F372835

General Info

Members Datasets Scaffolds Average Seq Length
264 198 260 453

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0030307|Ga0495586_0030307_1063_2559
Length 479
Sequence MPDRDIALARAAGYATQWLDSLATRPVPPRASVAEVTVALGTALPDGPAEAPQVIDLLAGACEPGLTAMPSGRFYGFVIGGTHPAALAADWLVSAWDQNAGLLLPTPALAAVENVAKGWLLDVLGLPAGSGVGFVTGATMSNFTCLAAARDAVLHQAGWQVAADGLTGAPRVRVLVGAERHDTVDLALRYLGLGASEVVAADNQGRIDPDALEAALAAVPGAPSGPAIVVLQAGNVHSGAFDPFGPAIEAAHRHGAWVHIDGAFGLFAAASPRTRHLVAGYEAADSWTTDAHKTLNVPYDCGIAIVRDSAALRAAMGMHGEYLIRDAAGDPFEFVPEVSRRARGVPVWAVMRALGRSGLAALVDGYCRHAASFAAGIAGIDGATVENDVVFSRCAPASAATSGPRRSPAGCSPTAPRGCLAPAGAARPCCASRCPTGPPPTTDKRTPQRNLSGNDRGYRSPPAPRQRAGSRSRSARRRP

Samples

Sample ID Description Type Environment
1 2643221641 Nocardioides sp. Root122 Isolate Unclassified
2 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
3 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0.38
Rhizoplane 11.36
Rhizosphere 82.2
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055539_1000027 3300003752 Bacteria 258020
2 Ga0055533_1000020 3300003756 Bacteria 353998
3 Ga0055525_1000296 3300003759 Bacteria 43199
4 Ga0070658_10042767 3300005327 Bacteria 3659
5 Ga0070683_100000365 3300005329 Bacteria 31299
6 Ga0070683_100008624 3300005329 Bacteria 8662
7 Ga0070683_100019448 3300005329 Bacteria 6032
8 Ga0070666_10009075 3300005335 Bacteria 6200
9 Ga0070666_10127725 3300005335 Bacteria 1765
10 Ga0070682_100002279 3300005337 Bacteria 10617
11 Ga0068868_100051508 3300005338 Bacteria 3239
12 Ga0070660_100043961 3300005339 Bacteria 3414
13 Ga0070687_100045108 3300005343 Bacteria 2249
14 Ga0070692_10003215 3300005345 Bacteria 6576
15 Ga0070692_10006570 3300005345 Bacteria 5058
16 Ga0070668_100131132 3300005347 Bacteria 2012
17 Ga0070669_100121418 3300005353 Bacteria 1994
18 Ga0070671_100004116 3300005355 Bacteria 11482
19 Ga0070674_100106599 3300005356 Bacteria 2051
20 Ga0070659_100047501 3300005366 Bacteria 3367
21 Ga0070667_100040377 3300005367 Bacteria 3913
22 Ga0070667_100041884 3300005367 Bacteria 3840
23 Ga0070714_100044158 3300005435 Bacteria 3772
24 Ga0070714_100080043 3300005435 Bacteria 2842
25 Ga0070713_100044881 3300005436 Bacteria 3619
26 Ga0070701_10010512 3300005438 Bacteria 4094
27 Ga0070705_100020147 3300005440 Bacteria 3524
28 Ga0070700_100021483 3300005441 Bacteria 3752
29 Ga0070700_100055130 3300005441 Bacteria 2487
30 Ga0070708_100019854 3300005445 Bacteria 5654
31 Ga0070663_100104878 3300005455 Bacteria 2115
32 Ga0070681_10137953 3300005458 Bacteria 2369
33 Ga0068867_100011082 3300005459 Bacteria 6361
34 Ga0070706_100077648 3300005467 Bacteria 3073
35 Ga0070707_100009144 3300005468 Bacteria 9189
36 Ga0070698_100013597 3300005471 Bacteria 8616
37 Ga0070698_100068287 3300005471 Bacteria 3572
38 Ga0070684_100003624 3300005535 Bacteria 11629
39 Ga0070684_100032959 3300005535 Bacteria 4420
40 Ga0070672_100190774 3300005543 Bacteria 1711
41 Ga0070693_100036467 3300005547 Bacteria 2734
42 Ga0070665_100000637 3300005548 Bacteria 47676
43 Ga0070665_100001179 3300005548 Bacteria 32016
44 Ga0068856_100187040 3300005614 Bacteria 2085
45 Ga0070702_100005159 3300005615 Bacteria 6049
46 Ga0068864_100083012 3300005618 Bacteria 2813
47 Ga0068863_100001783 3300005841 Bacteria 21351
48 Ga0068858_100005296 3300005842 Bacteria 12648
49 Ga0068860_100000085 3300005843 Bacteria 166269
50 Ga0068862_100071522 3300005844 Bacteria 2995
51 Ga0081539_10003872 3300005985 Bacteria 17503
52 Ga0070717_10193284 3300006028 Bacteria 1779
53 Ga0075364_10028911 3300006051 Bacteria 3551
54 Ga0068865_100029331 3300006881 Bacteria 3649
55 Ga0105245_10016996 3300009098 Bacteria 6350
56 Ga0105245_10019642 3300009098 Bacteria 5920
57 Ga0105245_10094960 3300009098 Bacteria 2750
58 Ga0105243_10032415 3300009148 Bacteria 4037
59 Ga0105243_10144082 3300009148 Bacteria 2036
60 Ga0105242_10073590 3300009176 Bacteria 2841
61 Ga0105248_10266529 3300009177 Bacteria 1928
62 Ga0105249_10045379 3300009553 Bacteria 3997
63 Ga0105249_10052092 3300009553 Bacteria 3737
64 Ga0105239_10001015 3300010375 Bacteria 39219
65 Ga0105239_10052272 3300010375 Bacteria 4480
66 Ga0157378_10014703 3300013297 Bacteria 6856
67 Ga0163162_10045744 3300013306 Bacteria 4385
68 Ga0157372_10000172 3300013307 Bacteria 71944
69 Ga0157372_10002484 3300013307 Bacteria 19989
70 Ga0163163_10033455 3300014325 Bacteria 4973
71 Ga0163163_10235585 3300014325 Bacteria 1880
72 Ga0157380_10006842 3300014326 Bacteria 8059
73 Ga0157380_10055549 3300014326 Bacteria 3145
74 Ga0157380_10056250 3300014326 Bacteria 3128
75 Ga0157377_10087329 3300014745 Bacteria 1835
76 Ga0157379_10017380 3300014968 Bacteria 6337
77 Ga0157379_10040904 3300014968 Bacteria 4138
78 Ga0209566_100366 3300025225 Bacteria 37636
79 Ga0209674_100001 3300025226 Bacteria 4013750
80 Ga0209563_100001 3300025230 Bacteria 4013775
81 Ga0209677_100001 3300025253 Bacteria 4013787
82 Ga0207688_10019663 3300025901 Bacteria 3681
83 Ga0207680_10022070 3300025903 Bacteria 3457
84 Ga0207647_10028619 3300025904 Bacteria 3617
85 Ga0207685_10056809 3300025905 Bacteria 1533
86 Ga0207705_10056964 3300025909 Bacteria 2819
87 Ga0207684_10086345 3300025910 Bacteria 2672
88 Ga0207662_10054151 3300025918 Bacteria 2392
89 Ga0207657_10067988 3300025919 Bacteria 3028
90 Ga0207646_10022376 3300025922 Bacteria 5825
91 Ga0207659_10043910 3300025926 Bacteria 3143
92 Ga0207687_10024263 3300025927 Bacteria 4049
93 Ga0207687_10224143 3300025927 Bacteria 1482
94 Ga0207700_10018516 3300025928 Bacteria 4683
95 Ga0207700_10054676 3300025928 Bacteria 2998
96 Ga0207664_10018832 3300025929 Bacteria 5092
97 Ga0207664_10219647 3300025929 Bacteria 1647
98 Ga0207644_10059588 3300025931 Bacteria 2761
99 Ga0207690_10033282 3300025932 Bacteria 3313
100 Ga0207669_10027466 3300025937 Bacteria 3117
101 Ga0207704_10022805 3300025938 Bacteria 3362
102 Ga0207665_10010132 3300025939 Bacteria 6188
103 Ga0207711_10178868 3300025941 Bacteria 1928
104 Ga0207661_10004837 3300025944 Bacteria 9438
105 Ga0207661_10028632 3300025944 Bacteria 4269
106 Ga0207661_10068804 3300025944 Bacteria 2884
107 Ga0207679_10271686 3300025945 Bacteria 1450
108 Ga0207667_10169757 3300025949 Bacteria 2242
109 Ga0207668_10080963 3300025972 Bacteria 2354
110 Ga0207677_10124052 3300026023 Bacteria 1948
111 Ga0207703_10020607 3300026035 Bacteria 5158
112 Ga0207639_10003095 3300026041 Bacteria 11182
113 Ga0207708_10001891 3300026075 Bacteria 15462
114 Ga0207641_10055891 3300026088 Bacteria 3352
115 Ga0207648_10007397 3300026089 Bacteria 10809
116 Ga0207676_10196227 3300026095 Bacteria 1780
117 Ga0207674_10001716 3300026116 Bacteria 28034
118 Ga0207675_100020019 3300026118 Bacteria 6243
119 Ga0268266_10001563 3300028379 Bacteria 26774
120 Ga0268266_10001751 3300028379 Bacteria 24833
121 Ga0268265_10126635 3300028380 Bacteria 2115
122 Ga0268264_10000031 3300028381 Bacteria 409525
123 Ga0265337_1001178 3300028556 Bacteria 13321
124 Ga0265326_10010612 3300028558 Bacteria 2730
125 Ga0265319_1002922 3300028563 Bacteria 9106
126 Ga0265334_10001149 3300028573 Bacteria 12936
127 Ga0265318_10014895 3300028577 Bacteria 3252
128 Ga0265323_10007923 3300028653 Bacteria 4393
129 Ga0265322_10009142 3300028654 Bacteria 2879
130 Ga0265336_10001212 3300028666 Bacteria 12225
131 Ga0265338_10002833 3300028800 Bacteria 25312
132 Ga0265338_10012278 3300028800 Bacteria 9779
133 Ga0265324_10001086 3300029957 Bacteria 16372
134 Ga0265332_10038459 3300031238 Bacteria 2073
135 Ga0265325_10012553 3300031241 Bacteria 4841
136 Ga0265340_10025786 3300031247 Bacteria 2974
137 Ga0265313_10002734 3300031595 Bacteria 14913
138 Ga0265314_10019629 3300031711 Bacteria 5232
139 Ga0265342_10001585 3300031712 Bacteria 20992
140 Ga0307410_10005234 3300031852 Bacteria 6836
141 Ga0307407_10055997 3300031903 Bacteria 2281
142 Ga0307409_100002048 3300031995 Bacteria 10353
143 Ga0307409_100219254 3300031995 Bacteria 1716
144 Ga0307415_100000007 3300032126 Bacteria 94604
145 Ga0307415_100181028 3300032126 Bacteria 1654
146 Ga0373953_0034550 3300035117 Bacteria 1982
147 Ga0373957_0003905 3300035120 Bacteria 4476
148 Ga0373933_0040404 3300035724 Bacteria 2748
149 Ga0373937_0237543 3300036401 Bacteria 1716
150 Ga0373925_0000001 3300037068 Bacteria 402692
151 Ga0395899_0007590 3300037312 Bacteria 8367
152 Ga0395900_0113255 3300037418 Bacteria 2784
153 Ga0395898_0031269 3300037466 Bacteria 5320
154 Ga0451841_0819440 3300041498 Bacteria 2809
155 Ga0466961_0038339 3300044693 Bacteria 3074
156 Ga0466963_0019394 3300044694 Bacteria 4264
157 Ga0466963_0052352 3300044694 Bacteria 2709
158 Ga0466963_0142653 3300044694 Bacteria 1660
159 Ga0466960_0016125 3300044901 Bacteria 3235
160 Ga0466967_0042486 3300045976 Bacteria 3929
161 Ga0466967_0140563 3300045976 Bacteria 2248
162 Ga0495592_0063997 3300046454 Bacteria 2696
163 Ga0495653_0028520 3300046463 Bacteria 4463
164 Ga0495664_0039859 3300046477 Bacteria 2775
165 Ga0495618_0051643 3300046514 Bacteria 2597
166 Ga0495628_0024541 3300046516 Bacteria 4934
167 Ga0495630_0030867 3300046517 Bacteria 3989
168 Ga0495652_0011276 3300046529 Bacteria 8086
169 Ga0495586_0030307 3300046535 Bacteria 2895
170 Ga0495657_0024230 3300046675 Bacteria 4325
171 Ga0495599_0037268 3300046678 Bacteria 3054
172 Ga0495623_0085285 3300046679 Bacteria 1948
173 Ga0495646_0012267 3300046680 Bacteria 5450
174 Ga0495613_0118480 3300046689 Bacteria 1903
175 Ga0495684_0093396 3300047471 Bacteria 2278
176 Ga0495602_0059032 3300048088 Bacteria 3352
177 Ga0496100_0020816 3300048903 Bacteria 3940
178 Ga0496100_0024493 3300048903 Bacteria 3682
179 Ga0496101_0017026 3300048904 Bacteria 4922
180 Ga0496102_0008798 3300048905 Bacteria 8660
181 Ga0496102_0016488 3300048905 Bacteria 6457
182 Ga0496104_0024852 3300048907 Bacteria 5516
183 Ga0496105_0001921 3300048908 Bacteria 14937
184 Ga0496106_0019579 3300048909 Bacteria 5021
185 Ga0496106_0167729 3300048909 Bacteria 1739
186 Ga0496107_0011584 3300048910 Bacteria 6146
187 Ga0496108_0015963 3300048911 Bacteria 6121
188 Ga0496108_0041856 3300048911 Bacteria 3825
189 Ga0496108_0042743 3300048911 Bacteria 3784
190 Ga0496108_0216353 3300048911 Bacteria 1664
191 Ga0496109_0009105 3300048912 Bacteria 8454
192 Ga0496109_0065860 3300048912 Bacteria 3317
193 Ga0496110_0020886 3300048913 Bacteria 5532
194 Ga0496110_0098740 3300048913 Bacteria 2617
195 Ga0496110_0230305 3300048913 Bacteria 1685
196 Ga0496111_0009622 3300048914 Bacteria 6455
197 Ga0496113_0018409 3300048916 Bacteria 4864
198 Ga0496113_0023617 3300048916 Bacteria 4361
199 Ga0496114_0009156 3300048917 Bacteria 7851
200 Ga0496114_0020245 3300048917 Bacteria 5399
201 Ga0496114_0038043 3300048917 Bacteria 3980
202 Ga0496114_0040146 3300048917 Bacteria 3873
203 Ga0496114_0107537 3300048917 Bacteria 2387
204 Ga0496114_0191068 3300048917 Bacteria 1792
205 Ga0496115_0003254 3300048918 Bacteria 11657
206 Ga0496115_0050763 3300048918 Bacteria 3324
207 Ga0496126_0009000 3300048929 Bacteria 10683
208 Ga0496126_0013282 3300048929 Bacteria 8392
209 Ga0501031_0002491 3300049568 Bacteria 11747
210 Ga0501034_0015468 3300049571 Bacteria 7841
211 Ga0501034_0041273 3300049571 Bacteria 4668
212 Ga0501036_0128304 3300049572 Bacteria 2141
213 Ga0501037_0040892 3300049573 Bacteria 3411
214 Ga0501038_0086774 3300049574 Bacteria 2629
215 Ga0501038_0218786 3300049574 Bacteria 1520
216 Ga0501039_0009195 3300049575 Bacteria 7531
217 Ga0501040_0012270 3300049576 Bacteria 5613
218 Ga0501040_0024662 3300049576 Bacteria 4037
219 Ga0501040_0131985 3300049576 Bacteria 1757
220 Ga0501041_0048394 3300049577 Bacteria 2589
221 Ga0501046_0085425 3300049580 Bacteria 2433
222 Ga0501048_0034437 3300049582 Bacteria 3653
223 Ga0501067_0000461 3300049583 Bacteria 22155
224 Ga0501067_0014594 3300049583 Bacteria 4349
225 Ga0501068_0024377 3300049584 Bacteria 3552
226 Ga0501068_0026590 3300049584 Bacteria 3411
227 Ga0501068_0077110 3300049584 Bacteria 2041
228 Ga0501069_0050234 3300049585 Bacteria 2319
229 Ga0501070_0024538 3300049586 Bacteria 5056
230 Ga0501071_0031205 3300049587 Bacteria 3775
231 Ga0501072_0002112 3300049588 Bacteria 14811
232 Ga0501072_0035775 3300049588 Bacteria 3891
233 Ga0501073_0012049 3300049589 Bacteria 6312
234 Ga0501074_0001017 3300049590 Bacteria 18243
235 Ga0501074_0059538 3300049590 Bacteria 2751
236 Ga0501075_0022583 3300049591 Bacteria 4597
237 Ga0501075_0031470 3300049591 Bacteria 3938
238 Ga0501076_0043816 3300049592 Bacteria 3528
239 Ga0501077_0018573 3300049593 Bacteria 4397
240 Ga0501079_0004918 3300049741 Bacteria 9907
241 Ga0501079_0015229 3300049741 Bacteria 5866
242 Ga0501080_0010115 3300049742 Bacteria 8626
243 Ga0501081_0042268 3300049743 Bacteria 3122
244 Ga0501083_0010633 3300049744 Bacteria 6477
245 Ga0501083_0034674 3300049744 Bacteria 3450
246 Ga0501035_0029373 3300049822 Bacteria 5013
247 Ga0501035_0080779 3300049822 Bacteria 2870
248 Ga0501035_0097251 3300049822 Bacteria 2586
249 Ga0501044_0084549 3300049823 Bacteria 3207
250 Ga0501045_0032185 3300049824 Bacteria 3799
251 nmdc:mga00v17_27028_c1 3300050491 Bacteria 3347
252 nmdc:mga0yw44_19725_c1 3300050492 Bacteria 3725
253 Ga0500616_0000095 3300053153 Bacteria 180630
254 Ga0501084_0043268 3300054114 Bacteria 3768
255 Ga0501084_0085486 3300054114 Bacteria 2648
256 Ga0501084_0206990 3300054114 Bacteria 1655
257 Ga0501082_0014380 3300060353 Bacteria 6810
258 Ga0501082_0036138 3300060353 Bacteria 4256
259 Ga0466962_0024391 3300061719 Bacteria 2905
260 Ga0530510_0052689 3300061734 Bacteria 2939

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0077110 Ga0501068_0077110_35_1171 364
2 3300048913 Ga0496110_0230305 Ga0496110_0230305_23_1159 378
3 3300049576 Ga0501040_0024662 Ga0501040_0024662_2847_4016 387
4 3300005441 Ga0070700_100021483 Ga0070700_1000214835 394
5 3300014325 Ga0163163_10033455 Ga0163163_100334552 398
6 3300045976 Ga0466967_0042486 Ga0466967_0042486_77_1276 399
7 3300045976 Ga0466967_0140563 Ga0466967_0140563_30_1238 399
8 3300037068 Ga0373925_0000001 Ga0373925_0000001_379059_380423 411
9 3300005445 Ga0070708_100019854 Ga0070708_1000198545 417
10 3300005467 Ga0070706_100077648 Ga0070706_1000776482 417
11 3300005471 Ga0070698_100068287 Ga0070698_1000682874 417
12 3300006028 Ga0070717_10193284 Ga0070717_101932841 417
13 3300049822 Ga0501035_0097251 Ga0501035_0097251_13_1272 417
14 3300005435 Ga0070714_100044158 Ga0070714_1000441582 424
15 3300025928 Ga0207700_10054676 Ga0207700_100546763 424
16 3300048929 Ga0496126_0009000 Ga0496126_0009000_2080_3477 424
17 3300049744 Ga0501083_0034674 Ga0501083_0034674_44_1408 424
18 3300031852 Ga0307410_10005234 Ga0307410_100052346 425
19 3300031903 Ga0307407_10055997 Ga0307407_100559972 425
20 3300031995 Ga0307409_100002048 Ga0307409_1000020484 425
21 3300032126 Ga0307415_100000007 Ga0307415_10000000755 425
22 3300048911 Ga0496108_0041856 Ga0496108_0041856_2252_3625 425
23 3300037312 Ga0395899_0007590 Ga0395899_0007590_5999_7396 426
24 3300037418 Ga0395900_0113255 Ga0395900_0113255_28_1425 426
25 3300025927 Ga0207687_10224143 Ga0207687_102241431 428
26 3300013307 Ga0157372_10000172 Ga0157372_1000017231 435
27 3300048916 Ga0496113_0018409 Ga0496113_0018409_1032_2405 436
28 3300005356 Ga0070674_100106599 Ga0070674_1001065991 437
29 3300005440 Ga0070705_100020147 Ga0070705_1000201472 437
30 3300005547 Ga0070693_100036467 Ga0070693_1000364672 437
31 3300005614 Ga0068856_100187040 Ga0068856_1001870402 437
32 3300005615 Ga0070702_100005159 Ga0070702_1000051592 437
33 3300009148 Ga0105243_10144082 Ga0105243_101440821 437
34 3300009176 Ga0105242_10073590 Ga0105242_100735902 437
35 3300013297 Ga0157378_10014703 Ga0157378_100147037 437
36 3300014326 Ga0157380_10056250 Ga0157380_100562503 437
37 3300025937 Ga0207669_10027466 Ga0207669_100274662 437
38 3300046535 Ga0495586_0030307 Ga0495586_0030307_1063_2559 437
39 3300054114 Ga0501084_0206990 Ga0501084_0206990_295_1614 437
40 3300005329 Ga0070683_100019448 Ga0070683_1000194485 438
41 3300005438 Ga0070701_10010512 Ga0070701_100105122 438
42 3300005459 Ga0068867_100011082 Ga0068867_1000110825 438
43 3300006881 Ga0068865_100029331 Ga0068865_1000293312 438
44 3300009098 Ga0105245_10016996 Ga0105245_100169965 438
45 3300025927 Ga0207687_10024263 Ga0207687_100242634 438
46 3300026075 Ga0207708_10001891 Ga0207708_100018918 438
47 3300026089 Ga0207648_10007397 Ga0207648_100073976 438
48 3300026118 Ga0207675_100020019 Ga0207675_1000200192 438
49 3300044694 Ga0466963_0142653 Ga0466963_0142653_60_1439 438
50 3300048917 Ga0496114_0107537 Ga0496114_0107537_102_1475 438
51 3300005343 Ga0070687_100045108 Ga0070687_1000451082 440
52 3300005345 Ga0070692_10003215 Ga0070692_100032155 440
53 3300005347 Ga0070668_100131132 Ga0070668_1001311322 440
54 3300005455 Ga0070663_100104878 Ga0070663_1001048782 440
55 3300005844 Ga0068862_100071522 Ga0068862_1000715222 440
56 3300009148 Ga0105243_10032415 Ga0105243_100324152 440
57 3300014326 Ga0157380_10006842 Ga0157380_100068426 440
58 3300025901 Ga0207688_10019663 Ga0207688_100196633 440
59 3300025918 Ga0207662_10054151 Ga0207662_100541512 440
60 3300028380 Ga0268265_10126635 Ga0268265_101266352 440
61 3300031995 Ga0307409_100219254 Ga0307409_1002192541 441
62 3300025928 Ga0207700_10018516 Ga0207700_100185162 444
63 3300005435 Ga0070714_100080043 Ga0070714_1000800433 446
64 3300025929 Ga0207664_10018832 Ga0207664_100188323 446
65 3300041498 Ga0451841_0819440 Ga0451841_0819440_863_2263 446
66 3300005985 Ga0081539_10003872 Ga0081539_100038725 448
67 3300014326 Ga0157380_10055549 Ga0157380_100555491 449
68 3300025926 Ga0207659_10043910 Ga0207659_100439103 449
69 iso_pu_bacteria 2839986021 2839987508 449
70 3300048903 Ga0496100_0020816 Ga0496100_0020816_1157_2509 450
71 3300048904 Ga0496101_0017026 Ga0496101_0017026_1061_2413 450
72 3300048909 Ga0496106_0019579 Ga0496106_0019579_3309_4661 450
73 3300048911 Ga0496108_0015963 Ga0496108_0015963_1591_2943 450
74 iso_pu_bacteria 2643221641 2644231414 450
75 iso_pu_bacteria 8054609563 8054612458 450
76 3300025945 Ga0207679_10271686 Ga0207679_102716861 451
77 3300048912 Ga0496109_0009105 Ga0496109_0009105_6369_7724 451
78 3300048916 Ga0496113_0023617 Ga0496113_0023617_1129_2484 451
79 3300005327 Ga0070658_10042767 Ga0070658_100427673 452
80 3300005329 Ga0070683_100000365 Ga0070683_10000036519 452
81 3300005335 Ga0070666_10127725 Ga0070666_101277251 452
82 3300005337 Ga0070682_100002279 Ga0070682_1000022796 452
83 3300005338 Ga0068868_100051508 Ga0068868_1000515082 452
84 3300005339 Ga0070660_100043961 Ga0070660_1000439613 452
85 3300005345 Ga0070692_10006570 Ga0070692_100065703 452
86 3300005353 Ga0070669_100121418 Ga0070669_1001214182 452
87 3300005366 Ga0070659_100047501 Ga0070659_1000475013 452
88 3300005367 Ga0070667_100041884 Ga0070667_1000418842 452
89 3300005468 Ga0070707_100009144 Ga0070707_1000091445 452
90 3300005471 Ga0070698_100013597 Ga0070698_1000135972 452
91 3300005535 Ga0070684_100003624 Ga0070684_1000036243 452
92 3300005535 Ga0070684_100032959 Ga0070684_1000329593 452
93 3300005543 Ga0070672_100190774 Ga0070672_1001907742 452
94 3300005548 Ga0070665_100001179 Ga0070665_10000117910 452
95 3300005618 Ga0068864_100083012 Ga0068864_1000830122 452
96 3300006051 Ga0075364_10028911 Ga0075364_100289113 452
97 3300009098 Ga0105245_10019642 Ga0105245_100196423 452
98 3300009553 Ga0105249_10045379 Ga0105249_100453793 452
99 3300009553 Ga0105249_10052092 Ga0105249_100520923 452
100 3300010375 Ga0105239_10001015 Ga0105239_1000101523 452
101 3300013306 Ga0163162_10045744 Ga0163162_100457443 452
102 3300013307 Ga0157372_10002484 Ga0157372_100024848 452
103 3300014325 Ga0163163_10235585 Ga0163163_102355852 452
104 3300014745 Ga0157377_10087329 Ga0157377_100873291 452
105 3300025905 Ga0207685_10056809 Ga0207685_100568092 452
106 3300025909 Ga0207705_10056964 Ga0207705_100569642 452
107 3300025919 Ga0207657_10067988 Ga0207657_100679882 452
108 3300025922 Ga0207646_10022376 Ga0207646_100223764 452
109 3300025932 Ga0207690_10033282 Ga0207690_100332823 452
110 3300025938 Ga0207704_10022805 Ga0207704_100228052 452
111 3300025939 Ga0207665_10010132 Ga0207665_100101323 452
112 3300025944 Ga0207661_10004837 Ga0207661_100048374 452
113 3300025944 Ga0207661_10068804 Ga0207661_100688042 452
114 3300026023 Ga0207677_10124052 Ga0207677_101240522 452
115 3300026095 Ga0207676_10196227 Ga0207676_101962272 452
116 3300026116 Ga0207674_10001716 Ga0207674_100017169 452
117 3300028379 Ga0268266_10001751 Ga0268266_1000175114 452
118 3300035117 Ga0373953_0034550 Ga0373953_0034550_35_1405 452
119 3300035120 Ga0373957_0003905 Ga0373957_0003905_3070_4440 452
120 3300035724 Ga0373933_0040404 Ga0373933_0040404_484_1854 452
121 3300036401 Ga0373937_0237543 Ga0373937_0237543_277_1647 452
122 3300044694 Ga0466963_0052352 Ga0466963_0052352_194_1558 452
123 3300046454 Ga0495592_0063997 Ga0495592_0063997_183_1553 452
124 3300046463 Ga0495653_0028520 Ga0495653_0028520_329_1699 452
125 3300046477 Ga0495664_0039859 Ga0495664_0039859_1248_2618 452
126 3300046514 Ga0495618_0051643 Ga0495618_0051643_456_1826 452
127 3300046516 Ga0495628_0024541 Ga0495628_0024541_2464_3834 452
128 3300046517 Ga0495630_0030867 Ga0495630_0030867_2060_3430 452
129 3300046529 Ga0495652_0011276 Ga0495652_0011276_1928_3298 452
130 3300046675 Ga0495657_0024230 Ga0495657_0024230_2413_3783 452
131 3300046678 Ga0495599_0037268 Ga0495599_0037268_666_2036 452
132 3300046679 Ga0495623_0085285 Ga0495623_0085285_398_1768 452
133 3300046680 Ga0495646_0012267 Ga0495646_0012267_392_1762 452
134 3300046689 Ga0495613_0118480 Ga0495613_0118480_77_1447 452
135 3300047471 Ga0495684_0093396 Ga0495684_0093396_392_1762 452
136 3300048088 Ga0495602_0059032 Ga0495602_0059032_1413_2783 452
137 3300048903 Ga0496100_0024493 Ga0496100_0024493_1341_2738 452
138 3300048905 Ga0496102_0008798 Ga0496102_0008798_195_1556 452
139 3300048905 Ga0496102_0016488 Ga0496102_0016488_2389_3786 452
140 3300048907 Ga0496104_0024852 Ga0496104_0024852_2198_3595 452
141 3300048908 Ga0496105_0001921 Ga0496105_0001921_6120_7517 452
142 3300048909 Ga0496106_0167729 Ga0496106_0167729_68_1426 452
143 3300048910 Ga0496107_0011584 Ga0496107_0011584_2145_3542 452
144 3300048911 Ga0496108_0042743 Ga0496108_0042743_299_1660 452
145 3300048911 Ga0496108_0216353 Ga0496108_0216353_72_1430 452
146 3300048912 Ga0496109_0065860 Ga0496109_0065860_1231_2589 452
147 3300048913 Ga0496110_0098740 Ga0496110_0098740_219_1580 452
148 3300048914 Ga0496111_0009622 Ga0496111_0009622_2648_4009 452
149 3300048917 Ga0496114_0009156 Ga0496114_0009156_6370_7767 452
150 3300048917 Ga0496114_0020245 Ga0496114_0020245_3925_5292 452
151 3300048917 Ga0496114_0038043 Ga0496114_0038043_2429_3826 452
152 3300048917 Ga0496114_0040146 Ga0496114_0040146_65_1426 452
153 3300048917 Ga0496114_0191068 Ga0496114_0191068_188_1552 452
154 3300048918 Ga0496115_0003254 Ga0496115_0003254_7906_9303 452
155 3300049571 Ga0501034_0015468 Ga0501034_0015468_1477_2841 452
156 3300049583 Ga0501067_0000461 Ga0501067_0000461_18733_20097 452
157 3300049584 Ga0501068_0024377 Ga0501068_0024377_1258_2622 452
158 3300049584 Ga0501068_0026590 Ga0501068_0026590_1645_3009 452
159 3300049586 Ga0501070_0024538 Ga0501070_0024538_2245_3609 452
160 3300049588 Ga0501072_0002112 Ga0501072_0002112_2423_3787 452
161 3300049589 Ga0501073_0012049 Ga0501073_0012049_2296_3660 452
162 3300049590 Ga0501074_0001017 Ga0501074_0001017_2245_3609 452
163 3300049590 Ga0501074_0059538 Ga0501074_0059538_987_2351 452
164 3300049593 Ga0501077_0018573 Ga0501077_0018573_2244_3608 452
165 3300049741 Ga0501079_0004918 Ga0501079_0004918_3537_4901 452
166 3300049742 Ga0501080_0010115 Ga0501080_0010115_2245_3609 452
167 3300049744 Ga0501083_0010633 Ga0501083_0010633_4949_6313 452
168 3300050491 nmdc:mga00v17_27028_c1 nmdc:mga00v17_27028_c1_181_1542 452
169 3300054114 Ga0501084_0043268 Ga0501084_0043268_2018_3382 452
170 3300060353 Ga0501082_0036138 Ga0501082_0036138_1717_3081 452
171 3300005329 Ga0070683_100008624 Ga0070683_1000086248 453
172 3300005436 Ga0070713_100044881 Ga0070713_1000448813 453
173 3300005458 Ga0070681_10137953 Ga0070681_101379532 453
174 3300025929 Ga0207664_10219647 Ga0207664_102196472 453
175 3300025944 Ga0207661_10028632 Ga0207661_100286324 453
176 3300028800 Ga0265338_10002833 Ga0265338_100028338 453
177 3300032126 Ga0307415_100181028 Ga0307415_1001810282 453
178 3300048929 Ga0496126_0013282 Ga0496126_0013282_6592_7980 454
179 3300050492 nmdc:mga0yw44_19725_c1 nmdc:mga0yw44_19725_c1_1827_3194 454
180 iso_pu_bacteria 2919051321 2919053255 454
181 3300005441 Ga0070700_100055130 Ga0070700_1000551302 455
182 3300010375 Ga0105239_10052272 Ga0105239_100522722 455
183 3300025910 Ga0207684_10086345 Ga0207684_100863454 455
184 3300028556 Ga0265337_1001178 Ga0265337_10011782 455
185 3300028558 Ga0265326_10010612 Ga0265326_100106122 455
186 3300028563 Ga0265319_1002922 Ga0265319_10029223 455
187 3300028573 Ga0265334_10001149 Ga0265334_1000114911 455
188 3300028577 Ga0265318_10014895 Ga0265318_100148953 455
189 3300028653 Ga0265323_10007923 Ga0265323_100079233 455
190 3300028654 Ga0265322_10009142 Ga0265322_100091423 455
191 3300028666 Ga0265336_10001212 Ga0265336_100012129 455
192 3300028800 Ga0265338_10012278 Ga0265338_100122789 455
193 3300029957 Ga0265324_10001086 Ga0265324_1000108613 455
194 3300031238 Ga0265332_10038459 Ga0265332_100384592 455
195 3300031241 Ga0265325_10012553 Ga0265325_100125533 455
196 3300031247 Ga0265340_10025786 Ga0265340_100257863 455
197 3300031595 Ga0265313_10002734 Ga0265313_100027347 455
198 3300031711 Ga0265314_10019629 Ga0265314_100196292 455
199 3300031712 Ga0265342_10001585 Ga0265342_100015854 455
200 3300044901 Ga0466960_0016125 Ga0466960_0016125_1000_2370 455
201 3300049576 Ga0501040_0131985 Ga0501040_0131985_299_1678 455
202 3300049583 Ga0501067_0014594 Ga0501067_0014594_2873_4243 455
203 3300049585 Ga0501069_0050234 Ga0501069_0050234_391_1764 455
204 3300009098 Ga0105245_10094960 Ga0105245_100949602 456
205 3300009177 Ga0105248_10266529 Ga0105248_102665292 456
206 3300014968 Ga0157379_10040904 Ga0157379_100409042 456
207 3300025904 Ga0207647_10028619 Ga0207647_100286193 456
208 3300025941 Ga0207711_10178868 Ga0207711_101788682 456
209 3300025949 Ga0207667_10169757 Ga0207667_101697572 456
210 3300026041 Ga0207639_10003095 Ga0207639_100030958 456
211 3300037466 Ga0395898_0031269 Ga0395898_0031269_3398_4807 456
212 3300049571 Ga0501034_0041273 Ga0501034_0041273_1696_3108 456
213 3300049574 Ga0501038_0086774 Ga0501038_0086774_418_1821 456
214 3300049574 Ga0501038_0218786 Ga0501038_0218786_13_1392 456
215 3300049576 Ga0501040_0012270 Ga0501040_0012270_3310_4689 456
216 3300049580 Ga0501046_0085425 Ga0501046_0085425_710_2113 456
217 3300049582 Ga0501048_0034437 Ga0501048_0034437_1345_2724 456
218 3300049591 Ga0501075_0031470 Ga0501075_0031470_2331_3710 456
219 3300049592 Ga0501076_0043816 Ga0501076_0043816_125_1504 456
220 3300049743 Ga0501081_0042268 Ga0501081_0042268_38_1417 456
221 3300049822 Ga0501035_0029373 Ga0501035_0029373_643_2055 456
222 3300049822 Ga0501035_0080779 Ga0501035_0080779_1125_2528 456
223 3300049823 Ga0501044_0084549 Ga0501044_0084549_279_1682 456
224 3300053153 Ga0500616_0000095 Ga0500616_0000095_160945_162330 456
225 3300054114 Ga0501084_0085486 Ga0501084_0085486_967_2346 456
226 3300060353 Ga0501082_0014380 Ga0501082_0014380_4802_6181 456
227 3300048913 Ga0496110_0020886 Ga0496110_0020886_1855_3261 457
228 3300048918 Ga0496115_0050763 Ga0496115_0050763_1444_2841 457
229 3300044694 Ga0466963_0019394 Ga0466963_0019394_1552_2931 458
230 3300049568 Ga0501031_0002491 Ga0501031_0002491_8526_9911 458
231 3300049572 Ga0501036_0128304 Ga0501036_0128304_86_1471 458
232 3300049573 Ga0501037_0040892 Ga0501037_0040892_1942_3327 458
233 3300049575 Ga0501039_0009195 Ga0501039_0009195_6069_7454 458
234 3300049577 Ga0501041_0048394 Ga0501041_0048394_68_1453 458
235 3300049587 Ga0501071_0031205 Ga0501071_0031205_64_1449 458
236 3300049588 Ga0501072_0035775 Ga0501072_0035775_2454_3839 458
237 3300049591 Ga0501075_0022583 Ga0501075_0022583_44_1429 458
238 3300049741 Ga0501079_0015229 Ga0501079_0015229_4394_5779 458
239 3300049824 Ga0501045_0032185 Ga0501045_0032185_2332_3717 458
240 3300061719 Ga0466962_0024391 Ga0466962_0024391_1514_2893 458
241 3300061734 Ga0530510_0052689 Ga0530510_0052689_1528_2913 458
242 3300003752 Ga0055539_1000027 Ga0055539_100002775 459
243 3300003756 Ga0055533_1000020 Ga0055533_100002075 459
244 3300003759 Ga0055525_1000296 Ga0055525_10002964 459
245 3300005335 Ga0070666_10009075 Ga0070666_100090757 459
246 3300005355 Ga0070671_100004116 Ga0070671_1000041166 459
247 3300005367 Ga0070667_100040377 Ga0070667_1000403774 459
248 3300005548 Ga0070665_100000637 Ga0070665_10000063730 459
249 3300005841 Ga0068863_100001783 Ga0068863_1000017833 459
250 3300005842 Ga0068858_100005296 Ga0068858_1000052966 459
251 3300005843 Ga0068860_100000085 Ga0068860_100000085136 459
252 3300014968 Ga0157379_10017380 Ga0157379_100173807 459
253 3300025225 Ga0209566_100366 Ga0209566_10036613 459
254 3300025226 Ga0209674_100001 Ga0209674_1000013822 459
255 3300025230 Ga0209563_100001 Ga0209563_1000013822 459
256 3300025253 Ga0209677_100001 Ga0209677_1000013822 459
257 3300025903 Ga0207680_10022070 Ga0207680_100220701 459
258 3300025931 Ga0207644_10059588 Ga0207644_100595882 459
259 3300025972 Ga0207668_10080963 Ga0207668_100809632 459
260 3300026035 Ga0207703_10020607 Ga0207703_100206073 459
261 3300026088 Ga0207641_10055891 Ga0207641_100558913 459
262 3300028379 Ga0268266_10001563 Ga0268266_100015632 459
263 3300028381 Ga0268264_10000031 Ga0268264_1000003129 459
264 3300044693 Ga0466961_0038339 Ga0466961_0038339_1129_2508 459

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00282

Pyridoxal_deC

Pyridoxal-dependent decarboxylase conserved domain

35

391

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mbb-assembly1.cif.gz_B crystal structure of stspl - apo form, after treatment with semicarbazide 0.8449 110 458
3maf-assembly1.cif.gz_B crystal structure of stspl (asymmetric form) 0.8339 110 458
3mad-assembly1.cif.gz_B crystal structure of stspl (symmetric form) 0.8282 113 458
6m4y-assembly1.cif.gz_A-2 structure of a r371a mutant of a group ii plp dependent decarboxylase from methanocaldococcus jannaschii 0.8163 111 453
1v72-assembly1.cif.gz_A crystal structure of phenylserine aldolase from pseudomonas putida 0.8109 117 454
ID Description Score Start End Superfamily
3k40B03 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.927 365 457 3.90.1150.10
3rbfA03 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9225 367 458 3.90.1150.10
af_Q95ZS2_455_559_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9201 366 458 3.90.1150.10
af_Q05733_379_483_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9147 366 458 3.90.1150.10
af_P19113_380_477_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9124 366 458 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A4Q3C6P6-F1-model_v4 Aspartate aminotransferase family protein 0.9808 116 458 GO:0008483
GO:0016831
GO:0019752
GO:0030170
AF-A0A1Q7H3Z0-F1-model_v4 Aspartate aminotransferase family protein 0.971 80 455 GO:0008483
GO:0016831
GO:0019752
GO:0030170
AF-A0A7Y0PEI7-F1-model_v4 Uncharacterized protein 0.9655 117 322 GO:0005737
GO:0016831
GO:0019752
GO:0030170
AF-A0A7W0XZD9-F1-model_v4 Aspartate aminotransferase family protein 0.9589 271 458 GO:0008483
GO:0016831
GO:0019752
GO:0030170
AF-A0A7Y2E6A5-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9573 187 457 GO:0008483
GO:0016831
GO:0019752
GO:0030170

Feature Viewer

pLDDT pTM Quality
90.5 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map