F372800

General Info

Members Datasets Scaffolds Average Seq Length
264 125 242 298

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_012656|Ga0495617_012656_19_924
Length 285
Sequence MNTLNTKQFHRPRLLILGCGDVGMRLLPLLRDRFRVFAVTSQPERCAALRAAGAVPLVADLDQPASLRRLYVVHLAPPQAEGAHDRRTRNVSAVLPAAARMVYISTTGVYGDCGGATFDESRPVAPRNARAQRRVDAEQWLRRWGRRTASAVSILRVPGIYAGDRLPVKRLQLGTPALIAQDDVYTNHIHADDLARVIARALFRGAPGRVYHAVDDSDMKMADYFDSVADALQLPRPVTPALLSFMSESRRLRNRRLKRELGVRLRYARVVDCLQQLAASAERKL

Samples

Sample ID Description Type Environment
1 2643221645 Massilia sp. Root351 Isolate Unclassified
2 2643221664 Massilia sp. Root418 Isolate Unclassified
3 2738541280 Massilia sp. GV090 Isolate Unclassified
4 2738541297 Duganella sp. GV083 Isolate Unclassified
5 2738541300 Massilia sp. GV016 Isolate Unclassified
6 2738541357 Duganella sp. GV053 Isolate Unclassified
7 2738543003 Duganella sp. GV066 Isolate Unclassified
8 2738543018 Massilia sp. GV045 Isolate Unclassified
9 2738543026 Duganella sp. GV089 Isolate Unclassified
10 2738543029 Duganella sp. GV039 Isolate Unclassified
11 2738543030 Massilia sp. GV097 Isolate Unclassified
12 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
13 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
14 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
15 2821131069 Duganella sp. 1224 Isolate Unclassified
16 2842711865 Duganella sp. R-73148 Isolate Unclassified
17 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
18 2857553236 Duganella sp. R-74557 Isolate Unclassified
19 2857558681 Duganella sp. R-74565 Isolate Unclassified
20 2857564685 Duganella sp. R-74599 Isolate Unclassified
21 2904424332 Duganella sp. 1411 Isolate Rhizosphere
22 2919476304 Duganella sp. 3397 Isolate Unclassified
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
36 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
43 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
44 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
49 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
52 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
53 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
56 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
57 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
58 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
59 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
60 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
63 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
64 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
67 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
68 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
69 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
70 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
71 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
72 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
73 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
76 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
77 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
78 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
79 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
80 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
81 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
93 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
94 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
103 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
121 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
122 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
123 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
124 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
125 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.67
Metatranscriptomes 0
Isolates 8.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 1.52
Rhizoplane 2.27
Rhizosphere 79.17
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001122 3300002738 Bacteria 10399
2 Ga0055529_1000500 3300003763 Bacteria 35487
3 Ga0055526_1000042 3300003771 Bacteria 124886
4 Ga0055526_1000125 3300003771 Bacteria 67941
5 Ga0079104_1002214 3300006946 Bacteria 10920
6 Ga0099826_10000005 3300006948 Bacteria 465206
7 Ga0105244_10002598 3300009036 Bacteria 13551
8 Ga0105244_10004984 3300009036 Bacteria 8961
9 Ga0157371_10000014 3300013102 Bacteria 347490
10 Ga0182008_10001917 3300014497 Bacteria 13449
11 Ga0182008_10012012 3300014497 Bacteria 4585
12 Ga0182006_1000004 3300015261 Bacteria 622190
13 Ga0182006_1000019 3300015261 Bacteria 294192
14 Ga0182007_10000018 3300015262 Bacteria 198916
15 Ga0182005_1000005 3300015265 Bacteria 537378
16 Ga0213872_10000059 3300021361 Bacteria 100362
17 Ga0213872_10000296 3300021361 Bacteria 42414
18 Ga0213872_10003431 3300021361 Bacteria 8810
19 Ga0213872_10023832 3300021361 Bacteria 2815
20 Ga0207425_1001253 3300025245 Bacteria 11114
21 Ga0209646_1000036 3300025246 Bacteria 358864
22 Ga0209455_1000047 3300025272 Bacteria 379709
23 Ga0209025_1003155 3300025294 Bacteria 16067
24 Ga0209564_1000032 3300025295 Bacteria 464041
25 Ga0209564_1000464 3300025295 Bacteria 67994
26 Ga0209758_1000340 3300025297 Bacteria 86646
27 Ga0207655_1019902 3300025728 Bacteria 3479
28 Ga0207655_1027828 3300025728 Bacteria 2681
29 Ga0209281_1001836 3300027111 Bacteria 10452
30 Ga0209282_1000003 3300027666 Bacteria 856377
31 Ga0307515_10243820 3300028794 Bacteria 1562
32 Ga0307408_100008249 3300031548 Bacteria 6874
33 Ga0436361_0018737 3300039447 Bacteria 3402
34 Ga0436361_0041186 3300039447 Bacteria 32508
35 Ga0436361_0555760 3300039447 Bacteria 5196
36 Ga0436361_0683259 3300039447 Bacteria 3291
37 Ga0436361_0841264 3300039447 Bacteria 12077
38 Ga0466965_0012541 3300044683 Bacteria 3988
39 Ga0466968_0062347 3300044735 Bacteria 1610
40 Ga0466970_0073134 3300044765 Bacteria 1845
41 Ga0466959_0105471 3300045049 Bacteria 2015
42 Ga0495617_000005 3300046452 Bacteria 404687
43 Ga0495617_002544 3300046452 Bacteria 7202
44 Ga0495617_008473 3300046452 Bacteria 3543
45 Ga0495617_012656 3300046452 Bacteria 2877
46 Ga0495617_024526 3300046452 Bacteria 2035
47 Ga0495627_000033 3300046453 Bacteria 220621
48 Ga0495590_0000011 3300046457 Bacteria 307470
49 Ga0495629_0055302 3300046459 Bacteria 2775
50 Ga0495638_0000058 3300046460 Bacteria 192656
51 Ga0495638_0002570 3300046460 Bacteria 14689
52 Ga0495653_0000008 3300046463 Bacteria 307868
53 Ga0495653_0206542 3300046463 Bacteria 1329
54 Ga0495650_0000109 3300046471 Bacteria 199925
55 Ga0495650_0000365 3300046471 Bacteria 79708
56 Ga0495650_0000368 3300046471 Bacteria 78685
57 Ga0495650_0000397 3300046471 Bacteria 72986
58 Ga0495650_0004064 3300046471 Bacteria 10236
59 Ga0495650_0008972 3300046471 Bacteria 5750
60 Ga0495650_0017649 3300046471 Bacteria 3571
61 Ga0495605_0000082 3300046474 Bacteria 125136
62 Ga0495605_0003566 3300046474 Bacteria 9223
63 Ga0495605_0009445 3300046474 Bacteria 5479
64 Ga0495584_0000504 3300046491 Bacteria 26778
65 Ga0495584_0078741 3300046491 Bacteria 1658
66 Ga0495585_0012762 3300046492 Bacteria 4942
67 Ga0495585_0019496 3300046492 Bacteria 3909
68 Ga0495585_0037073 3300046492 Bacteria 2746
69 Ga0495585_0043517 3300046492 Bacteria 2511
70 Ga0495594_0002052 3300046499 Bacteria 10492
71 Ga0495596_0000909 3300046500 Bacteria 17709
72 Ga0495596_0006219 3300046500 Bacteria 5526
73 Ga0495607_0020211 3300046501 Bacteria 4215
74 Ga0495607_0025941 3300046501 Bacteria 3639
75 Ga0495607_0034723 3300046501 Bacteria 3057
76 Ga0495607_0067794 3300046501 Bacteria 2003
77 Ga0495607_0079647 3300046501 Bacteria 1804
78 Ga0495607_0097994 3300046501 Bacteria 1575
79 Ga0495583_0000016 3300046506 Bacteria 312691
80 Ga0495583_0000076 3300046506 Bacteria 174154
81 Ga0495583_0062780 3300046506 Bacteria 1653
82 Ga0495606_0000048 3300046507 Bacteria 207840
83 Ga0495606_0000251 3300046507 Bacteria 94515
84 Ga0495606_0000757 3300046507 Bacteria 49718
85 Ga0495606_0000897 3300046507 Bacteria 44320
86 Ga0495606_0001963 3300046507 Bacteria 25360
87 Ga0495606_0027602 3300046507 Bacteria 4021
88 Ga0495606_0032505 3300046507 Bacteria 3613
89 Ga0495606_0057437 3300046507 Bacteria 2506
90 Ga0495606_0072090 3300046507 Bacteria 2172
91 Ga0495610_0000007 3300046512 Bacteria 820919
92 Ga0495610_0006754 3300046512 Bacteria 7789
93 Ga0495610_0009476 3300046512 Bacteria 6151
94 Ga0495610_0010235 3300046512 Bacteria 5846
95 Ga0495610_0014500 3300046512 Bacteria 4626
96 Ga0495610_0031071 3300046512 Bacteria 2790
97 Ga0495616_0004880 3300046513 Bacteria 8384
98 Ga0495616_0017040 3300046513 Bacteria 4010
99 Ga0495630_0222384 3300046517 Bacteria 1441
100 Ga0495631_0008388 3300046518 Bacteria 5207
101 Ga0495632_0000237 3300046519 Bacteria 55087
102 Ga0495637_0000500 3300046520 Bacteria 28393
103 Ga0495637_0024630 3300046520 Bacteria 2722
104 Ga0495643_0000119 3300046522 Bacteria 127740
105 Ga0495643_0000153 3300046522 Bacteria 112514
106 Ga0495643_0044046 3300046522 Bacteria 2426
107 Ga0495643_0055236 3300046522 Bacteria 2123
108 Ga0495643_0121433 3300046522 Bacteria 1320
109 Ga0495644_0010249 3300046523 Bacteria 3611
110 Ga0495644_0011454 3300046523 Bacteria 3414
111 Ga0495644_0011490 3300046523 Bacteria 3408
112 Ga0495644_0138752 3300046523 Bacteria 928
113 Ga0495648_0000010 3300046524 Bacteria 307259
114 Ga0495648_0003174 3300046524 Bacteria 14636
115 Ga0495648_0003598 3300046524 Bacteria 13561
116 Ga0495648_0005116 3300046524 Bacteria 10987
117 Ga0495648_0017152 3300046524 Bacteria 5188
118 Ga0495648_0022835 3300046524 Bacteria 4296
119 Ga0495648_0027824 3300046524 Bacteria 3777
120 Ga0495663_0008730 3300046525 Bacteria 2810
121 Ga0495666_0003105 3300046526 Bacteria 8348
122 Ga0495642_0039436 3300046528 Bacteria 1916
123 Ga0495654_0000046 3300046530 Bacteria 150178
124 Ga0495654_0080692 3300046530 Bacteria 1526
125 Ga0495665_0003414 3300046531 Bacteria 8626
126 Ga0495609_0001488 3300046538 Bacteria 15528
127 Ga0495609_0001530 3300046538 Bacteria 15209
128 Ga0495609_0029367 3300046538 Bacteria 2503
129 Ga0495597_0000043 3300046542 Bacteria 106919
130 Ga0495597_0000810 3300046542 Bacteria 24703
131 Ga0495622_0000061 3300046557 Bacteria 96048
132 Ga0495622_0000295 3300046557 Bacteria 37518
133 Ga0495622_0007193 3300046557 Bacteria 5172
134 Ga0495622_0010576 3300046557 Bacteria 4258
135 Ga0495622_0014739 3300046557 Bacteria 3631
136 Ga0495622_0074517 3300046557 Bacteria 1565
137 Ga0495622_0112833 3300046557 Bacteria 1244
138 Ga0495633_0000132 3300046558 Bacteria 100231
139 Ga0495633_0001778 3300046558 Bacteria 15971
140 Ga0495633_0002686 3300046558 Bacteria 12348
141 Ga0495633_0002815 3300046558 Bacteria 12034
142 Ga0495633_0003565 3300046558 Bacteria 10288
143 Ga0495633_0004896 3300046558 Bacteria 8361
144 Ga0495633_0007994 3300046558 Bacteria 6024
145 Ga0495633_0069863 3300046558 Bacteria 1639
146 Ga0495656_0031918 3300046615 Bacteria 2140
147 Ga0495668_0000045 3300046616 Bacteria 225145
148 Ga0495668_0000110 3300046616 Bacteria 132291
149 Ga0495668_0001057 3300046616 Bacteria 29161
150 Ga0495668_0001414 3300046616 Bacteria 23361
151 Ga0495611_0004119 3300046648 Bacteria 6332
152 Ga0495611_0007783 3300046648 Bacteria 4550
153 Ga0495611_0026275 3300046648 Bacteria 2539
154 Ga0495611_0057820 3300046648 Bacteria 1758
155 Ga0495625_0000393 3300046660 Bacteria 66807
156 Ga0495625_0000566 3300046660 Bacteria 54150
157 Ga0495625_0003913 3300046660 Bacteria 14339
158 Ga0495625_0006531 3300046660 Bacteria 10359
159 Ga0495625_0011760 3300046660 Bacteria 7112
160 Ga0495625_0047435 3300046660 Bacteria 3097
161 Ga0495659_0000196 3300046664 Bacteria 26439
162 Ga0495659_0000556 3300046664 Bacteria 13743
163 Ga0495659_0008442 3300046664 Bacteria 3278
164 Ga0495659_0022514 3300046664 Bacteria 2133
165 Ga0495661_0025529 3300046665 Bacteria 3815
166 Ga0495661_0035987 3300046665 Bacteria 3103
167 Ga0495661_0075826 3300046665 Bacteria 1953
168 Ga0495623_0009886 3300046679 Bacteria 6179
169 Ga0495613_0067889 3300046689 Bacteria 2602
170 Ga0495624_0017131 3300046690 Bacteria 4870
171 Ga0495670_0009161 3300046691 Bacteria 4867
172 Ga0495670_0010315 3300046691 Bacteria 4589
173 Ga0495670_0244973 3300046691 Bacteria 955
174 Ga0495671_0000056 3300046692 Bacteria 115524
175 Ga0495671_0000495 3300046692 Bacteria 30385
176 Ga0495671_0021953 3300046692 Bacteria 3347
177 Ga0495671_0142659 3300046692 Bacteria 1167
178 Ga0495649_0033973 3300046694 Bacteria 2807
179 Ga0495660_0000418 3300046810 Bacteria 36125
180 Ga0495660_0000490 3300046810 Bacteria 32692
181 Ga0495660_0004463 3300046810 Bacteria 8463
182 Ga0495581_0027542 3300047315 Bacteria 3295
183 Ga0495581_0154597 3300047315 Bacteria 1340
184 Ga0495636_0001587 3300047318 Bacteria 8649
185 Ga0495636_0001902 3300047318 Bacteria 7980
186 Ga0495672_0000005 3300047320 Bacteria 593294
187 Ga0495672_0000113 3300047320 Bacteria 129189
188 Ga0495672_0000161 3300047320 Bacteria 96964
189 Ga0495672_0000850 3300047320 Bacteria 32446
190 Ga0495672_0012446 3300047320 Bacteria 5937
191 Ga0495672_0017633 3300047320 Bacteria 4770
192 Ga0495683_0001752 3300047323 Bacteria 13707
193 Ga0495683_0003004 3300047323 Bacteria 9946
194 Ga0495687_000497 3300047443 Bacteria 47387
195 Ga0495687_000795 3300047443 Bacteria 33965
196 Ga0495687_000990 3300047443 Bacteria 28515
197 Ga0495687_016899 3300047443 Bacteria 3658
198 Ga0495679_014390 3300047446 Bacteria 2933
199 Ga0495685_000038 3300047447 Bacteria 54128
200 Ga0495673_0000057 3300047469 Bacteria 239715
201 Ga0495673_0000096 3300047469 Bacteria 182792
202 Ga0495673_0000098 3300047469 Bacteria 182002
203 Ga0495673_0005679 3300047469 Bacteria 7495
204 Ga0495686_0000352 3300047472 Bacteria 75409
205 Ga0495686_0001256 3300047472 Bacteria 28813
206 Ga0495686_0013034 3300047472 Bacteria 5789
207 Ga0495593_0036605 3300047673 Bacteria 2660
208 Ga0495602_0165132 3300048088 Bacteria 1724
209 Ga0495626_0002229 3300048091 Bacteria 13908
210 Ga0495626_0002754 3300048091 Bacteria 11816
211 Ga0495626_0034544 3300048091 Bacteria 2418
212 Ga0496102_0029095 3300048905 Bacteria 4939
213 Ga0496102_0037188 3300048905 Bacteria 4390
214 Ga0496103_0000878 3300048906 Bacteria 21803
215 Ga0496111_0020544 3300048914 Bacteria 4598
216 Ga0496115_0088804 3300048918 Bacteria 2524
217 Ga0496115_0142317 3300048918 Bacteria 1979
218 Ga0496116_0007434 3300048919 Bacteria 9722
219 Ga0496116_0039061 3300048919 Bacteria 3286
220 Ga0496121_0121899 3300048924 Bacteria 1967
221 Ga0496122_0001155 3300048925 Bacteria 45307
222 Ga0496122_0014686 3300048925 Bacteria 7551
223 Ga0496122_0049626 3300048925 Bacteria 3210
224 Ga0496123_0003290 3300048926 Bacteria 18305
225 Ga0496123_0003703 3300048926 Bacteria 16810
226 Ga0496124_0023976 3300048927 Bacteria 5555
227 Ga0496124_0150134 3300048927 Bacteria 1829
228 Ga0496124_0159771 3300048927 Bacteria 1758
229 Ga0496125_0081093 3300048928 Bacteria 2480
230 Ga0496126_0016767 3300048929 Bacteria 7315
231 Ga0495678_000001 3300049459 Bacteria 1060340
232 Ga0495678_000111 3300049459 Bacteria 97182
233 Ga0495678_002076 3300049459 Bacteria 14272
234 Ga0495682_0000327 3300049460 Bacteria 35368
235 Ga0495682_0002225 3300049460 Bacteria 9362
236 Ga0495682_0004455 3300049460 Bacteria 5988
237 Ga0495682_0007938 3300049460 Bacteria 4198
238 Ga0501238_000719 3300049671 Bacteria 3708
239 Ga0501269_000554 3300049766 Bacteria 7081
240 Ga0500594_0002150 3300053118 Bacteria 4266
241 Ga0500618_000078 3300053125 Bacteria 79833
242 Ga0500618_001415 3300053125 Bacteria 10747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046530 Ga0495654_0080692 Ga0495654_0080692_16_807 257
2 3300048091 Ga0495626_0034544 Ga0495626_0034544_1601_2404 264
3 3300046810 Ga0495660_0004463 Ga0495660_0004463_5687_6499 265
4 3300047472 Ga0495686_0000352 Ga0495686_0000352_8772_9779 267
5 3300046463 Ga0495653_0000008 Ga0495653_0000008_92099_92932 269
6 3300046507 Ga0495606_0000048 Ga0495606_0000048_118797_119630 269
7 3300046523 Ga0495644_0138752 Ga0495644_0138752_22_846 269
8 3300047320 Ga0495672_0000005 Ga0495672_0000005_157118_157948 269
9 3300046501 Ga0495607_0067794 Ga0495607_0067794_576_1481 272
10 3300046512 Ga0495610_0014500 Ga0495610_0014500_2844_3749 272
11 3300046513 Ga0495616_0004880 Ga0495616_0004880_5201_6106 272
12 3300046558 Ga0495633_0002686 Ga0495633_0002686_10956_11861 272
13 3300046648 Ga0495611_0004119 Ga0495611_0004119_611_1516 272
14 3300046660 Ga0495625_0047435 Ga0495625_0047435_448_1353 272
15 3300046691 Ga0495670_0009161 Ga0495670_0009161_1212_2117 272
16 3300047443 Ga0495687_016899 Ga0495687_016899_2425_3312 273
17 3300053125 Ga0500618_000078 Ga0500618_000078_58014_58898 273
18 3300046491 Ga0495584_0000504 Ga0495584_0000504_5378_6283 274
19 3300046452 Ga0495617_012656 Ga0495617_012656_19_924 275
20 3300046501 Ga0495607_0020211 Ga0495607_0020211_461_1366 275
21 3300046664 Ga0495659_0022514 Ga0495659_0022514_230_1135 275
22 3300047320 Ga0495672_0012446 Ga0495672_0012446_2387_3292 275
23 3300046665 Ga0495661_0025529 Ga0495661_0025529_2130_3035 276
24 3300046492 Ga0495585_0043517 Ga0495585_0043517_1385_2290 277
25 3300013102 Ga0157371_10000014 Ga0157371_10000014217 278
26 3300014497 Ga0182008_10012012 Ga0182008_100120123 278
27 iso_pu_bacteria 2852618963 2852621018 278
28 iso_pu_bacteria 2808606386 2808981281 281
29 iso_pu_bacteria 2808606415 2809128864 281
30 iso_pu_bacteria 2808606419 2809148485 281
31 3300046459 Ga0495629_0055302 Ga0495629_0055302_750_1634 284
32 3300046679 Ga0495623_0009886 Ga0495623_0009886_16_900 284
33 3300046691 Ga0495670_0244973 Ga0495670_0244973_14_883 284
34 iso_pu_bacteria 2738541297 2738827339 285
35 iso_pu_bacteria 2738541357 2739151136 285
36 iso_pu_bacteria 2738543003 2739193055 285
37 iso_pu_bacteria 2738543026 2739319532 285
38 iso_pu_bacteria 2738543029 2739337773 285
39 iso_pu_bacteria 2821131069 2821134693 285
40 3300046471 Ga0495650_0008972 Ga0495650_0008972_118_996 287
41 3300046522 Ga0495643_0055236 Ga0495643_0055236_121_1095 287
42 3300046557 Ga0495622_0014739 Ga0495622_0014739_2408_3310 287
43 3300046558 Ga0495633_0003565 Ga0495633_0003565_8874_9776 287
44 3300048914 Ga0496111_0020544 Ga0496111_0020544_1077_1979 287
45 3300048925 Ga0496122_0001155 Ga0496122_0001155_17617_18519 287
46 3300048926 Ga0496123_0003703 Ga0496123_0003703_13765_14667 287
47 3300048927 Ga0496124_0023976 Ga0496124_0023976_4416_5318 287
48 3300048928 Ga0496125_0081093 Ga0496125_0081093_948_1850 287
49 3300049460 Ga0495682_0004455 Ga0495682_0004455_3600_4502 287
50 3300046452 Ga0495617_000005 Ga0495617_000005_286711_287598 288
51 3300046463 Ga0495653_0206542 Ga0495653_0206542_107_994 288
52 3300046471 Ga0495650_0000365 Ga0495650_0000365_55331_56218 288
53 3300046474 Ga0495605_0009445 Ga0495605_0009445_362_1246 288
54 3300046492 Ga0495585_0012762 Ga0495585_0012762_988_1875 288
55 3300046512 Ga0495610_0000007 Ga0495610_0000007_103919_104806 288
56 3300046524 Ga0495648_0003174 Ga0495648_0003174_12667_13551 288
57 3300046524 Ga0495648_0005116 Ga0495648_0005116_7555_8442 288
58 3300046524 Ga0495648_0022835 Ga0495648_0022835_2617_3504 288
59 3300046616 Ga0495668_0001414 Ga0495668_0001414_15255_16142 288
60 3300046665 Ga0495661_0035987 Ga0495661_0035987_921_1808 288
61 3300046692 Ga0495671_0000056 Ga0495671_0000056_65767_66750 288
62 3300047320 Ga0495672_0000850 Ga0495672_0000850_1109_1993 288
63 3300047323 Ga0495683_0003004 Ga0495683_0003004_3760_4644 288
64 3300047446 Ga0495679_014390 Ga0495679_014390_249_1136 288
65 3300047469 Ga0495673_0000057 Ga0495673_0000057_125420_126292 288
66 3300047469 Ga0495673_0000098 Ga0495673_0000098_93240_94127 288
67 3300048924 Ga0496121_0121899 Ga0496121_0121899_311_1192 288
68 3300048925 Ga0496122_0014686 Ga0496122_0014686_4326_5213 288
69 3300048925 Ga0496122_0049626 Ga0496122_0049626_399_1292 288
70 3300048926 Ga0496123_0003290 Ga0496123_0003290_2124_3017 288
71 3300048929 Ga0496126_0016767 Ga0496126_0016767_3304_4176 288
72 3300053125 Ga0500618_001415 Ga0500618_001415_7947_8981 288
73 iso_pu_bacteria 2842711865 2842715243 288
74 iso_pu_bacteria 2857553236 2857557920 288
75 iso_pu_bacteria 2857558681 2857564056 288
76 iso_pu_bacteria 2857564685 2857569020 288
77 iso_pu_bacteria 2919476304 2919479568 288
78 3300003763 Ga0055529_1000500 Ga0055529_100050024 289
79 3300021361 Ga0213872_10000296 Ga0213872_1000029610 289
80 3300025272 Ga0209455_1000047 Ga0209455_100004762 289
81 3300039447 Ga0436361_0041186 Ga0436361_0041186_22334_23224 289
82 3300046500 Ga0495596_0006219 Ga0495596_0006219_1753_2640 289
83 3300046522 Ga0495643_0121433 Ga0495643_0121433_427_1308 289
84 3300047472 Ga0495686_0001256 Ga0495686_0001256_19502_20389 289
85 3300049460 Ga0495682_0002225 Ga0495682_0002225_3099_3986 289
86 iso_pu_bacteria 2904424332 2904430044 289
87 3300046507 Ga0495606_0072090 Ga0495606_0072090_693_1871 290
88 3300046519 Ga0495632_0000237 Ga0495632_0000237_34890_35822 290
89 3300048918 Ga0496115_0088804 Ga0496115_0088804_901_1791 290
90 3300003771 Ga0055526_1000125 Ga0055526_100012524 291
91 3300006946 Ga0079104_1002214 Ga0079104_10022149 291
92 3300006948 Ga0099826_10000005 Ga0099826_10000005303 291
93 3300009036 Ga0105244_10002598 Ga0105244_1000259814 291
94 3300014497 Ga0182008_10001917 Ga0182008_100019176 291
95 3300015261 Ga0182006_1000004 Ga0182006_1000004236 291
96 3300015261 Ga0182006_1000019 Ga0182006_100001928 291
97 3300015262 Ga0182007_10000018 Ga0182007_10000018135 291
98 3300015265 Ga0182005_1000005 Ga0182005_1000005185 291
99 3300021361 Ga0213872_10000059 Ga0213872_1000005972 291
100 3300021361 Ga0213872_10003431 Ga0213872_100034319 291
101 3300021361 Ga0213872_10023832 Ga0213872_100238324 291
102 3300025245 Ga0207425_1001253 Ga0207425_10012539 291
103 3300025294 Ga0209025_1003155 Ga0209025_100315518 291
104 3300025295 Ga0209564_1000464 Ga0209564_100046451 291
105 3300025297 Ga0209758_1000340 Ga0209758_100034075 291
106 3300025728 Ga0207655_1027828 Ga0207655_10278284 291
107 3300027111 Ga0209281_1001836 Ga0209281_100183611 291
108 3300027666 Ga0209282_1000003 Ga0209282_1000003498 291
109 3300031548 Ga0307408_100008249 Ga0307408_1000082496 291
110 3300039447 Ga0436361_0018737 Ga0436361_0018737_2490_3389 291
111 3300039447 Ga0436361_0555760 Ga0436361_0555760_1693_2592 291
112 3300039447 Ga0436361_0683259 Ga0436361_0683259_17_916 291
113 3300039447 Ga0436361_0841264 Ga0436361_0841264_5518_6417 291
114 3300044683 Ga0466965_0012541 Ga0466965_0012541_2980_3876 291
115 3300044735 Ga0466968_0062347 Ga0466968_0062347_336_1232 291
116 3300044765 Ga0466970_0073134 Ga0466970_0073134_393_1310 291
117 3300046452 Ga0495617_008473 Ga0495617_008473_2141_3076 291
118 3300046452 Ga0495617_024526 Ga0495617_024526_370_1305 291
119 3300046453 Ga0495627_000033 Ga0495627_000033_139357_140247 291
120 3300046460 Ga0495638_0002570 Ga0495638_0002570_9563_10498 291
121 3300046471 Ga0495650_0000109 Ga0495650_0000109_113371_114255 291
122 3300046471 Ga0495650_0000368 Ga0495650_0000368_13315_14202 291
123 3300046474 Ga0495605_0000082 Ga0495605_0000082_114464_115351 291
124 3300046474 Ga0495605_0003566 Ga0495605_0003566_2517_3452 291
125 3300046491 Ga0495584_0078741 Ga0495584_0078741_90_1025 291
126 3300046492 Ga0495585_0019496 Ga0495585_0019496_1953_2897 291
127 3300046492 Ga0495585_0037073 Ga0495585_0037073_1698_2633 291
128 3300046499 Ga0495594_0002052 Ga0495594_0002052_7355_8299 291
129 3300046500 Ga0495596_0000909 Ga0495596_0000909_12751_13659 291
130 3300046501 Ga0495607_0025941 Ga0495607_0025941_787_1722 291
131 3300046501 Ga0495607_0079647 Ga0495607_0079647_307_1194 291
132 3300046501 Ga0495607_0097994 Ga0495607_0097994_136_1071 291
133 3300046506 Ga0495583_0000016 Ga0495583_0000016_96378_97313 291
134 3300046506 Ga0495583_0062780 Ga0495583_0062780_400_1293 291
135 3300046507 Ga0495606_0000251 Ga0495606_0000251_69881_70768 291
136 3300046507 Ga0495606_0027602 Ga0495606_0027602_1933_2817 291
137 3300046513 Ga0495616_0017040 Ga0495616_0017040_1297_2232 291
138 3300046517 Ga0495630_0222384 Ga0495630_0222384_275_1183 291
139 3300046518 Ga0495631_0008388 Ga0495631_0008388_761_1669 291
140 3300046522 Ga0495643_0044046 Ga0495643_0044046_799_1689 291
141 3300046523 Ga0495644_0010249 Ga0495644_0010249_2265_3155 291
142 3300046523 Ga0495644_0011454 Ga0495644_0011454_443_1378 291
143 3300046523 Ga0495644_0011490 Ga0495644_0011490_443_1378 291
144 3300046524 Ga0495648_0003598 Ga0495648_0003598_1939_2874 291
145 3300046524 Ga0495648_0017152 Ga0495648_0017152_1951_2847 291
146 3300046525 Ga0495663_0008730 Ga0495663_0008730_1097_1990 291
147 3300046526 Ga0495666_0003105 Ga0495666_0003105_5119_6027 291
148 3300046531 Ga0495665_0003414 Ga0495665_0003414_3145_4053 291
149 3300046538 Ga0495609_0001488 Ga0495609_0001488_12726_13661 291
150 3300046538 Ga0495609_0001530 Ga0495609_0001530_14106_14996 291
151 3300046538 Ga0495609_0029367 Ga0495609_0029367_12_947 291
152 3300046557 Ga0495622_0000061 Ga0495622_0000061_78399_79295 291
153 3300046557 Ga0495622_0007193 Ga0495622_0007193_1563_2456 291
154 3300046557 Ga0495622_0010576 Ga0495622_0010576_2147_3055 291
155 3300046557 Ga0495622_0074517 Ga0495622_0074517_290_1183 291
156 3300046557 Ga0495622_0112833 Ga0495622_0112833_210_1145 291
157 3300046558 Ga0495633_0004896 Ga0495633_0004896_1200_2135 291
158 3300046558 Ga0495633_0007994 Ga0495633_0007994_1886_2773 291
159 3300046558 Ga0495633_0069863 Ga0495633_0069863_216_1109 291
160 3300046615 Ga0495656_0031918 Ga0495656_0031918_787_1680 291
161 3300046616 Ga0495668_0000110 Ga0495668_0000110_76826_77713 291
162 3300046616 Ga0495668_0001057 Ga0495668_0001057_13506_14393 291
163 3300046648 Ga0495611_0007783 Ga0495611_0007783_1585_2520 291
164 3300046648 Ga0495611_0026275 Ga0495611_0026275_1222_2157 291
165 3300046648 Ga0495611_0057820 Ga0495611_0057820_290_1177 291
166 3300046660 Ga0495625_0011760 Ga0495625_0011760_2478_3413 291
167 3300046664 Ga0495659_0000556 Ga0495659_0000556_11506_12441 291
168 3300046664 Ga0495659_0008442 Ga0495659_0008442_2280_3224 291
169 3300046665 Ga0495661_0075826 Ga0495661_0075826_868_1803 291
170 3300046689 Ga0495613_0067889 Ga0495613_0067889_651_1559 291
171 3300046690 Ga0495624_0017131 Ga0495624_0017131_3405_4313 291
172 3300046691 Ga0495670_0010315 Ga0495670_0010315_1787_2722 291
173 3300046692 Ga0495671_0021953 Ga0495671_0021953_545_1480 291
174 3300046810 Ga0495660_0000418 Ga0495660_0000418_12492_13388 291
175 3300046810 Ga0495660_0000490 Ga0495660_0000490_8482_9399 291
176 3300047315 Ga0495581_0027542 Ga0495581_0027542_312_1220 291
177 3300047315 Ga0495581_0154597 Ga0495581_0154597_255_1148 291
178 3300047318 Ga0495636_0001587 Ga0495636_0001587_1465_2409 291
179 3300047318 Ga0495636_0001902 Ga0495636_0001902_4306_5241 291
180 3300047320 Ga0495672_0017633 Ga0495672_0017633_442_1377 291
181 3300047323 Ga0495683_0001752 Ga0495683_0001752_8751_9686 291
182 3300047443 Ga0495687_000497 Ga0495687_000497_35059_35994 291
183 3300047447 Ga0495685_000038 Ga0495685_000038_953_1888 291
184 3300047469 Ga0495673_0005679 Ga0495673_0005679_2255_3190 291
185 3300047472 Ga0495686_0013034 Ga0495686_0013034_3415_4302 291
186 3300047673 Ga0495593_0036605 Ga0495593_0036605_1246_2154 291
187 3300048088 Ga0495602_0165132 Ga0495602_0165132_308_1216 291
188 3300048091 Ga0495626_0002229 Ga0495626_0002229_7512_8441 291
189 3300048091 Ga0495626_0002754 Ga0495626_0002754_9786_10730 291
190 3300048905 Ga0496102_0029095 Ga0496102_0029095_3216_4157 291
191 3300048905 Ga0496102_0037188 Ga0496102_0037188_1086_1979 291
192 3300048918 Ga0496115_0142317 Ga0496115_0142317_141_1025 291
193 3300048919 Ga0496116_0007434 Ga0496116_0007434_34_951 291
194 3300048919 Ga0496116_0039061 Ga0496116_0039061_932_1819 291
195 3300048927 Ga0496124_0150134 Ga0496124_0150134_412_1299 291
196 3300048927 Ga0496124_0159771 Ga0496124_0159771_54_941 291
197 3300049459 Ga0495678_002076 Ga0495678_002076_9106_10041 291
198 3300049460 Ga0495682_0000327 Ga0495682_0000327_16315_17250 291
199 3300049460 Ga0495682_0007938 Ga0495682_0007938_3109_4044 291
200 3300049671 Ga0501238_000719 Ga0501238_000719_2539_3432 291
201 3300053118 Ga0500594_0002150 Ga0500594_0002150_114_1010 291
202 3300002738 JGI25154J39366_1001122 JGI25154J39366_10011225 292
203 3300003771 Ga0055526_1000042 Ga0055526_100004225 292
204 3300009036 Ga0105244_10004984 Ga0105244_100049842 292
205 3300025246 Ga0209646_1000036 Ga0209646_1000036327 292
206 3300025295 Ga0209564_1000032 Ga0209564_100003267 292
207 3300025728 Ga0207655_1019902 Ga0207655_10199022 292
208 3300028794 Ga0307515_10243820 Ga0307515_102438201 292
209 3300045049 Ga0466959_0105471 Ga0466959_0105471_439_1344 292
210 3300046452 Ga0495617_002544 Ga0495617_002544_2477_3394 292
211 3300046457 Ga0495590_0000011 Ga0495590_0000011_158985_159881 292
212 3300046460 Ga0495638_0000058 Ga0495638_0000058_22531_23427 292
213 3300046471 Ga0495650_0000397 Ga0495650_0000397_47166_48056 292
214 3300046471 Ga0495650_0004064 Ga0495650_0004064_465_1361 292
215 3300046471 Ga0495650_0017649 Ga0495650_0017649_2590_3486 292
216 3300046501 Ga0495607_0034723 Ga0495607_0034723_631_1539 292
217 3300046506 Ga0495583_0000076 Ga0495583_0000076_104845_105741 292
218 3300046507 Ga0495606_0000757 Ga0495606_0000757_5547_6452 292
219 3300046507 Ga0495606_0000897 Ga0495606_0000897_22739_23647 292
220 3300046507 Ga0495606_0001963 Ga0495606_0001963_20695_21693 292
221 3300046507 Ga0495606_0032505 Ga0495606_0032505_1654_2559 292
222 3300046507 Ga0495606_0057437 Ga0495606_0057437_357_1271 292
223 3300046512 Ga0495610_0006754 Ga0495610_0006754_2233_3117 292
224 3300046512 Ga0495610_0009476 Ga0495610_0009476_4898_5800 292
225 3300046512 Ga0495610_0010235 Ga0495610_0010235_1400_2305 292
226 3300046512 Ga0495610_0031071 Ga0495610_0031071_660_1562 292
227 3300046520 Ga0495637_0000500 Ga0495637_0000500_12010_12906 292
228 3300046520 Ga0495637_0024630 Ga0495637_0024630_1773_2690 292
229 3300046522 Ga0495643_0000119 Ga0495643_0000119_121055_121939 292
230 3300046522 Ga0495643_0000153 Ga0495643_0000153_5945_6841 292
231 3300046524 Ga0495648_0000010 Ga0495648_0000010_45068_45964 292
232 3300046524 Ga0495648_0027824 Ga0495648_0027824_206_1090 292
233 3300046528 Ga0495642_0039436 Ga0495642_0039436_558_1454 292
234 3300046530 Ga0495654_0000046 Ga0495654_0000046_69290_70186 292
235 3300046542 Ga0495597_0000043 Ga0495597_0000043_101922_102818 292
236 3300046542 Ga0495597_0000810 Ga0495597_0000810_5751_6635 292
237 3300046557 Ga0495622_0000295 Ga0495622_0000295_32387_33283 292
238 3300046558 Ga0495633_0000132 Ga0495633_0000132_27222_28115 292
239 3300046558 Ga0495633_0001778 Ga0495633_0001778_2179_3081 292
240 3300046558 Ga0495633_0002815 Ga0495633_0002815_933_1829 292
241 3300046616 Ga0495668_0000045 Ga0495668_0000045_140038_140934 292
242 3300046660 Ga0495625_0000393 Ga0495625_0000393_4123_5013 292
243 3300046660 Ga0495625_0000566 Ga0495625_0000566_32291_33187 292
244 3300046660 Ga0495625_0003913 Ga0495625_0003913_5088_5972 292
245 3300046660 Ga0495625_0006531 Ga0495625_0006531_3861_4775 292
246 3300046664 Ga0495659_0000196 Ga0495659_0000196_22671_23585 292
247 3300046692 Ga0495671_0000495 Ga0495671_0000495_6568_7482 292
248 3300046692 Ga0495671_0142659 Ga0495671_0142659_208_1092 292
249 3300046694 Ga0495649_0033973 Ga0495649_0033973_1148_2032 292
250 3300047320 Ga0495672_0000113 Ga0495672_0000113_27191_28075 292
251 3300047320 Ga0495672_0000161 Ga0495672_0000161_90981_91895 292
252 3300047443 Ga0495687_000795 Ga0495687_000795_9324_10220 292
253 3300047443 Ga0495687_000990 Ga0495687_000990_9336_10232 292
254 3300047469 Ga0495673_0000096 Ga0495673_0000096_47854_48780 292
255 3300048906 Ga0496103_0000878 Ga0496103_0000878_18000_18902 292
256 3300049459 Ga0495678_000001 Ga0495678_000001_272431_273360 292
257 3300049459 Ga0495678_000111 Ga0495678_000111_71737_72621 292
258 3300049766 Ga0501269_000554 Ga0501269_000554_5181_6083 292
259 iso_pu_bacteria 2643221645 2644250130 292
260 iso_pu_bacteria 2643221664 2644360001 292
261 iso_pu_bacteria 2738541280 2738742829 292
262 iso_pu_bacteria 2738541300 2738847099 292
263 iso_pu_bacteria 2738543018 2739277700 292
264 iso_pu_bacteria 2738543030 2739346743 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

14

75

0.94

PF04321

RmlD_sub_bind

RmlD substrate binding domain

13

270

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

14

213

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ius-assembly2.cif.gz_B the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.8433 12 291
3ic5-assembly2.cif.gz_B n-terminal domain of putative saccharopine dehydrogenase from ruegeria pomeroyi. 0.8409 11 82
3ius-assembly1.cif.gz_A the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.838 12 291
3ius-assembly2.cif.gz_B the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.8147 12 291
3ius-assembly1.cif.gz_A the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.8102 12 291
ID Description Score Start End Superfamily
3iusB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8383 12 291 3.40.50.720
af_Q54L85_1_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8378 11 291 3.40.50.720
af_Q8VZB1_86_348_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8352 13 290 3.40.50.720
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8319 13 249 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8302 13 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2N7RPH7-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.997 163 291
AF-A0A5E4W7I2-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9915 174 292
AF-V2JIN2-F1-model_v4 NAD-dependent dehydratase 0.99 139 292 GO:0004029
GO:0005737
AF-A0A6L3N9H8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9898 159 291
AF-A0A6I6M861-F1-model_v4 deleted 0.9834 1 291

Feature Viewer

pLDDT pTM Quality
93.27 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map