F372801

General Info

Members Datasets Scaffolds Average Seq Length
264 172 530 215

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_008729|Ga0495627_008729_1777_2505
Length 242
Sequence LADDKTILTFPSSFLDATFVSLKIKKMAVQKLKNVAGITIPDSKIATEATELLLEHGTEFIYNHSLRVFLFSSLNGKRQNMKYDEELLYVSSVFHDLGLVPHYSSPDLRFEVDGANAARDFLKSHGISNDKLQLVWDTIALHTTIGIAEHKENEVALMYSGVGLDVMGEGYEHLSEDNRNEIIKAFPRNDFKKNIIPTFFEGFKHKTETTFGNIKADVCAFMIPNFERKNFCNCILHSPWSE

Samples

Sample ID Description Type Environment
1 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
83 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
99 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
133 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
134 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
135 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
136 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
139 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
142 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
145 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
146 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
147 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
148 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
149 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
150 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
151 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
152 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
153 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
154 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
155 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
156 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
157 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
158 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
159 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
160 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
161 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
162 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
163 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
164 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
165 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
166 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
167 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
168 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
169 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
170 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
171 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
172 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.26
Metatranscriptomes 0.38
Isolates 11.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.15
Nodule 0.38
Rhizoplane 1.52
Rhizosphere 65.53
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495627_008729 3300046453 Bacteria 3777
2 SwRhRL2b_contig_1013487 2162886007 Bacteria 49455
3 JGI24740J21852_10023398 3300001979 Bacteria 2111
4 JGI24737J22298_10005536 3300001990 Bacteria 4356
5 JGI24735J21928_10000001 3300002067 Bacteria 650042
6 JGI25162J39368_1000012 3300002737 Bacteria 373191
7 JGI25153J46596_10029006 3300003215 Bacteria 1907
8 JGI25153J46596_10031465 3300003215 Bacteria 1786
9 rootH1_10058628 3300003316 Bacteria 3742
10 rootH1_10058628 3300003323 Bacteria 18017
11 rootH2_10303886 3300003320 Bacteria 3061
12 rootL2_10003234 3300003322 Bacteria 5012
13 rootL2_10077778 3300003322 Bacteria 1297
14 rootL2_10109034 3300003322 Bacteria 3432
15 rootL2_10268332 3300003322 Bacteria 1986
16 rootH1_10055917 3300003316 Bacteria 2465
17 rootH1_10055917 3300003323 Bacteria 5337
18 rootH1_10078312 3300003323 Bacteria 15744
19 rootH1_10329708 3300003323 Bacteria 3350
20 JGI25160J50197_1000867 3300003354 Bacteria 16038
21 JGI25160J50197_1007189 3300003354 Bacteria 4386
22 Ga0055526_1016835 3300003771 Bacteria 2831
23 Ga0055536_1012978 3300003781 Bacteria 3042
24 Ga0055534_1023770 3300003784 Bacteria 1000
25 Ga0055528_1000122 3300003790 Bacteria 61910
26 Ga0055530_10000192 3300003791 Bacteria 54681
27 Ga0055531_10000102 3300003794 Bacteria 92703
28 Ga0055531_10062905 3300003794 Bacteria 895
29 Ga0055543_1011925 3300004625 Bacteria 1762
30 Ga0065165_1000066 3300005262 Bacteria 172490
31 Ga0065165_1003174 3300005262 Bacteria 12041
32 Ga0065714_10067106 3300005288 Bacteria 5881
33 Ga0065714_10068365 3300005288 Bacteria 4775
34 Ga0065714_10075329 3300005288 Unclassified 2914
35 Ga0065714_10075439 3300005288 Bacteria 2902
36 Ga0065704_10073131 3300005289 Bacteria 7552
37 Ga0070666_10042008 3300005335 Bacteria 3057
38 Ga0070682_100000245 3300005337 Bacteria 39270
39 Ga0068868_100427962 3300005338 Bacteria 1147
40 Ga0070660_100056018 3300005339 Bacteria 3049
41 Ga0070708_100018477 3300005445 Bacteria 5834
42 Ga0070698_100002069 3300005471 Bacteria 22295
43 Ga0070699_100007311 3300005518 Bacteria 9612
44 Ga0068853_100003792 3300005539 Bacteria 11582
45 Ga0068853_100369212 3300005539 Bacteria 1338
46 Ga0068855_100040541 3300005563 Bacteria 5527
47 Ga0068854_100660447 3300005578 Bacteria 899
48 Ga0070717_10025156 3300006028 Bacteria 4730
49 Ga0075366_10137840 3300006195 Bacteria 1474
50 Ga0105244_10000244 3300009036 Bacteria 55612
51 Ga0105240_10000059 3300009093 Bacteria 219860
52 Ga0105240_10000100 3300009093 Bacteria 176640
53 Ga0105240_10262633 3300009093 Bacteria 1991
54 Ga0105243_10000408 3300009148 Bacteria 45109
55 Ga0105243_10031291 3300009148 Bacteria 4102
56 Ga0105243_10055499 3300009148 Bacteria 3148
57 Ga0105241_10587531 3300009174 Bacteria 1004
58 Ga0105237_10008552 3300009545 Bacteria 11065
59 Ga0105237_10035395 3300009545 Bacteria 5053
60 Ga0105238_10145168 3300009551 Bacteria 2349
61 Ga0105239_10000117 3300010375 Bacteria 112291
62 Ga0105239_10074027 3300010375 Bacteria 3745
63 Ga0105239_10449104 3300010375 Bacteria 1462
64 Ga0105239_10831155 3300010375 Bacteria 1059
65 Ga0157373_10002593 3300013100 Bacteria 13729
66 Ga0157373_10057798 3300013100 Bacteria 2751
67 Ga0157373_10272111 3300013100 Bacteria 1199
68 Ga0157371_10456009 3300013102 Bacteria 940
69 Ga0157370_10000103 3300013104 Bacteria 97072
70 Ga0157370_10001172 3300013104 Bacteria 32684
71 Ga0157370_10001460 3300013104 Bacteria 29235
72 Ga0157370_10004370 3300013104 Bacteria 16227
73 Ga0157370_10038164 3300013104 Bacteria 4647
74 Ga0157370_10061465 3300013104 Bacteria 3565
75 Ga0157370_10089085 3300013104 Bacteria 2898
76 Ga0157370_10162238 3300013104 Bacteria 2079
77 Ga0157369_10038224 3300013105 Bacteria 5248
78 Ga0157369_10067260 3300013105 Plasmid 3853
79 Ga0163162_10015623 3300013306 Bacteria 7419
80 Ga0163162_10529847 3300013306 Unclassified 1307
81 Ga0157372_10170559 3300013307 Plasmid 2518
82 Ga0157375_10000218 3300013308 Bacteria 53847
83 Ga0157375_10066124 3300013308 Bacteria 3607
84 Ga0157375_10625933 3300013308 Bacteria 1234
85 Ga0163163_10041164 3300014325 Unclassified 4517
86 Ga0182006_1009666 3300015261 Bacteria 4315
87 Ga0163161_10001081 3300017792 Bacteria 20628
88 Ga0163161_10001325 3300017792 Bacteria 18423
89 Ga0163161_10098693 3300017792 Bacteria 2171
90 Ga0209437_100041 3300025233 Bacteria 444465
91 Ga0209673_1000049 3300025273 Bacteria 286207
92 Ga0209675_1000032 3300025291 Bacteria 273013
93 Ga0209675_1058263 3300025291 Bacteria 772
94 Ga0209676_1000579 3300025292 Bacteria 55137
95 Ga0209564_1007341 3300025295 Bacteria 5713
96 Ga0209758_1003047 3300025297 Bacteria 15952
97 Ga0209758_1006793 3300025297 Bacteria 8027
98 Ga0209758_1027268 3300025297 Bacteria 2445
99 Ga0209050_1000129 3300025298 Bacteria 186356
100 Ga0207426_1000782 3300025302 Bacteria 34779
101 Ga0207426_1001379 3300025302 Bacteria 20571
102 Ga0209051_1036275 3300025303 Bacteria 1823
103 Ga0209257_1000004 3300025304 Bacteria 1678347
104 Ga0209257_1001137 3300025304 Bacteria 34045
105 Ga0209257_1060412 3300025304 Bacteria 1031
106 Ga0207655_1000702 3300025728 Bacteria 38833
107 Ga0207680_10076486 3300025903 Bacteria 2090
108 Ga0207684_10572652 3300025910 Bacteria 965
109 Ga0207695_10000027 3300025913 Bacteria 612456
110 Ga0207695_10000039 3300025913 Bacteria 454801
111 Ga0207695_10777077 3300025913 Bacteria 838
112 Ga0207671_10004569 3300025914 Bacteria 13149
113 Ga0207671_10010114 3300025914 Bacteria 7818
114 Ga0207709_10000458 3300025935 Bacteria 37753
115 Ga0207667_10033642 3300025949 Bacteria 5510
116 Ga0207639_10019211 3300026041 Bacteria 4869
117 Ga0207674_10508288 3300026116 Bacteria 1164
118 Ga0265760_10144483 3300031090 Bacteria 776
119 Ga0265327_10000010 3300031251 Bacteria 566817
120 Ga0307513_10122427 3300031456 Bacteria 2565
121 Ga0307513_10409198 3300031456 Bacteria 1089
122 Ga0265314_10204820 3300031711 Bacteria 1163
123 Ga0307407_10000007 3300031903 Bacteria 210716
124 Ga0307412_10000029 3300031911 Bacteria 209074
125 Ga0307412_10431905 3300031911 Bacteria 1080
126 Ga0307409_100157523 3300031995 Bacteria 1981
127 Ga0307416_100000015 3300032002 Bacteria 210716
128 Ga0307414_10004023 3300032004 Bacteria 7936
129 Ga0307414_10008294 3300032004 Bacteria 5883
130 Ga0307414_10060925 3300032004 Unclassified 2671
131 Ga0307414_10253687 3300032004 Bacteria 1464
132 Ga0395900_0126747 3300037418 Bacteria 2619
133 Ga0395905_0141997 3300037471 Bacteria 2259
134 Ga0395905_0264645 3300037471 Unclassified 1605
135 Ga0439431_0020248 3300041997 Bacteria 1588
136 Ga0439445_0000563 3300042004 Bacteria 7572
137 Ga0466969_0040698 3300044656 Bacteria 2328
138 Ga0466969_0275470 3300044656 Unclassified 762
139 Ga0466972_0000002 3300044658 Bacteria 408005
140 Ga0466972_0000127 3300044658 Bacteria 63923
141 Ga0466982_0061445 3300044672 Bacteria 2313
142 Ga0466965_0733253 3300044683 Bacteria 569
143 Ga0466966_0019469 3300044684 Bacteria 4465
144 Ga0466961_0037724 3300044693 Bacteria 3100
145 Ga0466963_0229610 3300044694 Bacteria 1300
146 Ga0466971_0019169 3300044719 Bacteria 3037
147 Ga0466970_0000159 3300044765 Bacteria 32178
148 Ga0466970_0018412 3300044765 Unclassified 3614
149 Ga0466970_0062072 3300044765 Bacteria 2003
150 Ga0466957_0052482 3300044842 Bacteria 2483
151 Ga0466959_0115574 3300045049 Bacteria 1911
152 Ga0466958_0042369 3300045836 Plasmid 2741
153 Ga0466967_0086815 3300045976 Bacteria 2835
154 Ga0495638_0025508 3300046460 Bacteria 3841
155 Ga0495650_0000273 3300046471 Bacteria 98757
156 Ga0495650_0072384 3300046471 Bacteria 1349
157 Ga0495605_0033595 3300046474 Bacteria 2602
158 Ga0495596_0000771 3300046500 Bacteria 19541
159 Ga0495606_0000130 3300046507 Bacteria 127805
160 Ga0495606_0011386 3300046507 Bacteria 7259
161 Ga0495606_0012575 3300046507 Bacteria 6775
162 Ga0495606_0025032 3300046507 Bacteria 4284
163 Ga0495606_0030949 3300046507 Bacteria 3728
164 Ga0495610_0000460 3300046512 Bacteria 42065
165 Ga0495610_0012305 3300046512 Bacteria 5160
166 Ga0495616_0003212 3300046513 Bacteria 10534
167 Ga0495616_0013165 3300046513 Bacteria 4675
168 Ga0495637_0019017 3300046520 Unclassified 3181
169 Ga0495643_0069992 3300046522 Bacteria 1843
170 Ga0495663_0008495 3300046525 Bacteria 2846
171 Ga0495652_0308265 3300046529 Bacteria 1148
172 Ga0495633_0026872 3300046558 Bacteria 2818
173 Ga0495625_0001013 3300046660 Bacteria 37051
174 Ga0495625_0015722 3300046660 Bacteria 5979
175 Ga0495625_0040302 3300046660 Bacteria 3408
176 Ga0495625_0142914 3300046660 Bacteria 1613
177 Ga0495661_0002813 3300046665 Bacteria 13183
178 Ga0495661_0029948 3300046665 Bacteria 3469
179 Ga0495649_0000419 3300046694 Bacteria 36929
180 Ga0495660_0060301 3300046810 Unclassified 2038
181 Ga0495660_0124914 3300046810 Bacteria 1297
182 Ga0495683_0093703 3300047323 Bacteria 1452
183 Ga0495686_0000106 3300047472 Bacteria 175852
184 Ga0495686_0001353 3300047472 Bacteria 27388
185 Ga0495686_0025292 3300047472 Bacteria 3893
186 Ga0495686_0072415 3300047472 Bacteria 2119
187 Ga0495686_0237477 3300047472 Bacteria 1029
188 Ga0496101_0125473 3300048904 Bacteria 1945
189 Ga0496106_0015027 3300048909 Bacteria 5730
190 Ga0496115_0027666 3300048918 Bacteria 4437
191 Ga0496115_0036978 3300048918 Unclassified 3867
192 Ga0496116_0000012 3300048919 Bacteria 611365
193 Ga0496117_0000050 3300048920 Bacteria 292727
194 Ga0496117_0001128 3300048920 Bacteria 40283
195 Ga0496118_0000044 3300048921 Bacteria 283524
196 Ga0496118_0269523 3300048921 Bacteria 955
197 Ga0496119_0000002 3300048922 Bacteria 738385
198 Ga0496120_0081516 3300048923 Bacteria 1751
199 Ga0496121_0000026 3300048924 Bacteria 450157
200 Ga0496121_0027765 3300048924 Bacteria 5288
201 Ga0496122_0000090 3300048925 Bacteria 205886
202 Ga0496122_0000658 3300048925 Bacteria 69587
203 Ga0496122_0002758 3300048925 Bacteria 24241
204 Ga0496122_0018483 3300048925 Bacteria 6433
205 Ga0496123_0000856 3300048926 Bacteria 48564
206 Ga0496123_0005161 3300048926 Bacteria 13286
207 Ga0496123_0087525 3300048926 Bacteria 1863
208 Ga0496123_0091849 3300048926 Bacteria 1799
209 Ga0496124_0008955 3300048927 Bacteria 10368
210 Ga0496124_0104663 3300048927 Bacteria 2288
211 Ga0496125_0000349 3300048928 Bacteria 87610
212 Ga0496125_0000844 3300048928 Bacteria 49221
213 Ga0496125_0015935 3300048928 Bacteria 7240
214 Ga0496125_0046558 3300048928 Bacteria 3638
215 Ga0496126_0001903 3300048929 Bacteria 30010
216 Ga0496126_0025813 3300048929 Bacteria 5645
217 Ga0496126_0095326 3300048929 Bacteria 2610
218 Ga0495678_007087 3300049459 Bacteria 5863
219 Ga0495678_131055 3300049459 Unclassified 831
220 Ga0501043_0559205 3300049579 Bacteria 849
221 Ga0501047_0004089 3300049581 Bacteria 13726
222 Ga0501238_034353 3300049671 Unclassified 737
223 Ga0501261_003097 3300049690 Bacteria 2042
224 Ga0501225_0000165 3300049705 Bacteria 19966
225 Ga0501241_000440 3300049758 Bacteria 9077
226 Ga0501241_014253 3300049758 Bacteria 1444
227 Ga0501266_018899 3300049763 Bacteria 929
228 nmdc:mga0k408_45194_c1 3300050493 Bacteria 2540
229 Ga0500635_0000677 3300053080 Bacteria 8620
230 Ga0500578_0000029 3300053086 Bacteria 140078
231 Ga0500578_0034274 3300053086 Bacteria 3262
232 Ga0500568_0030278 3300053139 Bacteria 2242
233 Ga0500622_0000249 3300053156 Bacteria 54675
234 Ga0500622_0005725 3300053156 Bacteria 7383
235 Ga0500587_016833 3300053739 Bacteria 935
236 Ga0466962_0015574 3300061719 Bacteria 3667
237 2522550707 2522125168 Bacteria 7376607
238 2585144836 2582581278 Bacteria 5296881
239 2587679685 2585428045 Bacteria 5203023
240 2587748722 2585428060 Bacteria 5304711
241 2587867350 2585428095 Bacteria 3789702
242 2588208440 2585428182 Bacteria 5007281
243 2588213059 2585428183 Bacteria 5166119
244 2588219651 2585428184 Bacteria 4978681
245 2588224038 2585428185 Bacteria 4969476
246 2588447656 2588253712 Bacteria 5403181
247 2590600989 2588254255 Bacteria 5014294
248 2590610300 2588254257 Bacteria 5436094
249 2644008986 2643221600 Bacteria 5530138
250 2722728317 2721755487 Bacteria 6357185
251 2740060748 2739367874 Bacteria 4872888
252 2765572436 2765235839 Bacteria 5314748
253 2816872720 2816332188 Bacteria 5133218
254 2871721753 2871720351 Bacteria 4862476
255 2889291927 2889290771 Bacteria 5530962
256 2896112210 2896109856 Bacteria 7140722
257 2904556775 2904555929 Bacteria 5218588
258 2919191573 2919191525 Bacteria 5765973
259 2919441824 2919437846 Bacteria 6199444
260 2929239536 2929239360 Bacteria 7745570
261 2929244067 2929239360 Bacteria 7745570
262 2929923807 2929921140 Bacteria 8649150
263 2932085843 2932082852 Bacteria 6563563
264 2945927413 2945924605 Bacteria 4296724
265 2954019586 2954016120 Bacteria 6446024
266 8003153514 8003151029 Bacteria 8187759
267 Ga0495627_008729
268 SwRhRL2b_contig_1013487
269 JGI24740J21852_10023398
270 JGI24737J22298_10005536
271 JGI24735J21928_10000001
272 JGI25162J39368_1000012
273 JGI25153J46596_10029006
274 JGI25153J46596_10031465
275 rootH1_10058628
276 rootH2_10303886
277 rootL2_10003234
278 rootL2_10077778
279 rootL2_10109034
280 rootL2_10268332
281 rootH1_10055917
282 rootH1_10078312
283 rootH1_10329708
284 JGI25160J50197_1000867
285 JGI25160J50197_1007189
286 Ga0055526_1016835
287 Ga0055536_1012978
288 Ga0055534_1023770
289 Ga0055528_1000122
290 Ga0055530_10000192
291 Ga0055531_10000102
292 Ga0055531_10062905
293 Ga0055543_1011925
294 Ga0065165_1000066
295 Ga0065165_1003174
296 Ga0065714_10067106
297 Ga0065714_10068365
298 Ga0065714_10075329
299 Ga0065714_10075439
300 Ga0065704_10073131
301 Ga0070666_10042008
302 Ga0070682_100000245
303 Ga0068868_100427962
304 Ga0070660_100056018
305 Ga0070708_100018477
306 Ga0070698_100002069
307 Ga0070699_100007311
308 Ga0068853_100003792
309 Ga0068853_100369212
310 Ga0068855_100040541
311 Ga0068854_100660447
312 Ga0070717_10025156
313 Ga0075366_10137840
314 Ga0105244_10000244
315 Ga0105240_10000059
316 Ga0105240_10000100
317 Ga0105240_10262633
318 Ga0105243_10000408
319 Ga0105243_10031291
320 Ga0105243_10055499
321 Ga0105241_10587531
322 Ga0105237_10008552
323 Ga0105237_10035395
324 Ga0105238_10145168
325 Ga0105239_10000117
326 Ga0105239_10074027
327 Ga0105239_10449104
328 Ga0105239_10831155
329 Ga0157373_10002593
330 Ga0157373_10057798
331 Ga0157373_10272111
332 Ga0157371_10456009
333 Ga0157370_10000103
334 Ga0157370_10001172
335 Ga0157370_10001460
336 Ga0157370_10004370
337 Ga0157370_10038164
338 Ga0157370_10061465
339 Ga0157370_10089085
340 Ga0157370_10162238
341 Ga0157369_10038224
342 Ga0157369_10067260
343 Ga0163162_10015623
344 Ga0163162_10529847
345 Ga0157372_10170559
346 Ga0157375_10000218
347 Ga0157375_10066124
348 Ga0157375_10625933
349 Ga0163163_10041164
350 Ga0182006_1009666
351 Ga0163161_10001081
352 Ga0163161_10001325
353 Ga0163161_10098693
354 Ga0209437_100041
355 Ga0209673_1000049
356 Ga0209675_1000032
357 Ga0209675_1058263
358 Ga0209676_1000579
359 Ga0209564_1007341
360 Ga0209758_1003047
361 Ga0209758_1006793
362 Ga0209758_1027268
363 Ga0209050_1000129
364 Ga0207426_1000782
365 Ga0207426_1001379
366 Ga0209051_1036275
367 Ga0209257_1000004
368 Ga0209257_1001137
369 Ga0209257_1060412
370 Ga0207655_1000702
371 Ga0207680_10076486
372 Ga0207684_10572652
373 Ga0207695_10000027
374 Ga0207695_10000039
375 Ga0207695_10777077
376 Ga0207671_10004569
377 Ga0207671_10010114
378 Ga0207709_10000458
379 Ga0207667_10033642
380 Ga0207639_10019211
381 Ga0207674_10508288
382 Ga0265760_10144483
383 Ga0265327_10000010
384 Ga0307513_10122427
385 Ga0307513_10409198
386 Ga0265314_10204820
387 Ga0307407_10000007
388 Ga0307412_10000029
389 Ga0307412_10431905
390 Ga0307409_100157523
391 Ga0307416_100000015
392 Ga0307414_10004023
393 Ga0307414_10008294
394 Ga0307414_10060925
395 Ga0307414_10253687
396 Ga0395900_0126747
397 Ga0395905_0141997
398 Ga0395905_0264645
399 Ga0439431_0020248
400 Ga0439445_0000563
401 Ga0466969_0040698
402 Ga0466969_0275470
403 Ga0466972_0000002
404 Ga0466972_0000127
405 Ga0466982_0061445
406 Ga0466965_0733253
407 Ga0466966_0019469
408 Ga0466961_0037724
409 Ga0466963_0229610
410 Ga0466971_0019169
411 Ga0466970_0000159
412 Ga0466970_0018412
413 Ga0466970_0062072
414 Ga0466957_0052482
415 Ga0466959_0115574
416 Ga0466958_0042369
417 Ga0466967_0086815
418 Ga0495638_0025508
419 Ga0495650_0000273
420 Ga0495650_0072384
421 Ga0495605_0033595
422 Ga0495596_0000771
423 Ga0495606_0000130
424 Ga0495606_0011386
425 Ga0495606_0012575
426 Ga0495606_0025032
427 Ga0495606_0030949
428 Ga0495610_0000460
429 Ga0495610_0012305
430 Ga0495616_0003212
431 Ga0495616_0013165
432 Ga0495637_0019017
433 Ga0495643_0069992
434 Ga0495663_0008495
435 Ga0495652_0308265
436 Ga0495633_0026872
437 Ga0495625_0001013
438 Ga0495625_0015722
439 Ga0495625_0040302
440 Ga0495625_0142914
441 Ga0495661_0002813
442 Ga0495661_0029948
443 Ga0495649_0000419
444 Ga0495660_0060301
445 Ga0495660_0124914
446 Ga0495683_0093703
447 Ga0495686_0000106
448 Ga0495686_0001353
449 Ga0495686_0025292
450 Ga0495686_0072415
451 Ga0495686_0237477
452 Ga0496101_0125473
453 Ga0496106_0015027
454 Ga0496115_0027666
455 Ga0496115_0036978
456 Ga0496116_0000012
457 Ga0496117_0000050
458 Ga0496117_0001128
459 Ga0496118_0000044
460 Ga0496118_0269523
461 Ga0496119_0000002
462 Ga0496120_0081516
463 Ga0496121_0000026
464 Ga0496121_0027765
465 Ga0496122_0000090
466 Ga0496122_0000658
467 Ga0496122_0002758
468 Ga0496122_0018483
469 Ga0496123_0000856
470 Ga0496123_0005161
471 Ga0496123_0087525
472 Ga0496123_0091849
473 Ga0496124_0008955
474 Ga0496124_0104663
475 Ga0496125_0000349
476 Ga0496125_0000844
477 Ga0496125_0015935
478 Ga0496125_0046558
479 Ga0496126_0001903
480 Ga0496126_0025813
481 Ga0496126_0095326
482 Ga0495678_007087
483 Ga0495678_131055
484 Ga0501043_0559205
485 Ga0501047_0004089
486 Ga0501238_034353
487 Ga0501261_003097
488 Ga0501225_0000165
489 Ga0501241_000440
490 Ga0501241_014253
491 Ga0501266_018899
492 nmdc:mga0k408_45194_c1
493 Ga0500635_0000677
494 Ga0500578_0000029
495 Ga0500578_0034274
496 Ga0500568_0030278
497 Ga0500622_0000249
498 Ga0500622_0005725
499 Ga0500587_016833
500 Ga0466962_0015574
501 2522550707
502 2585144836
503 2587679685
504 2587748722
505 2587867350
506 2588208440
507 2588213059
508 2588219651
509 2588224038
510 2588447656
511 2590600989
512 2590610300
513 2644008986
514 2722728317
515 2740060748
516 2765572436
517 2816872720
518 2871721753
519 2889291927
520 2896112210
521 2904556775
522 2919191573
523 2919441824
524 2929239536
525 2929244067
526 2929923807
527 2932085843
528 2945927413
529 2954019586
530 8003153514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

61

186

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8688 3 181
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.8674 3 181
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8662 3 181
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7249 3 181
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.7242 3 181
ID Description Score Start End Superfamily
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9071 16 172 1.10.3210.10
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8756 16 172 1.10.3210.10
af_F4HZF4_333_543_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6553 19 144 1.10.3210.10
af_Q54GY3_13_181_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6031 19 182 1.10.3210.10
af_Q86JB3_16_237_1.10.3210.50 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432; 0.6025 19 179 1.10.3210.50
ID Description Score Start End GO Terms
AF-A0A7W5GAA3-F1-model_v4 HD superfamily phosphodiesterase 0.9952 8 216
AF-A0A1I5G940-F1-model_v4 HD domain-containing protein 0.9921 8 176
AF-A0A0H3KS96-F1-model_v4 Metal-dependent phosphohydrolase 0.9911 9 191
AF-A0A7W5GAA3-F1-model_v4 HD superfamily phosphodiesterase 0.9905 8 216
AF-A0A512JR07-F1-model_v4 HD domain-containing protein 0.9904 8 110

Map