F372835
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 264 | 198 | 260 | 453 |
Family's Representative Sequence
| Representative Sequence | 3300046535|Ga0495586_0030307|Ga0495586_0030307_1063_2559 |
| Length | 479 |
| Sequence | MPDRDIALARAAGYATQWLDSLATRPVPPRASVAEVTVALGTALPDGPAEAPQVIDLLAGACEPGLTAMPSGRFYGFVIGGTHPAALAADWLVSAWDQNAGLLLPTPALAAVENVAKGWLLDVLGLPAGSGVGFVTGATMSNFTCLAAARDAVLHQAGWQVAADGLTGAPRVRVLVGAERHDTVDLALRYLGLGASEVVAADNQGRIDPDALEAALAAVPGAPSGPAIVVLQAGNVHSGAFDPFGPAIEAAHRHGAWVHIDGAFGLFAAASPRTRHLVAGYEAADSWTTDAHKTLNVPYDCGIAIVRDSAALRAAMGMHGEYLIRDAAGDPFEFVPEVSRRARGVPVWAVMRALGRSGLAALVDGYCRHAASFAAGIAGIDGATVENDVVFSRCAPASAATSGPRRSPAGCSPTAPRGCLAPAGAARPCCASRCPTGPPPTTDKRTPQRNLSGNDRGYRSPPAPRQRAGSRSRSARRRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 2 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 3 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 4 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 102 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 106 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 112 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 113 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 120 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 122 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 129 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 132 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 133 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 197 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 198 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 0 |
| Isolates | 1.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.17 |
| Nodule | 0.38 |
| Rhizoplane | 11.36 |
| Rhizosphere | 82.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055539_1000027 | 3300003752 | Bacteria | 258020 |
| 2 | Ga0055533_1000020 | 3300003756 | Bacteria | 353998 |
| 3 | Ga0055525_1000296 | 3300003759 | Bacteria | 43199 |
| 4 | Ga0070658_10042767 | 3300005327 | Bacteria | 3659 |
| 5 | Ga0070683_100000365 | 3300005329 | Bacteria | 31299 |
| 6 | Ga0070683_100008624 | 3300005329 | Bacteria | 8662 |
| 7 | Ga0070683_100019448 | 3300005329 | Bacteria | 6032 |
| 8 | Ga0070666_10009075 | 3300005335 | Bacteria | 6200 |
| 9 | Ga0070666_10127725 | 3300005335 | Bacteria | 1765 |
| 10 | Ga0070682_100002279 | 3300005337 | Bacteria | 10617 |
| 11 | Ga0068868_100051508 | 3300005338 | Bacteria | 3239 |
| 12 | Ga0070660_100043961 | 3300005339 | Bacteria | 3414 |
| 13 | Ga0070687_100045108 | 3300005343 | Bacteria | 2249 |
| 14 | Ga0070692_10003215 | 3300005345 | Bacteria | 6576 |
| 15 | Ga0070692_10006570 | 3300005345 | Bacteria | 5058 |
| 16 | Ga0070668_100131132 | 3300005347 | Bacteria | 2012 |
| 17 | Ga0070669_100121418 | 3300005353 | Bacteria | 1994 |
| 18 | Ga0070671_100004116 | 3300005355 | Bacteria | 11482 |
| 19 | Ga0070674_100106599 | 3300005356 | Bacteria | 2051 |
| 20 | Ga0070659_100047501 | 3300005366 | Bacteria | 3367 |
| 21 | Ga0070667_100040377 | 3300005367 | Bacteria | 3913 |
| 22 | Ga0070667_100041884 | 3300005367 | Bacteria | 3840 |
| 23 | Ga0070714_100044158 | 3300005435 | Bacteria | 3772 |
| 24 | Ga0070714_100080043 | 3300005435 | Bacteria | 2842 |
| 25 | Ga0070713_100044881 | 3300005436 | Bacteria | 3619 |
| 26 | Ga0070701_10010512 | 3300005438 | Bacteria | 4094 |
| 27 | Ga0070705_100020147 | 3300005440 | Bacteria | 3524 |
| 28 | Ga0070700_100021483 | 3300005441 | Bacteria | 3752 |
| 29 | Ga0070700_100055130 | 3300005441 | Bacteria | 2487 |
| 30 | Ga0070708_100019854 | 3300005445 | Bacteria | 5654 |
| 31 | Ga0070663_100104878 | 3300005455 | Bacteria | 2115 |
| 32 | Ga0070681_10137953 | 3300005458 | Bacteria | 2369 |
| 33 | Ga0068867_100011082 | 3300005459 | Bacteria | 6361 |
| 34 | Ga0070706_100077648 | 3300005467 | Bacteria | 3073 |
| 35 | Ga0070707_100009144 | 3300005468 | Bacteria | 9189 |
| 36 | Ga0070698_100013597 | 3300005471 | Bacteria | 8616 |
| 37 | Ga0070698_100068287 | 3300005471 | Bacteria | 3572 |
| 38 | Ga0070684_100003624 | 3300005535 | Bacteria | 11629 |
| 39 | Ga0070684_100032959 | 3300005535 | Bacteria | 4420 |
| 40 | Ga0070672_100190774 | 3300005543 | Bacteria | 1711 |
| 41 | Ga0070693_100036467 | 3300005547 | Bacteria | 2734 |
| 42 | Ga0070665_100000637 | 3300005548 | Bacteria | 47676 |
| 43 | Ga0070665_100001179 | 3300005548 | Bacteria | 32016 |
| 44 | Ga0068856_100187040 | 3300005614 | Bacteria | 2085 |
| 45 | Ga0070702_100005159 | 3300005615 | Bacteria | 6049 |
| 46 | Ga0068864_100083012 | 3300005618 | Bacteria | 2813 |
| 47 | Ga0068863_100001783 | 3300005841 | Bacteria | 21351 |
| 48 | Ga0068858_100005296 | 3300005842 | Bacteria | 12648 |
| 49 | Ga0068860_100000085 | 3300005843 | Bacteria | 166269 |
| 50 | Ga0068862_100071522 | 3300005844 | Bacteria | 2995 |
| 51 | Ga0081539_10003872 | 3300005985 | Bacteria | 17503 |
| 52 | Ga0070717_10193284 | 3300006028 | Bacteria | 1779 |
| 53 | Ga0075364_10028911 | 3300006051 | Bacteria | 3551 |
| 54 | Ga0068865_100029331 | 3300006881 | Bacteria | 3649 |
| 55 | Ga0105245_10016996 | 3300009098 | Bacteria | 6350 |
| 56 | Ga0105245_10019642 | 3300009098 | Bacteria | 5920 |
| 57 | Ga0105245_10094960 | 3300009098 | Bacteria | 2750 |
| 58 | Ga0105243_10032415 | 3300009148 | Bacteria | 4037 |
| 59 | Ga0105243_10144082 | 3300009148 | Bacteria | 2036 |
| 60 | Ga0105242_10073590 | 3300009176 | Bacteria | 2841 |
| 61 | Ga0105248_10266529 | 3300009177 | Bacteria | 1928 |
| 62 | Ga0105249_10045379 | 3300009553 | Bacteria | 3997 |
| 63 | Ga0105249_10052092 | 3300009553 | Bacteria | 3737 |
| 64 | Ga0105239_10001015 | 3300010375 | Bacteria | 39219 |
| 65 | Ga0105239_10052272 | 3300010375 | Bacteria | 4480 |
| 66 | Ga0157378_10014703 | 3300013297 | Bacteria | 6856 |
| 67 | Ga0163162_10045744 | 3300013306 | Bacteria | 4385 |
| 68 | Ga0157372_10000172 | 3300013307 | Bacteria | 71944 |
| 69 | Ga0157372_10002484 | 3300013307 | Bacteria | 19989 |
| 70 | Ga0163163_10033455 | 3300014325 | Bacteria | 4973 |
| 71 | Ga0163163_10235585 | 3300014325 | Bacteria | 1880 |
| 72 | Ga0157380_10006842 | 3300014326 | Bacteria | 8059 |
| 73 | Ga0157380_10055549 | 3300014326 | Bacteria | 3145 |
| 74 | Ga0157380_10056250 | 3300014326 | Bacteria | 3128 |
| 75 | Ga0157377_10087329 | 3300014745 | Bacteria | 1835 |
| 76 | Ga0157379_10017380 | 3300014968 | Bacteria | 6337 |
| 77 | Ga0157379_10040904 | 3300014968 | Bacteria | 4138 |
| 78 | Ga0209566_100366 | 3300025225 | Bacteria | 37636 |
| 79 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 80 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 81 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 82 | Ga0207688_10019663 | 3300025901 | Bacteria | 3681 |
| 83 | Ga0207680_10022070 | 3300025903 | Bacteria | 3457 |
| 84 | Ga0207647_10028619 | 3300025904 | Bacteria | 3617 |
| 85 | Ga0207685_10056809 | 3300025905 | Bacteria | 1533 |
| 86 | Ga0207705_10056964 | 3300025909 | Bacteria | 2819 |
| 87 | Ga0207684_10086345 | 3300025910 | Bacteria | 2672 |
| 88 | Ga0207662_10054151 | 3300025918 | Bacteria | 2392 |
| 89 | Ga0207657_10067988 | 3300025919 | Bacteria | 3028 |
| 90 | Ga0207646_10022376 | 3300025922 | Bacteria | 5825 |
| 91 | Ga0207659_10043910 | 3300025926 | Bacteria | 3143 |
| 92 | Ga0207687_10024263 | 3300025927 | Bacteria | 4049 |
| 93 | Ga0207687_10224143 | 3300025927 | Bacteria | 1482 |
| 94 | Ga0207700_10018516 | 3300025928 | Bacteria | 4683 |
| 95 | Ga0207700_10054676 | 3300025928 | Bacteria | 2998 |
| 96 | Ga0207664_10018832 | 3300025929 | Bacteria | 5092 |
| 97 | Ga0207664_10219647 | 3300025929 | Bacteria | 1647 |
| 98 | Ga0207644_10059588 | 3300025931 | Bacteria | 2761 |
| 99 | Ga0207690_10033282 | 3300025932 | Bacteria | 3313 |
| 100 | Ga0207669_10027466 | 3300025937 | Bacteria | 3117 |
| 101 | Ga0207704_10022805 | 3300025938 | Bacteria | 3362 |
| 102 | Ga0207665_10010132 | 3300025939 | Bacteria | 6188 |
| 103 | Ga0207711_10178868 | 3300025941 | Bacteria | 1928 |
| 104 | Ga0207661_10004837 | 3300025944 | Bacteria | 9438 |
| 105 | Ga0207661_10028632 | 3300025944 | Bacteria | 4269 |
| 106 | Ga0207661_10068804 | 3300025944 | Bacteria | 2884 |
| 107 | Ga0207679_10271686 | 3300025945 | Bacteria | 1450 |
| 108 | Ga0207667_10169757 | 3300025949 | Bacteria | 2242 |
| 109 | Ga0207668_10080963 | 3300025972 | Bacteria | 2354 |
| 110 | Ga0207677_10124052 | 3300026023 | Bacteria | 1948 |
| 111 | Ga0207703_10020607 | 3300026035 | Bacteria | 5158 |
| 112 | Ga0207639_10003095 | 3300026041 | Bacteria | 11182 |
| 113 | Ga0207708_10001891 | 3300026075 | Bacteria | 15462 |
| 114 | Ga0207641_10055891 | 3300026088 | Bacteria | 3352 |
| 115 | Ga0207648_10007397 | 3300026089 | Bacteria | 10809 |
| 116 | Ga0207676_10196227 | 3300026095 | Bacteria | 1780 |
| 117 | Ga0207674_10001716 | 3300026116 | Bacteria | 28034 |
| 118 | Ga0207675_100020019 | 3300026118 | Bacteria | 6243 |
| 119 | Ga0268266_10001563 | 3300028379 | Bacteria | 26774 |
| 120 | Ga0268266_10001751 | 3300028379 | Bacteria | 24833 |
| 121 | Ga0268265_10126635 | 3300028380 | Bacteria | 2115 |
| 122 | Ga0268264_10000031 | 3300028381 | Bacteria | 409525 |
| 123 | Ga0265337_1001178 | 3300028556 | Bacteria | 13321 |
| 124 | Ga0265326_10010612 | 3300028558 | Bacteria | 2730 |
| 125 | Ga0265319_1002922 | 3300028563 | Bacteria | 9106 |
| 126 | Ga0265334_10001149 | 3300028573 | Bacteria | 12936 |
| 127 | Ga0265318_10014895 | 3300028577 | Bacteria | 3252 |
| 128 | Ga0265323_10007923 | 3300028653 | Bacteria | 4393 |
| 129 | Ga0265322_10009142 | 3300028654 | Bacteria | 2879 |
| 130 | Ga0265336_10001212 | 3300028666 | Bacteria | 12225 |
| 131 | Ga0265338_10002833 | 3300028800 | Bacteria | 25312 |
| 132 | Ga0265338_10012278 | 3300028800 | Bacteria | 9779 |
| 133 | Ga0265324_10001086 | 3300029957 | Bacteria | 16372 |
| 134 | Ga0265332_10038459 | 3300031238 | Bacteria | 2073 |
| 135 | Ga0265325_10012553 | 3300031241 | Bacteria | 4841 |
| 136 | Ga0265340_10025786 | 3300031247 | Bacteria | 2974 |
| 137 | Ga0265313_10002734 | 3300031595 | Bacteria | 14913 |
| 138 | Ga0265314_10019629 | 3300031711 | Bacteria | 5232 |
| 139 | Ga0265342_10001585 | 3300031712 | Bacteria | 20992 |
| 140 | Ga0307410_10005234 | 3300031852 | Bacteria | 6836 |
| 141 | Ga0307407_10055997 | 3300031903 | Bacteria | 2281 |
| 142 | Ga0307409_100002048 | 3300031995 | Bacteria | 10353 |
| 143 | Ga0307409_100219254 | 3300031995 | Bacteria | 1716 |
| 144 | Ga0307415_100000007 | 3300032126 | Bacteria | 94604 |
| 145 | Ga0307415_100181028 | 3300032126 | Bacteria | 1654 |
| 146 | Ga0373953_0034550 | 3300035117 | Bacteria | 1982 |
| 147 | Ga0373957_0003905 | 3300035120 | Bacteria | 4476 |
| 148 | Ga0373933_0040404 | 3300035724 | Bacteria | 2748 |
| 149 | Ga0373937_0237543 | 3300036401 | Bacteria | 1716 |
| 150 | Ga0373925_0000001 | 3300037068 | Bacteria | 402692 |
| 151 | Ga0395899_0007590 | 3300037312 | Bacteria | 8367 |
| 152 | Ga0395900_0113255 | 3300037418 | Bacteria | 2784 |
| 153 | Ga0395898_0031269 | 3300037466 | Bacteria | 5320 |
| 154 | Ga0451841_0819440 | 3300041498 | Bacteria | 2809 |
| 155 | Ga0466961_0038339 | 3300044693 | Bacteria | 3074 |
| 156 | Ga0466963_0019394 | 3300044694 | Bacteria | 4264 |
| 157 | Ga0466963_0052352 | 3300044694 | Bacteria | 2709 |
| 158 | Ga0466963_0142653 | 3300044694 | Bacteria | 1660 |
| 159 | Ga0466960_0016125 | 3300044901 | Bacteria | 3235 |
| 160 | Ga0466967_0042486 | 3300045976 | Bacteria | 3929 |
| 161 | Ga0466967_0140563 | 3300045976 | Bacteria | 2248 |
| 162 | Ga0495592_0063997 | 3300046454 | Bacteria | 2696 |
| 163 | Ga0495653_0028520 | 3300046463 | Bacteria | 4463 |
| 164 | Ga0495664_0039859 | 3300046477 | Bacteria | 2775 |
| 165 | Ga0495618_0051643 | 3300046514 | Bacteria | 2597 |
| 166 | Ga0495628_0024541 | 3300046516 | Bacteria | 4934 |
| 167 | Ga0495630_0030867 | 3300046517 | Bacteria | 3989 |
| 168 | Ga0495652_0011276 | 3300046529 | Bacteria | 8086 |
| 169 | Ga0495586_0030307 | 3300046535 | Bacteria | 2895 |
| 170 | Ga0495657_0024230 | 3300046675 | Bacteria | 4325 |
| 171 | Ga0495599_0037268 | 3300046678 | Bacteria | 3054 |
| 172 | Ga0495623_0085285 | 3300046679 | Bacteria | 1948 |
| 173 | Ga0495646_0012267 | 3300046680 | Bacteria | 5450 |
| 174 | Ga0495613_0118480 | 3300046689 | Bacteria | 1903 |
| 175 | Ga0495684_0093396 | 3300047471 | Bacteria | 2278 |
| 176 | Ga0495602_0059032 | 3300048088 | Bacteria | 3352 |
| 177 | Ga0496100_0020816 | 3300048903 | Bacteria | 3940 |
| 178 | Ga0496100_0024493 | 3300048903 | Bacteria | 3682 |
| 179 | Ga0496101_0017026 | 3300048904 | Bacteria | 4922 |
| 180 | Ga0496102_0008798 | 3300048905 | Bacteria | 8660 |
| 181 | Ga0496102_0016488 | 3300048905 | Bacteria | 6457 |
| 182 | Ga0496104_0024852 | 3300048907 | Bacteria | 5516 |
| 183 | Ga0496105_0001921 | 3300048908 | Bacteria | 14937 |
| 184 | Ga0496106_0019579 | 3300048909 | Bacteria | 5021 |
| 185 | Ga0496106_0167729 | 3300048909 | Bacteria | 1739 |
| 186 | Ga0496107_0011584 | 3300048910 | Bacteria | 6146 |
| 187 | Ga0496108_0015963 | 3300048911 | Bacteria | 6121 |
| 188 | Ga0496108_0041856 | 3300048911 | Bacteria | 3825 |
| 189 | Ga0496108_0042743 | 3300048911 | Bacteria | 3784 |
| 190 | Ga0496108_0216353 | 3300048911 | Bacteria | 1664 |
| 191 | Ga0496109_0009105 | 3300048912 | Bacteria | 8454 |
| 192 | Ga0496109_0065860 | 3300048912 | Bacteria | 3317 |
| 193 | Ga0496110_0020886 | 3300048913 | Bacteria | 5532 |
| 194 | Ga0496110_0098740 | 3300048913 | Bacteria | 2617 |
| 195 | Ga0496110_0230305 | 3300048913 | Bacteria | 1685 |
| 196 | Ga0496111_0009622 | 3300048914 | Bacteria | 6455 |
| 197 | Ga0496113_0018409 | 3300048916 | Bacteria | 4864 |
| 198 | Ga0496113_0023617 | 3300048916 | Bacteria | 4361 |
| 199 | Ga0496114_0009156 | 3300048917 | Bacteria | 7851 |
| 200 | Ga0496114_0020245 | 3300048917 | Bacteria | 5399 |
| 201 | Ga0496114_0038043 | 3300048917 | Bacteria | 3980 |
| 202 | Ga0496114_0040146 | 3300048917 | Bacteria | 3873 |
| 203 | Ga0496114_0107537 | 3300048917 | Bacteria | 2387 |
| 204 | Ga0496114_0191068 | 3300048917 | Bacteria | 1792 |
| 205 | Ga0496115_0003254 | 3300048918 | Bacteria | 11657 |
| 206 | Ga0496115_0050763 | 3300048918 | Bacteria | 3324 |
| 207 | Ga0496126_0009000 | 3300048929 | Bacteria | 10683 |
| 208 | Ga0496126_0013282 | 3300048929 | Bacteria | 8392 |
| 209 | Ga0501031_0002491 | 3300049568 | Bacteria | 11747 |
| 210 | Ga0501034_0015468 | 3300049571 | Bacteria | 7841 |
| 211 | Ga0501034_0041273 | 3300049571 | Bacteria | 4668 |
| 212 | Ga0501036_0128304 | 3300049572 | Bacteria | 2141 |
| 213 | Ga0501037_0040892 | 3300049573 | Bacteria | 3411 |
| 214 | Ga0501038_0086774 | 3300049574 | Bacteria | 2629 |
| 215 | Ga0501038_0218786 | 3300049574 | Bacteria | 1520 |
| 216 | Ga0501039_0009195 | 3300049575 | Bacteria | 7531 |
| 217 | Ga0501040_0012270 | 3300049576 | Bacteria | 5613 |
| 218 | Ga0501040_0024662 | 3300049576 | Bacteria | 4037 |
| 219 | Ga0501040_0131985 | 3300049576 | Bacteria | 1757 |
| 220 | Ga0501041_0048394 | 3300049577 | Bacteria | 2589 |
| 221 | Ga0501046_0085425 | 3300049580 | Bacteria | 2433 |
| 222 | Ga0501048_0034437 | 3300049582 | Bacteria | 3653 |
| 223 | Ga0501067_0000461 | 3300049583 | Bacteria | 22155 |
| 224 | Ga0501067_0014594 | 3300049583 | Bacteria | 4349 |
| 225 | Ga0501068_0024377 | 3300049584 | Bacteria | 3552 |
| 226 | Ga0501068_0026590 | 3300049584 | Bacteria | 3411 |
| 227 | Ga0501068_0077110 | 3300049584 | Bacteria | 2041 |
| 228 | Ga0501069_0050234 | 3300049585 | Bacteria | 2319 |
| 229 | Ga0501070_0024538 | 3300049586 | Bacteria | 5056 |
| 230 | Ga0501071_0031205 | 3300049587 | Bacteria | 3775 |
| 231 | Ga0501072_0002112 | 3300049588 | Bacteria | 14811 |
| 232 | Ga0501072_0035775 | 3300049588 | Bacteria | 3891 |
| 233 | Ga0501073_0012049 | 3300049589 | Bacteria | 6312 |
| 234 | Ga0501074_0001017 | 3300049590 | Bacteria | 18243 |
| 235 | Ga0501074_0059538 | 3300049590 | Bacteria | 2751 |
| 236 | Ga0501075_0022583 | 3300049591 | Bacteria | 4597 |
| 237 | Ga0501075_0031470 | 3300049591 | Bacteria | 3938 |
| 238 | Ga0501076_0043816 | 3300049592 | Bacteria | 3528 |
| 239 | Ga0501077_0018573 | 3300049593 | Bacteria | 4397 |
| 240 | Ga0501079_0004918 | 3300049741 | Bacteria | 9907 |
| 241 | Ga0501079_0015229 | 3300049741 | Bacteria | 5866 |
| 242 | Ga0501080_0010115 | 3300049742 | Bacteria | 8626 |
| 243 | Ga0501081_0042268 | 3300049743 | Bacteria | 3122 |
| 244 | Ga0501083_0010633 | 3300049744 | Bacteria | 6477 |
| 245 | Ga0501083_0034674 | 3300049744 | Bacteria | 3450 |
| 246 | Ga0501035_0029373 | 3300049822 | Bacteria | 5013 |
| 247 | Ga0501035_0080779 | 3300049822 | Bacteria | 2870 |
| 248 | Ga0501035_0097251 | 3300049822 | Bacteria | 2586 |
| 249 | Ga0501044_0084549 | 3300049823 | Bacteria | 3207 |
| 250 | Ga0501045_0032185 | 3300049824 | Bacteria | 3799 |
| 251 | nmdc:mga00v17_27028_c1 | 3300050491 | Bacteria | 3347 |
| 252 | nmdc:mga0yw44_19725_c1 | 3300050492 | Bacteria | 3725 |
| 253 | Ga0500616_0000095 | 3300053153 | Bacteria | 180630 |
| 254 | Ga0501084_0043268 | 3300054114 | Bacteria | 3768 |
| 255 | Ga0501084_0085486 | 3300054114 | Bacteria | 2648 |
| 256 | Ga0501084_0206990 | 3300054114 | Bacteria | 1655 |
| 257 | Ga0501082_0014380 | 3300060353 | Bacteria | 6810 |
| 258 | Ga0501082_0036138 | 3300060353 | Bacteria | 4256 |
| 259 | Ga0466962_0024391 | 3300061719 | Bacteria | 2905 |
| 260 | Ga0530510_0052689 | 3300061734 | Bacteria | 2939 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049584 | Ga0501068_0077110 | Ga0501068_0077110_35_1171 | 364 |
| 2 | 3300048913 | Ga0496110_0230305 | Ga0496110_0230305_23_1159 | 378 |
| 3 | 3300049576 | Ga0501040_0024662 | Ga0501040_0024662_2847_4016 | 387 |
| 4 | 3300005441 | Ga0070700_100021483 | Ga0070700_1000214835 | 394 |
| 5 | 3300014325 | Ga0163163_10033455 | Ga0163163_100334552 | 398 |
| 6 | 3300045976 | Ga0466967_0042486 | Ga0466967_0042486_77_1276 | 399 |
| 7 | 3300045976 | Ga0466967_0140563 | Ga0466967_0140563_30_1238 | 399 |
| 8 | 3300037068 | Ga0373925_0000001 | Ga0373925_0000001_379059_380423 | 411 |
| 9 | 3300005445 | Ga0070708_100019854 | Ga0070708_1000198545 | 417 |
| 10 | 3300005467 | Ga0070706_100077648 | Ga0070706_1000776482 | 417 |
| 11 | 3300005471 | Ga0070698_100068287 | Ga0070698_1000682874 | 417 |
| 12 | 3300006028 | Ga0070717_10193284 | Ga0070717_101932841 | 417 |
| 13 | 3300049822 | Ga0501035_0097251 | Ga0501035_0097251_13_1272 | 417 |
| 14 | 3300005435 | Ga0070714_100044158 | Ga0070714_1000441582 | 424 |
| 15 | 3300025928 | Ga0207700_10054676 | Ga0207700_100546763 | 424 |
| 16 | 3300048929 | Ga0496126_0009000 | Ga0496126_0009000_2080_3477 | 424 |
| 17 | 3300049744 | Ga0501083_0034674 | Ga0501083_0034674_44_1408 | 424 |
| 18 | 3300031852 | Ga0307410_10005234 | Ga0307410_100052346 | 425 |
| 19 | 3300031903 | Ga0307407_10055997 | Ga0307407_100559972 | 425 |
| 20 | 3300031995 | Ga0307409_100002048 | Ga0307409_1000020484 | 425 |
| 21 | 3300032126 | Ga0307415_100000007 | Ga0307415_10000000755 | 425 |
| 22 | 3300048911 | Ga0496108_0041856 | Ga0496108_0041856_2252_3625 | 425 |
| 23 | 3300037312 | Ga0395899_0007590 | Ga0395899_0007590_5999_7396 | 426 |
| 24 | 3300037418 | Ga0395900_0113255 | Ga0395900_0113255_28_1425 | 426 |
| 25 | 3300025927 | Ga0207687_10224143 | Ga0207687_102241431 | 428 |
| 26 | 3300013307 | Ga0157372_10000172 | Ga0157372_1000017231 | 435 |
| 27 | 3300048916 | Ga0496113_0018409 | Ga0496113_0018409_1032_2405 | 436 |
| 28 | 3300005356 | Ga0070674_100106599 | Ga0070674_1001065991 | 437 |
| 29 | 3300005440 | Ga0070705_100020147 | Ga0070705_1000201472 | 437 |
| 30 | 3300005547 | Ga0070693_100036467 | Ga0070693_1000364672 | 437 |
| 31 | 3300005614 | Ga0068856_100187040 | Ga0068856_1001870402 | 437 |
| 32 | 3300005615 | Ga0070702_100005159 | Ga0070702_1000051592 | 437 |
| 33 | 3300009148 | Ga0105243_10144082 | Ga0105243_101440821 | 437 |
| 34 | 3300009176 | Ga0105242_10073590 | Ga0105242_100735902 | 437 |
| 35 | 3300013297 | Ga0157378_10014703 | Ga0157378_100147037 | 437 |
| 36 | 3300014326 | Ga0157380_10056250 | Ga0157380_100562503 | 437 |
| 37 | 3300025937 | Ga0207669_10027466 | Ga0207669_100274662 | 437 |
| 38 | 3300046535 | Ga0495586_0030307 | Ga0495586_0030307_1063_2559 | 437 |
| 39 | 3300054114 | Ga0501084_0206990 | Ga0501084_0206990_295_1614 | 437 |
| 40 | 3300005329 | Ga0070683_100019448 | Ga0070683_1000194485 | 438 |
| 41 | 3300005438 | Ga0070701_10010512 | Ga0070701_100105122 | 438 |
| 42 | 3300005459 | Ga0068867_100011082 | Ga0068867_1000110825 | 438 |
| 43 | 3300006881 | Ga0068865_100029331 | Ga0068865_1000293312 | 438 |
| 44 | 3300009098 | Ga0105245_10016996 | Ga0105245_100169965 | 438 |
| 45 | 3300025927 | Ga0207687_10024263 | Ga0207687_100242634 | 438 |
| 46 | 3300026075 | Ga0207708_10001891 | Ga0207708_100018918 | 438 |
| 47 | 3300026089 | Ga0207648_10007397 | Ga0207648_100073976 | 438 |
| 48 | 3300026118 | Ga0207675_100020019 | Ga0207675_1000200192 | 438 |
| 49 | 3300044694 | Ga0466963_0142653 | Ga0466963_0142653_60_1439 | 438 |
| 50 | 3300048917 | Ga0496114_0107537 | Ga0496114_0107537_102_1475 | 438 |
| 51 | 3300005343 | Ga0070687_100045108 | Ga0070687_1000451082 | 440 |
| 52 | 3300005345 | Ga0070692_10003215 | Ga0070692_100032155 | 440 |
| 53 | 3300005347 | Ga0070668_100131132 | Ga0070668_1001311322 | 440 |
| 54 | 3300005455 | Ga0070663_100104878 | Ga0070663_1001048782 | 440 |
| 55 | 3300005844 | Ga0068862_100071522 | Ga0068862_1000715222 | 440 |
| 56 | 3300009148 | Ga0105243_10032415 | Ga0105243_100324152 | 440 |
| 57 | 3300014326 | Ga0157380_10006842 | Ga0157380_100068426 | 440 |
| 58 | 3300025901 | Ga0207688_10019663 | Ga0207688_100196633 | 440 |
| 59 | 3300025918 | Ga0207662_10054151 | Ga0207662_100541512 | 440 |
| 60 | 3300028380 | Ga0268265_10126635 | Ga0268265_101266352 | 440 |
| 61 | 3300031995 | Ga0307409_100219254 | Ga0307409_1002192541 | 441 |
| 62 | 3300025928 | Ga0207700_10018516 | Ga0207700_100185162 | 444 |
| 63 | 3300005435 | Ga0070714_100080043 | Ga0070714_1000800433 | 446 |
| 64 | 3300025929 | Ga0207664_10018832 | Ga0207664_100188323 | 446 |
| 65 | 3300041498 | Ga0451841_0819440 | Ga0451841_0819440_863_2263 | 446 |
| 66 | 3300005985 | Ga0081539_10003872 | Ga0081539_100038725 | 448 |
| 67 | 3300014326 | Ga0157380_10055549 | Ga0157380_100555491 | 449 |
| 68 | 3300025926 | Ga0207659_10043910 | Ga0207659_100439103 | 449 |
| 69 | iso_pu_bacteria | 2839986021 | 2839987508 | 449 |
| 70 | 3300048903 | Ga0496100_0020816 | Ga0496100_0020816_1157_2509 | 450 |
| 71 | 3300048904 | Ga0496101_0017026 | Ga0496101_0017026_1061_2413 | 450 |
| 72 | 3300048909 | Ga0496106_0019579 | Ga0496106_0019579_3309_4661 | 450 |
| 73 | 3300048911 | Ga0496108_0015963 | Ga0496108_0015963_1591_2943 | 450 |
| 74 | iso_pu_bacteria | 2643221641 | 2644231414 | 450 |
| 75 | iso_pu_bacteria | 8054609563 | 8054612458 | 450 |
| 76 | 3300025945 | Ga0207679_10271686 | Ga0207679_102716861 | 451 |
| 77 | 3300048912 | Ga0496109_0009105 | Ga0496109_0009105_6369_7724 | 451 |
| 78 | 3300048916 | Ga0496113_0023617 | Ga0496113_0023617_1129_2484 | 451 |
| 79 | 3300005327 | Ga0070658_10042767 | Ga0070658_100427673 | 452 |
| 80 | 3300005329 | Ga0070683_100000365 | Ga0070683_10000036519 | 452 |
| 81 | 3300005335 | Ga0070666_10127725 | Ga0070666_101277251 | 452 |
| 82 | 3300005337 | Ga0070682_100002279 | Ga0070682_1000022796 | 452 |
| 83 | 3300005338 | Ga0068868_100051508 | Ga0068868_1000515082 | 452 |
| 84 | 3300005339 | Ga0070660_100043961 | Ga0070660_1000439613 | 452 |
| 85 | 3300005345 | Ga0070692_10006570 | Ga0070692_100065703 | 452 |
| 86 | 3300005353 | Ga0070669_100121418 | Ga0070669_1001214182 | 452 |
| 87 | 3300005366 | Ga0070659_100047501 | Ga0070659_1000475013 | 452 |
| 88 | 3300005367 | Ga0070667_100041884 | Ga0070667_1000418842 | 452 |
| 89 | 3300005468 | Ga0070707_100009144 | Ga0070707_1000091445 | 452 |
| 90 | 3300005471 | Ga0070698_100013597 | Ga0070698_1000135972 | 452 |
| 91 | 3300005535 | Ga0070684_100003624 | Ga0070684_1000036243 | 452 |
| 92 | 3300005535 | Ga0070684_100032959 | Ga0070684_1000329593 | 452 |
| 93 | 3300005543 | Ga0070672_100190774 | Ga0070672_1001907742 | 452 |
| 94 | 3300005548 | Ga0070665_100001179 | Ga0070665_10000117910 | 452 |
| 95 | 3300005618 | Ga0068864_100083012 | Ga0068864_1000830122 | 452 |
| 96 | 3300006051 | Ga0075364_10028911 | Ga0075364_100289113 | 452 |
| 97 | 3300009098 | Ga0105245_10019642 | Ga0105245_100196423 | 452 |
| 98 | 3300009553 | Ga0105249_10045379 | Ga0105249_100453793 | 452 |
| 99 | 3300009553 | Ga0105249_10052092 | Ga0105249_100520923 | 452 |
| 100 | 3300010375 | Ga0105239_10001015 | Ga0105239_1000101523 | 452 |
| 101 | 3300013306 | Ga0163162_10045744 | Ga0163162_100457443 | 452 |
| 102 | 3300013307 | Ga0157372_10002484 | Ga0157372_100024848 | 452 |
| 103 | 3300014325 | Ga0163163_10235585 | Ga0163163_102355852 | 452 |
| 104 | 3300014745 | Ga0157377_10087329 | Ga0157377_100873291 | 452 |
| 105 | 3300025905 | Ga0207685_10056809 | Ga0207685_100568092 | 452 |
| 106 | 3300025909 | Ga0207705_10056964 | Ga0207705_100569642 | 452 |
| 107 | 3300025919 | Ga0207657_10067988 | Ga0207657_100679882 | 452 |
| 108 | 3300025922 | Ga0207646_10022376 | Ga0207646_100223764 | 452 |
| 109 | 3300025932 | Ga0207690_10033282 | Ga0207690_100332823 | 452 |
| 110 | 3300025938 | Ga0207704_10022805 | Ga0207704_100228052 | 452 |
| 111 | 3300025939 | Ga0207665_10010132 | Ga0207665_100101323 | 452 |
| 112 | 3300025944 | Ga0207661_10004837 | Ga0207661_100048374 | 452 |
| 113 | 3300025944 | Ga0207661_10068804 | Ga0207661_100688042 | 452 |
| 114 | 3300026023 | Ga0207677_10124052 | Ga0207677_101240522 | 452 |
| 115 | 3300026095 | Ga0207676_10196227 | Ga0207676_101962272 | 452 |
| 116 | 3300026116 | Ga0207674_10001716 | Ga0207674_100017169 | 452 |
| 117 | 3300028379 | Ga0268266_10001751 | Ga0268266_1000175114 | 452 |
| 118 | 3300035117 | Ga0373953_0034550 | Ga0373953_0034550_35_1405 | 452 |
| 119 | 3300035120 | Ga0373957_0003905 | Ga0373957_0003905_3070_4440 | 452 |
| 120 | 3300035724 | Ga0373933_0040404 | Ga0373933_0040404_484_1854 | 452 |
| 121 | 3300036401 | Ga0373937_0237543 | Ga0373937_0237543_277_1647 | 452 |
| 122 | 3300044694 | Ga0466963_0052352 | Ga0466963_0052352_194_1558 | 452 |
| 123 | 3300046454 | Ga0495592_0063997 | Ga0495592_0063997_183_1553 | 452 |
| 124 | 3300046463 | Ga0495653_0028520 | Ga0495653_0028520_329_1699 | 452 |
| 125 | 3300046477 | Ga0495664_0039859 | Ga0495664_0039859_1248_2618 | 452 |
| 126 | 3300046514 | Ga0495618_0051643 | Ga0495618_0051643_456_1826 | 452 |
| 127 | 3300046516 | Ga0495628_0024541 | Ga0495628_0024541_2464_3834 | 452 |
| 128 | 3300046517 | Ga0495630_0030867 | Ga0495630_0030867_2060_3430 | 452 |
| 129 | 3300046529 | Ga0495652_0011276 | Ga0495652_0011276_1928_3298 | 452 |
| 130 | 3300046675 | Ga0495657_0024230 | Ga0495657_0024230_2413_3783 | 452 |
| 131 | 3300046678 | Ga0495599_0037268 | Ga0495599_0037268_666_2036 | 452 |
| 132 | 3300046679 | Ga0495623_0085285 | Ga0495623_0085285_398_1768 | 452 |
| 133 | 3300046680 | Ga0495646_0012267 | Ga0495646_0012267_392_1762 | 452 |
| 134 | 3300046689 | Ga0495613_0118480 | Ga0495613_0118480_77_1447 | 452 |
| 135 | 3300047471 | Ga0495684_0093396 | Ga0495684_0093396_392_1762 | 452 |
| 136 | 3300048088 | Ga0495602_0059032 | Ga0495602_0059032_1413_2783 | 452 |
| 137 | 3300048903 | Ga0496100_0024493 | Ga0496100_0024493_1341_2738 | 452 |
| 138 | 3300048905 | Ga0496102_0008798 | Ga0496102_0008798_195_1556 | 452 |
| 139 | 3300048905 | Ga0496102_0016488 | Ga0496102_0016488_2389_3786 | 452 |
| 140 | 3300048907 | Ga0496104_0024852 | Ga0496104_0024852_2198_3595 | 452 |
| 141 | 3300048908 | Ga0496105_0001921 | Ga0496105_0001921_6120_7517 | 452 |
| 142 | 3300048909 | Ga0496106_0167729 | Ga0496106_0167729_68_1426 | 452 |
| 143 | 3300048910 | Ga0496107_0011584 | Ga0496107_0011584_2145_3542 | 452 |
| 144 | 3300048911 | Ga0496108_0042743 | Ga0496108_0042743_299_1660 | 452 |
| 145 | 3300048911 | Ga0496108_0216353 | Ga0496108_0216353_72_1430 | 452 |
| 146 | 3300048912 | Ga0496109_0065860 | Ga0496109_0065860_1231_2589 | 452 |
| 147 | 3300048913 | Ga0496110_0098740 | Ga0496110_0098740_219_1580 | 452 |
| 148 | 3300048914 | Ga0496111_0009622 | Ga0496111_0009622_2648_4009 | 452 |
| 149 | 3300048917 | Ga0496114_0009156 | Ga0496114_0009156_6370_7767 | 452 |
| 150 | 3300048917 | Ga0496114_0020245 | Ga0496114_0020245_3925_5292 | 452 |
| 151 | 3300048917 | Ga0496114_0038043 | Ga0496114_0038043_2429_3826 | 452 |
| 152 | 3300048917 | Ga0496114_0040146 | Ga0496114_0040146_65_1426 | 452 |
| 153 | 3300048917 | Ga0496114_0191068 | Ga0496114_0191068_188_1552 | 452 |
| 154 | 3300048918 | Ga0496115_0003254 | Ga0496115_0003254_7906_9303 | 452 |
| 155 | 3300049571 | Ga0501034_0015468 | Ga0501034_0015468_1477_2841 | 452 |
| 156 | 3300049583 | Ga0501067_0000461 | Ga0501067_0000461_18733_20097 | 452 |
| 157 | 3300049584 | Ga0501068_0024377 | Ga0501068_0024377_1258_2622 | 452 |
| 158 | 3300049584 | Ga0501068_0026590 | Ga0501068_0026590_1645_3009 | 452 |
| 159 | 3300049586 | Ga0501070_0024538 | Ga0501070_0024538_2245_3609 | 452 |
| 160 | 3300049588 | Ga0501072_0002112 | Ga0501072_0002112_2423_3787 | 452 |
| 161 | 3300049589 | Ga0501073_0012049 | Ga0501073_0012049_2296_3660 | 452 |
| 162 | 3300049590 | Ga0501074_0001017 | Ga0501074_0001017_2245_3609 | 452 |
| 163 | 3300049590 | Ga0501074_0059538 | Ga0501074_0059538_987_2351 | 452 |
| 164 | 3300049593 | Ga0501077_0018573 | Ga0501077_0018573_2244_3608 | 452 |
| 165 | 3300049741 | Ga0501079_0004918 | Ga0501079_0004918_3537_4901 | 452 |
| 166 | 3300049742 | Ga0501080_0010115 | Ga0501080_0010115_2245_3609 | 452 |
| 167 | 3300049744 | Ga0501083_0010633 | Ga0501083_0010633_4949_6313 | 452 |
| 168 | 3300050491 | nmdc:mga00v17_27028_c1 | nmdc:mga00v17_27028_c1_181_1542 | 452 |
| 169 | 3300054114 | Ga0501084_0043268 | Ga0501084_0043268_2018_3382 | 452 |
| 170 | 3300060353 | Ga0501082_0036138 | Ga0501082_0036138_1717_3081 | 452 |
| 171 | 3300005329 | Ga0070683_100008624 | Ga0070683_1000086248 | 453 |
| 172 | 3300005436 | Ga0070713_100044881 | Ga0070713_1000448813 | 453 |
| 173 | 3300005458 | Ga0070681_10137953 | Ga0070681_101379532 | 453 |
| 174 | 3300025929 | Ga0207664_10219647 | Ga0207664_102196472 | 453 |
| 175 | 3300025944 | Ga0207661_10028632 | Ga0207661_100286324 | 453 |
| 176 | 3300028800 | Ga0265338_10002833 | Ga0265338_100028338 | 453 |
| 177 | 3300032126 | Ga0307415_100181028 | Ga0307415_1001810282 | 453 |
| 178 | 3300048929 | Ga0496126_0013282 | Ga0496126_0013282_6592_7980 | 454 |
| 179 | 3300050492 | nmdc:mga0yw44_19725_c1 | nmdc:mga0yw44_19725_c1_1827_3194 | 454 |
| 180 | iso_pu_bacteria | 2919051321 | 2919053255 | 454 |
| 181 | 3300005441 | Ga0070700_100055130 | Ga0070700_1000551302 | 455 |
| 182 | 3300010375 | Ga0105239_10052272 | Ga0105239_100522722 | 455 |
| 183 | 3300025910 | Ga0207684_10086345 | Ga0207684_100863454 | 455 |
| 184 | 3300028556 | Ga0265337_1001178 | Ga0265337_10011782 | 455 |
| 185 | 3300028558 | Ga0265326_10010612 | Ga0265326_100106122 | 455 |
| 186 | 3300028563 | Ga0265319_1002922 | Ga0265319_10029223 | 455 |
| 187 | 3300028573 | Ga0265334_10001149 | Ga0265334_1000114911 | 455 |
| 188 | 3300028577 | Ga0265318_10014895 | Ga0265318_100148953 | 455 |
| 189 | 3300028653 | Ga0265323_10007923 | Ga0265323_100079233 | 455 |
| 190 | 3300028654 | Ga0265322_10009142 | Ga0265322_100091423 | 455 |
| 191 | 3300028666 | Ga0265336_10001212 | Ga0265336_100012129 | 455 |
| 192 | 3300028800 | Ga0265338_10012278 | Ga0265338_100122789 | 455 |
| 193 | 3300029957 | Ga0265324_10001086 | Ga0265324_1000108613 | 455 |
| 194 | 3300031238 | Ga0265332_10038459 | Ga0265332_100384592 | 455 |
| 195 | 3300031241 | Ga0265325_10012553 | Ga0265325_100125533 | 455 |
| 196 | 3300031247 | Ga0265340_10025786 | Ga0265340_100257863 | 455 |
| 197 | 3300031595 | Ga0265313_10002734 | Ga0265313_100027347 | 455 |
| 198 | 3300031711 | Ga0265314_10019629 | Ga0265314_100196292 | 455 |
| 199 | 3300031712 | Ga0265342_10001585 | Ga0265342_100015854 | 455 |
| 200 | 3300044901 | Ga0466960_0016125 | Ga0466960_0016125_1000_2370 | 455 |
| 201 | 3300049576 | Ga0501040_0131985 | Ga0501040_0131985_299_1678 | 455 |
| 202 | 3300049583 | Ga0501067_0014594 | Ga0501067_0014594_2873_4243 | 455 |
| 203 | 3300049585 | Ga0501069_0050234 | Ga0501069_0050234_391_1764 | 455 |
| 204 | 3300009098 | Ga0105245_10094960 | Ga0105245_100949602 | 456 |
| 205 | 3300009177 | Ga0105248_10266529 | Ga0105248_102665292 | 456 |
| 206 | 3300014968 | Ga0157379_10040904 | Ga0157379_100409042 | 456 |
| 207 | 3300025904 | Ga0207647_10028619 | Ga0207647_100286193 | 456 |
| 208 | 3300025941 | Ga0207711_10178868 | Ga0207711_101788682 | 456 |
| 209 | 3300025949 | Ga0207667_10169757 | Ga0207667_101697572 | 456 |
| 210 | 3300026041 | Ga0207639_10003095 | Ga0207639_100030958 | 456 |
| 211 | 3300037466 | Ga0395898_0031269 | Ga0395898_0031269_3398_4807 | 456 |
| 212 | 3300049571 | Ga0501034_0041273 | Ga0501034_0041273_1696_3108 | 456 |
| 213 | 3300049574 | Ga0501038_0086774 | Ga0501038_0086774_418_1821 | 456 |
| 214 | 3300049574 | Ga0501038_0218786 | Ga0501038_0218786_13_1392 | 456 |
| 215 | 3300049576 | Ga0501040_0012270 | Ga0501040_0012270_3310_4689 | 456 |
| 216 | 3300049580 | Ga0501046_0085425 | Ga0501046_0085425_710_2113 | 456 |
| 217 | 3300049582 | Ga0501048_0034437 | Ga0501048_0034437_1345_2724 | 456 |
| 218 | 3300049591 | Ga0501075_0031470 | Ga0501075_0031470_2331_3710 | 456 |
| 219 | 3300049592 | Ga0501076_0043816 | Ga0501076_0043816_125_1504 | 456 |
| 220 | 3300049743 | Ga0501081_0042268 | Ga0501081_0042268_38_1417 | 456 |
| 221 | 3300049822 | Ga0501035_0029373 | Ga0501035_0029373_643_2055 | 456 |
| 222 | 3300049822 | Ga0501035_0080779 | Ga0501035_0080779_1125_2528 | 456 |
| 223 | 3300049823 | Ga0501044_0084549 | Ga0501044_0084549_279_1682 | 456 |
| 224 | 3300053153 | Ga0500616_0000095 | Ga0500616_0000095_160945_162330 | 456 |
| 225 | 3300054114 | Ga0501084_0085486 | Ga0501084_0085486_967_2346 | 456 |
| 226 | 3300060353 | Ga0501082_0014380 | Ga0501082_0014380_4802_6181 | 456 |
| 227 | 3300048913 | Ga0496110_0020886 | Ga0496110_0020886_1855_3261 | 457 |
| 228 | 3300048918 | Ga0496115_0050763 | Ga0496115_0050763_1444_2841 | 457 |
| 229 | 3300044694 | Ga0466963_0019394 | Ga0466963_0019394_1552_2931 | 458 |
| 230 | 3300049568 | Ga0501031_0002491 | Ga0501031_0002491_8526_9911 | 458 |
| 231 | 3300049572 | Ga0501036_0128304 | Ga0501036_0128304_86_1471 | 458 |
| 232 | 3300049573 | Ga0501037_0040892 | Ga0501037_0040892_1942_3327 | 458 |
| 233 | 3300049575 | Ga0501039_0009195 | Ga0501039_0009195_6069_7454 | 458 |
| 234 | 3300049577 | Ga0501041_0048394 | Ga0501041_0048394_68_1453 | 458 |
| 235 | 3300049587 | Ga0501071_0031205 | Ga0501071_0031205_64_1449 | 458 |
| 236 | 3300049588 | Ga0501072_0035775 | Ga0501072_0035775_2454_3839 | 458 |
| 237 | 3300049591 | Ga0501075_0022583 | Ga0501075_0022583_44_1429 | 458 |
| 238 | 3300049741 | Ga0501079_0015229 | Ga0501079_0015229_4394_5779 | 458 |
| 239 | 3300049824 | Ga0501045_0032185 | Ga0501045_0032185_2332_3717 | 458 |
| 240 | 3300061719 | Ga0466962_0024391 | Ga0466962_0024391_1514_2893 | 458 |
| 241 | 3300061734 | Ga0530510_0052689 | Ga0530510_0052689_1528_2913 | 458 |
| 242 | 3300003752 | Ga0055539_1000027 | Ga0055539_100002775 | 459 |
| 243 | 3300003756 | Ga0055533_1000020 | Ga0055533_100002075 | 459 |
| 244 | 3300003759 | Ga0055525_1000296 | Ga0055525_10002964 | 459 |
| 245 | 3300005335 | Ga0070666_10009075 | Ga0070666_100090757 | 459 |
| 246 | 3300005355 | Ga0070671_100004116 | Ga0070671_1000041166 | 459 |
| 247 | 3300005367 | Ga0070667_100040377 | Ga0070667_1000403774 | 459 |
| 248 | 3300005548 | Ga0070665_100000637 | Ga0070665_10000063730 | 459 |
| 249 | 3300005841 | Ga0068863_100001783 | Ga0068863_1000017833 | 459 |
| 250 | 3300005842 | Ga0068858_100005296 | Ga0068858_1000052966 | 459 |
| 251 | 3300005843 | Ga0068860_100000085 | Ga0068860_100000085136 | 459 |
| 252 | 3300014968 | Ga0157379_10017380 | Ga0157379_100173807 | 459 |
| 253 | 3300025225 | Ga0209566_100366 | Ga0209566_10036613 | 459 |
| 254 | 3300025226 | Ga0209674_100001 | Ga0209674_1000013822 | 459 |
| 255 | 3300025230 | Ga0209563_100001 | Ga0209563_1000013822 | 459 |
| 256 | 3300025253 | Ga0209677_100001 | Ga0209677_1000013822 | 459 |
| 257 | 3300025903 | Ga0207680_10022070 | Ga0207680_100220701 | 459 |
| 258 | 3300025931 | Ga0207644_10059588 | Ga0207644_100595882 | 459 |
| 259 | 3300025972 | Ga0207668_10080963 | Ga0207668_100809632 | 459 |
| 260 | 3300026035 | Ga0207703_10020607 | Ga0207703_100206073 | 459 |
| 261 | 3300026088 | Ga0207641_10055891 | Ga0207641_100558913 | 459 |
| 262 | 3300028379 | Ga0268266_10001563 | Ga0268266_100015632 | 459 |
| 263 | 3300028381 | Ga0268264_10000031 | Ga0268264_1000003129 | 459 |
| 264 | 3300044693 | Ga0466961_0038339 | Ga0466961_0038339_1129_2508 | 459 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mbb-assembly1.cif.gz_B | crystal structure of stspl - apo form, after treatment with semicarbazide | 0.8449 | 110 | 458 |
| 3maf-assembly1.cif.gz_B | crystal structure of stspl (asymmetric form) | 0.8339 | 110 | 458 |
| 3mad-assembly1.cif.gz_B | crystal structure of stspl (symmetric form) | 0.8282 | 113 | 458 |
| 6m4y-assembly1.cif.gz_A-2 | structure of a r371a mutant of a group ii plp dependent decarboxylase from methanocaldococcus jannaschii | 0.8163 | 111 | 453 |
| 1v72-assembly1.cif.gz_A | crystal structure of phenylserine aldolase from pseudomonas putida | 0.8109 | 117 | 454 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3k40B03 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.927 | 365 | 457 | 3.90.1150.10 |
| 3rbfA03 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9225 | 367 | 458 | 3.90.1150.10 |
| af_Q95ZS2_455_559_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9201 | 366 | 458 | 3.90.1150.10 |
| af_Q05733_379_483_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9147 | 366 | 458 | 3.90.1150.10 |
| af_P19113_380_477_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9124 | 366 | 458 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3C6P6-F1-model_v4 | Aspartate aminotransferase family protein | 0.9808 | 116 | 458 |
GO:0008483
GO:0016831 GO:0019752 GO:0030170 |
| AF-A0A1Q7H3Z0-F1-model_v4 | Aspartate aminotransferase family protein | 0.971 | 80 | 455 |
GO:0008483
GO:0016831 GO:0019752 GO:0030170 |
| AF-A0A7Y0PEI7-F1-model_v4 | Uncharacterized protein | 0.9655 | 117 | 322 |
GO:0005737
GO:0016831 GO:0019752 GO:0030170 |
| AF-A0A7W0XZD9-F1-model_v4 | Aspartate aminotransferase family protein | 0.9589 | 271 | 458 |
GO:0008483
GO:0016831 GO:0019752 GO:0030170 |
| AF-A0A7Y2E6A5-F1-model_v4 | Aminotransferase class V-fold PLP-dependent enzyme | 0.9573 | 187 | 457 |
GO:0008483
GO:0016831 GO:0019752 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar