3300025949 Ga0207667_10007552 Ga0207667_1000755212 159
128 3300025949 Ga0207667_10012474 Ga0207667_100124747 159
129 3300025981 Ga0207640_10061246 Ga0207640_100612462 159
130 3300025981 Ga0207640_10199176 Ga0207640_101991762 159
131 3300026035 Ga0207703_11587266 Ga0207703_115872661 159
132 3300026041 Ga0207639_10021947 Ga0207639_100219475 159
133 3300026067 Ga0207678_10075764 Ga0207678_100757643 159
134 3300026067 Ga0207678_10086166 Ga0207678_100861663 159
135 3300026078 Ga0207702_10039782 Ga0207702_100397823 159
136 3300026088 Ga0207641_11278276 Ga0207641_112782762 159
137 3300026116 Ga0207674_10113369 Ga0207674_101133693 159
138 3300026142 Ga0207698_10002064 Ga0207698_100020646 159
139 3300031852 Ga0307410_10416385 Ga0307410_104163852 159
140 3300032004 Ga0307414_10484947 Ga0307414_104849472 159
141 3300032005 Ga0307411_10738258 Ga0307411_107382581 159
142 3300037418 Ga0395900_0005289 Ga0395900_0005289_3517_4002 159
143 3300037418 Ga0395900_0107061 Ga0395900_0107061_959_1438 159
144 3300037466 Ga0395898_0440537 Ga0395898_0440537_750_1229 159
145 3300038443 Ga0395901_0034161 Ga0395901_0034161_2309_2788 159
146 3300041492 Ga0451835_1024061 Ga0451835_1024061_14_493 159
147 3300042876 Ga0451577_0022765 Ga0451577_0022765_5042_5521 159
148 3300044656 Ga0466969_0004888 Ga0466969_0004888_397_879 159
149 3300044673 Ga0453683_0676691 Ga0453683_0676691_20_499 159
150 3300044684 Ga0466966_0081019 Ga0466966_0081019_1143_1625 159
151 3300044693 Ga0466961_0000708 Ga0466961_0000708_170_652 159
152 3300044706 Ga0466964_0000409 Ga0466964_0000409_4167_4649 159
153 3300044719 Ga0466971_0038417 Ga0466971_0038417_1122_1604 159
154 3300044765 Ga0466970_0163513 Ga0466970_0163513_397_879 159
155 3300044842 Ga0466957_0187626 Ga0466957_0187626_231_713 159
156 3300045049 Ga0466959_0093346 Ga0466959_0093346_1529_2011 159
157 3300045836 Ga0466958_0074924 Ga0466958_0074924_255_737 159
158 3300045976 Ga0466967_0485525 Ga0466967_0485525_333_821 159
159 3300046477 Ga0495664_0026901 Ga0495664_0026901_668_1147 159
160 3300046543 Ga0495645_0155677 Ga0495645_0155677_138_617 159
161 3300046678 Ga0495599_0702068 Ga0495599_0702068_17_496 159
162 3300046680 Ga0495646_0145978 Ga0495646_0145978_778_1257 159
163 3300046809 Ga0495600_0185186 Ga0495600_0185186_639_1118 159
164 3300047320 Ga0495672_0049093 Ga0495672_0049093_300_812 159
165 3300047673 Ga0495593_0179273 Ga0495593_0179273_275_766 159
166 3300048915 Ga0496112_1590324 Ga0496112_1590324_10_492 159
167 3300048929 Ga0496126_0493384 Ga0496126_0493384_222_770 159
168 3300049586 Ga0501070_0097600 Ga0501070_0097600_51_530 159
169 3300061719 Ga0466962_0000339 Ga0466962_0000339_1691_2173 159
170 3300001915 JGI24741J21665_1017803 JGI24741J21665_10178032 160
171 3300005329 Ga0070683_100097053 Ga0070683_1000970531 160
172 3300005336 Ga0070680_100133209 Ga0070680_1001332091 160
173 3300005341 Ga0070691_10172543 Ga0070691_101725432 160
174 3300005458 Ga0070681_10166741 Ga0070681_101667413 160
175 3300005530 Ga0070679_100376006 Ga0070679_1003760061 160
176 3300005548 Ga0070665_100008829 Ga0070665_1000088293 160
177 3300005615 Ga0070702_100500925 Ga0070702_1005009251 160
178 3300005618 Ga0068864_100794968 Ga0068864_1007949682 160
179 3300005841 Ga0068863_101157575 Ga0068863_1011575751 160
180 3300005842 Ga0068858_100751651 Ga0068858_1007516511 160
181 3300005844 Ga0068862_101316171 Ga0068862_1013161712 160
182 3300006038 Ga0075365_11038839 Ga0075365_110388391 160
183 3300009093 Ga0105240_10082923 Ga0105240_100829232 160
184 3300009174 Ga0105241_10673378 Ga0105241_106733781 160
185 3300009174 Ga0105241_11047044 Ga0105241_110470441 160
186 3300009551 Ga0105238_10080207 Ga0105238_100802072 160
187 3300009553 Ga0105249_10008497 Ga0105249_100084975 160
188 3300013104 Ga0157370_10018257 Ga0157370_100182572 160
189 3300013104 Ga0157370_10036767 Ga0157370_100367674 160
190 3300013306 Ga0163162_10300248 Ga0163162_103002482 160
191 3300017792 Ga0163161_10021750 Ga0163161_100217504 160
192 3300017792 Ga0163161_10174141 Ga0163161_101741412 160
193 3300025911 Ga0207654_10785797 Ga0207654_107857971 160
194 3300025912 Ga0207707_10042206 Ga0207707_100422064 160
195 3300025913 Ga0207695_10094558 Ga0207695_100945583 160
196 3300025917 Ga0207660_10000253 Ga0207660_100002534 160
197 3300025921 Ga0207652_10010550 Ga0207652_100105502 160
198 3300025924 Ga0207694_10034284 Ga0207694_100342844 160
199 3300025961 Ga0207712_10011103 Ga0207712_100111034 160
200 3300026095 Ga0207676_10709929 Ga0207676_107099291 160
201 3300028379 Ga0268266_10007614 Ga0268266_100076149 160
202 3300028380 Ga0268265_10946641 Ga0268265_109466411 160
203 3300031616 Ga0307508_10005455 Ga0307508_100054555 160
204 3300032004 Ga0307414_11290027 Ga0307414_112900271 160
205 3300041509 Ga0451843_1069097 Ga0451843_1069097_65_547 160
206 3300042006 Ga0439432_023687 Ga0439432_023687_330_812 160
207 3300046453 Ga0495627_012245 Ga0495627_012245_2252_2737 160
208 3300046453 Ga0495627_184855 Ga0495627_184855_74_556 160
209 3300046460 Ga0495638_0017177 Ga0495638_0017177_1904_2386 160
210 3300046522 Ga0495643_0032968 Ga0495643_0032968_960_1442 160
211 3300046525 Ga0495663_0006824 Ga0495663_0006824_1875_2357 160
212 3300046530 Ga0495654_0182487 Ga0495654_0182487_250_792 160
213 3300046538 Ga0495609_0094298 Ga0495609_0094298_592_1074 160
214 3300046558 Ga0495633_0167653 Ga0495633_0167653_467_949 160
215 3300046660 Ga0495625_0064727 Ga0495625_0064727_1484_1966 160
216 3300046660 Ga0495625_0248801 Ga0495625_0248801_398_880 160
217 3300047320 Ga0495672_0001742 Ga0495672_0001742_16899_17381 160
218 3300047320 Ga0495672_0002675 Ga0495672_0002675_14360_14902 160
219 3300047472 Ga0495686_0088736 Ga0495686_0088736_177_659 160
220 3300048916 Ga0496113_0620448 Ga0496113_0620448_143_628 160
221 3300048919 Ga0496116_0167940 Ga0496116_0167940_66_548 160
222 3300048920 Ga0496117_0005378 Ga0496117_0005378_6921_7403 160
223 3300048920 Ga0496117_0084049 Ga0496117_0084049_392_877 160
224 3300048921 Ga0496118_0005983 Ga0496118_0005983_6151_6633 160
225 3300048921 Ga0496118_0091645 Ga0496118_0091645_450_932 160
226 3300048921 Ga0496118_0097482 Ga0496118_0097482_390_875 160
227 3300048924 Ga0496121_0038214 Ga0496121_0038214_1765_2250 160
228 3300048925 Ga0496122_0027811 Ga0496122_0027811_1878_2363 160
229 3300048925 Ga0496122_0089971 Ga0496122_0089971_1001_1486 160
230 3300048926 Ga0496123_0041065 Ga0496123_0041065_968_1453 160
231 3300048926 Ga0496123_0087689 Ga0496123_0087689_219_704 160
232 3300048927 Ga0496124_0002663 Ga0496124_0002663_1145_1627 160
233 3300048927 Ga0496124_0071021 Ga0496124_0071021_1289_1774 160
234 3300048927 Ga0496124_0188345 Ga0496124_0188345_893_1375 160
235 3300048927 Ga0496124_0193956 Ga0496124_0193956_793_1275 160
236 3300048927 Ga0496124_0347428 Ga0496124_0347428_44_529 160
237 3300048927 Ga0496124_0552954 Ga0496124_0552954_250_735 160
238 3300048928 Ga0496125_0189579 Ga0496125_0189579_219_704 160
239 3300048929 Ga0496126_0396036 Ga0496126_0396036_79_564 160
240 3300049568 Ga0501031_0215447 Ga0501031_0215447_375_869 160
241 3300049570 Ga0501033_0044565 Ga0501033_0044565_639_1133 160
242 3300049573 Ga0501037_0099403 Ga0501037_0099403_836_1330 160
243 3300049574 Ga0501038_0137470 Ga0501038_0137470_646_1140 160
244 3300049581 Ga0501047_0006075 Ga0501047_0006075_940_1422 160
245 3300049581 Ga0501047_0040320 Ga0501047_0040320_1156_1650 160
246 3300049585 Ga0501069_0024424 Ga0501069_0024424_2371_2865 160
247 3300049585 Ga0501069_0069973 Ga0501069_0069973_47_529 160
248 3300049585 Ga0501069_0171967 Ga0501069_0171967_343_831 160
249 3300049586 Ga0501070_0115830 Ga0501070_0115830_1470_1964 160
250 3300049586 Ga0501070_0477112 Ga0501070_0477112_193_681 160
251 3300049587 Ga0501071_0001798 Ga0501071_0001798_3070_3552 160
252 3300049589 Ga0501073_0015014 Ga0501073_0015014_4229_4723 160
253 3300049590 Ga0501074_0011401 Ga0501074_0011401_4963_5445 160
254 3300049590 Ga0501074_0024394 Ga0501074_0024394_716_1210 160
255 3300049592 Ga0501076_0765582 Ga0501076_0765582_202_684 160
256 3300049741 Ga0501079_0207879 Ga0501079_0207879_397_879 160
257 3300049741 Ga0501079_0373864 Ga0501079_0373864_47_541 160
258 3300049742 Ga0501080_0130738 Ga0501080_0130738_1638_2120 160
259 3300049742 Ga0501080_0157109 Ga0501080_0157109_1412_1906 160
260 3300049744 Ga0501083_0671676 Ga0501083_0671676_96_578 160
261 3300049822 Ga0501035_1034953 Ga0501035_1034953_75_557 160
262 3300049823 Ga0501044_0007834 Ga0501044_0007834_6608_7090 160
263 3300049823 Ga0501044_0117207 Ga0501044_0117207_883_1377 160
264 3300053128 Ga0500626_062979 Ga0500626_062979_265_747 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

6

113

0.99

PF00578

AhpC-TSA

AhpC/TSA family

3

142

0.76

PF08534

Redoxin

Redoxin

3

160

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9722 1 160
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9711 1 160
2vup-assembly1.cif.gz_A crystal structure of a type ii tryparedoxin-dependant peroxidase from trypanosoma brucei 0.9704 1 160
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9662 1 160
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9651 1 160
ID Description Score Start End Superfamily
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9846 3 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9802 1 158 3.40.30.10
af_Q7FS88_1_175_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9703 1 159 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.968 1 158 3.40.30.10
af_A8WFK6_20_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9669 1 159 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A562R3D5-F1-model_v4 Glutathione peroxidase 0.9934 1 159 GO:0004601
GO:0034599
AF-A0A520RD70-F1-model_v4 Glutathione peroxidase 0.9933 1 159 GO:0004601
GO:0034599
AF-A0A7X0B9B4-F1-model_v4 deleted 0.9931 2 159
AF-A0A1R7QBL3-F1-model_v4 Glutathione peroxidase 0.993 1 160 GO:0004601
GO:0034599
AF-A0A7W8M8F6-F1-model_v4 Glutathione peroxidase 0.9928 1 159 GO:0004602
GO:0034599

Feature Viewer

pLDDT pTM Quality
93.87 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map