F373310
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 265 | 162 | 265 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10000442|Ga0157369_1000044228 |
| Length | 351 |
| Sequence | VPATLKPAPLRRGDTVVIVAPASNIKHELLERGAAALRDGFGYRVVFAQSIFERDLYFAGDLDRRVREFHAAFESEDVRAIVCARGGYGCNYLLEHVDLDLVRRHPKILVGSSDITSLLTYLHDATGLVTFHGPMAAAGFATDPGAKWAGSPEGVHPAAWECAVGGWFGYDAAEEDVTTLVPGEAEGKLYGGCLSMLAASLGTPFEVQPRDTILFLEDVNTKPYQVDRMLMQLALAGKLDGVRGFVFGEMLDCVQPGGQDYTLQDVIVRLLGERCPGVPVVFGFRSGHVSRHNITLPIGVRARLQAAPGDVRLTIVESAVEPAGTNAGELIAKVQGAQRPVRFDGNGRSVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 44 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 45 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 110 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 111 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 125 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 126 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 127 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 128 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 129 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 138 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 143 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 144 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 147 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 148 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 149 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 154 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 155 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 156 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 157 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.77 |
| Nodule | 0 |
| Rhizoplane | 6.42 |
| Rhizosphere | 87.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000684 | 3300000546 | Bacteria | 5718 |
| 2 | Ga0070658_10358896 | 3300005327 | Bacteria | 1248 |
| 3 | Ga0070683_100081646 | 3300005329 | Bacteria | 3027 |
| 4 | Ga0070683_100253935 | 3300005329 | Bacteria | 1672 |
| 5 | Ga0070683_100297784 | 3300005329 | Bacteria | 1534 |
| 6 | Ga0070670_100021939 | 3300005331 | Bacteria | 5494 |
| 7 | Ga0070680_100082456 | 3300005336 | Unclassified | 2654 |
| 8 | Ga0068868_100000948 | 3300005338 | Bacteria | 19729 |
| 9 | Ga0068868_100017827 | 3300005338 | Bacteria | 5296 |
| 10 | Ga0070660_100159586 | 3300005339 | Bacteria | 1816 |
| 11 | Ga0070660_100183992 | 3300005339 | Bacteria | 1691 |
| 12 | Ga0070689_100096012 | 3300005340 | Bacteria | 2342 |
| 13 | Ga0070661_100004819 | 3300005344 | Bacteria | 9288 |
| 14 | Ga0070661_100048894 | 3300005344 | Unclassified | 3096 |
| 15 | Ga0070661_100246218 | 3300005344 | Bacteria | 1378 |
| 16 | Ga0070669_100248773 | 3300005353 | Bacteria | 1415 |
| 17 | Ga0070709_10016024 | 3300005434 | Bacteria | 4272 |
| 18 | Ga0070714_100001244 | 3300005435 | Bacteria | 18383 |
| 19 | Ga0070714_100646991 | 3300005435 | Bacteria | 1017 |
| 20 | Ga0070713_100005742 | 3300005436 | Bacteria | 8523 |
| 21 | Ga0070713_100056414 | 3300005436 | Bacteria | 3268 |
| 22 | Ga0070713_100242135 | 3300005436 | Bacteria | 1643 |
| 23 | Ga0070713_100266509 | 3300005436 | Bacteria | 1567 |
| 24 | Ga0070710_10044023 | 3300005437 | Bacteria | 2475 |
| 25 | Ga0070711_100001945 | 3300005439 | Bacteria | 11581 |
| 26 | Ga0070708_100001670 | 3300005445 | Bacteria | 17028 |
| 27 | Ga0070708_100006061 | 3300005445 | Bacteria | 9615 |
| 28 | Ga0070681_10000201 | 3300005458 | Bacteria | 46571 |
| 29 | Ga0070681_10011383 | 3300005458 | Bacteria | 8802 |
| 30 | Ga0070681_10074104 | 3300005458 | Bacteria | 3366 |
| 31 | Ga0070681_10094704 | 3300005458 | Bacteria | 2934 |
| 32 | Ga0068867_100028194 | 3300005459 | Bacteria | 4041 |
| 33 | Ga0070706_100008356 | 3300005467 | Bacteria | 9646 |
| 34 | Ga0070706_100013738 | 3300005467 | Bacteria | 7487 |
| 35 | Ga0070707_100003256 | 3300005468 | Bacteria | 15391 |
| 36 | Ga0070707_100008252 | 3300005468 | Bacteria | 9666 |
| 37 | Ga0070707_100087974 | 3300005468 | Bacteria | 3005 |
| 38 | Ga0070698_100007842 | 3300005471 | Bacteria | 11559 |
| 39 | Ga0070698_100046230 | 3300005471 | Bacteria | 4451 |
| 40 | Ga0070699_100000976 | 3300005518 | Bacteria | 26672 |
| 41 | Ga0070679_100130387 | 3300005530 | Unclassified | 2495 |
| 42 | Ga0070679_100203311 | 3300005530 | Bacteria | 1946 |
| 43 | Ga0070697_100000337 | 3300005536 | Bacteria | 36991 |
| 44 | Ga0070697_100040580 | 3300005536 | Bacteria | 3767 |
| 45 | Ga0068853_100013973 | 3300005539 | Bacteria | 6568 |
| 46 | Ga0068853_100158019 | 3300005539 | Bacteria | 2044 |
| 47 | Ga0070695_100325171 | 3300005545 | Bacteria | 1144 |
| 48 | Ga0070693_100008422 | 3300005547 | Bacteria | 5083 |
| 49 | Ga0068855_100000282 | 3300005563 | Bacteria | 62654 |
| 50 | Ga0068855_100006263 | 3300005563 | Bacteria | 14508 |
| 51 | Ga0068855_100008514 | 3300005563 | Bacteria | 12401 |
| 52 | Ga0068855_100045068 | 3300005563 | Bacteria | 5217 |
| 53 | Ga0070664_100000302 | 3300005564 | Bacteria | 35799 |
| 54 | Ga0068857_100036870 | 3300005577 | Bacteria | 4331 |
| 55 | Ga0068857_100036989 | 3300005577 | Bacteria | 4324 |
| 56 | Ga0068857_100050459 | 3300005577 | Bacteria | 3691 |
| 57 | Ga0068857_100195500 | 3300005577 | Bacteria | 1843 |
| 58 | Ga0068854_100018072 | 3300005578 | Bacteria | 4727 |
| 59 | Ga0068856_100000026 | 3300005614 | Bacteria | 135674 |
| 60 | Ga0068856_100000506 | 3300005614 | Bacteria | 43162 |
| 61 | Ga0068856_100001494 | 3300005614 | Bacteria | 24459 |
| 62 | Ga0068856_100032885 | 3300005614 | Bacteria | 5079 |
| 63 | Ga0068856_100303225 | 3300005614 | Bacteria | 1615 |
| 64 | Ga0068852_100074860 | 3300005616 | Bacteria | 2984 |
| 65 | Ga0068859_100000193 | 3300005617 | Bacteria | 59184 |
| 66 | Ga0068864_100000449 | 3300005618 | Bacteria | 35592 |
| 67 | Ga0068864_100033853 | 3300005618 | Bacteria | 4344 |
| 68 | Ga0068866_10002811 | 3300005718 | Bacteria | 7172 |
| 69 | Ga0068861_100312423 | 3300005719 | Unclassified | 1366 |
| 70 | Ga0068851_10064294 | 3300005834 | Bacteria | 1885 |
| 71 | Ga0068851_10111289 | 3300005834 | Unclassified | 1462 |
| 72 | Ga0068863_100122728 | 3300005841 | Unclassified | 2478 |
| 73 | Ga0068858_100006271 | 3300005842 | Bacteria | 11589 |
| 74 | Ga0068858_100007985 | 3300005842 | Bacteria | 10202 |
| 75 | Ga0068860_100026246 | 3300005843 | Bacteria | 5616 |
| 76 | Ga0070717_10026351 | 3300006028 | Bacteria | 4636 |
| 77 | Ga0075365_10078244 | 3300006038 | Bacteria | 2235 |
| 78 | Ga0075363_100019951 | 3300006048 | Bacteria | 3356 |
| 79 | Ga0075364_10150212 | 3300006051 | Bacteria | 1570 |
| 80 | Ga0075364_10181663 | 3300006051 | Bacteria | 1424 |
| 81 | Ga0075367_10054484 | 3300006178 | Bacteria | 2372 |
| 82 | Ga0097621_100000520 | 3300006237 | Bacteria | 26997 |
| 83 | Ga0097621_100002293 | 3300006237 | Bacteria | 13104 |
| 84 | Ga0097621_100007442 | 3300006237 | Bacteria | 7833 |
| 85 | Ga0068871_100000211 | 3300006358 | Bacteria | 40563 |
| 86 | Ga0068871_100002566 | 3300006358 | Bacteria | 12404 |
| 87 | Ga0068871_100143983 | 3300006358 | Unclassified | 2028 |
| 88 | Ga0075428_100009581 | 3300006844 | Bacteria | 10757 |
| 89 | Ga0075428_100036314 | 3300006844 | Bacteria | 5428 |
| 90 | Ga0075428_100039593 | 3300006844 | Bacteria | 5188 |
| 91 | Ga0075428_100545471 | 3300006844 | Unclassified | 1240 |
| 92 | Ga0075431_100035712 | 3300006847 | Bacteria | 5117 |
| 93 | Ga0075433_10046434 | 3300006852 | Bacteria | 3777 |
| 94 | Ga0075433_10067791 | 3300006852 | Bacteria | 3131 |
| 95 | Ga0075434_100043323 | 3300006871 | Bacteria | 4464 |
| 96 | Ga0075429_100003095 | 3300006880 | Bacteria | 14117 |
| 97 | Ga0075436_100028834 | 3300006914 | Bacteria | 3818 |
| 98 | Ga0097620_100000193 | 3300006931 | Bacteria | 59184 |
| 99 | Ga0105240_10080816 | 3300009093 | Unclassified | 3996 |
| 100 | Ga0111539_10006409 | 3300009094 | Bacteria | 15174 |
| 101 | Ga0111539_10115149 | 3300009094 | Bacteria | 3153 |
| 102 | Ga0105245_10020465 | 3300009098 | Bacteria | 5802 |
| 103 | Ga0114129_10007504 | 3300009147 | Bacteria | 15532 |
| 104 | Ga0114129_10008591 | 3300009147 | Bacteria | 14564 |
| 105 | Ga0105243_10164484 | 3300009148 | Bacteria | 1916 |
| 106 | Ga0105248_10003075 | 3300009177 | Bacteria | 18502 |
| 107 | Ga0105237_10054798 | 3300009545 | Bacteria | 3995 |
| 108 | Ga0105237_10255381 | 3300009545 | Bacteria | 1755 |
| 109 | Ga0105237_10483969 | 3300009545 | Bacteria | 1244 |
| 110 | Ga0105238_10005366 | 3300009551 | Bacteria | 12666 |
| 111 | Ga0105238_10142629 | 3300009551 | Bacteria | 2372 |
| 112 | Ga0105239_10024447 | 3300010375 | Bacteria | 6656 |
| 113 | Ga0105239_10035721 | 3300010375 | Bacteria | 5456 |
| 114 | Ga0105239_10131125 | 3300010375 | Bacteria | 2788 |
| 115 | Ga0105246_10066700 | 3300011119 | Bacteria | 2520 |
| 116 | Ga0157371_10023735 | 3300013102 | Bacteria | 4483 |
| 117 | Ga0157371_10038585 | 3300013102 | Bacteria | 3417 |
| 118 | Ga0157371_10081876 | 3300013102 | Bacteria | 2285 |
| 119 | Ga0157369_10000229 | 3300013105 | Bacteria | 77507 |
| 120 | Ga0157369_10000442 | 3300013105 | Bacteria | 55048 |
| 121 | Ga0157369_10058587 | 3300013105 | Bacteria | 4155 |
| 122 | Ga0157369_10103665 | 3300013105 | Bacteria | 3030 |
| 123 | Ga0157374_10000090 | 3300013296 | Bacteria | 88789 |
| 124 | Ga0157374_10000750 | 3300013296 | Bacteria | 28316 |
| 125 | Ga0157374_10001253 | 3300013296 | Bacteria | 21678 |
| 126 | Ga0157378_10000070 | 3300013297 | Bacteria | 91609 |
| 127 | Ga0157378_10000596 | 3300013297 | Bacteria | 33870 |
| 128 | Ga0157378_10001219 | 3300013297 | Bacteria | 23313 |
| 129 | Ga0157378_10382082 | 3300013297 | Bacteria | 1383 |
| 130 | Ga0157372_10000100 | 3300013307 | Bacteria | 89828 |
| 131 | Ga0157372_10000211 | 3300013307 | Bacteria | 65258 |
| 132 | Ga0157372_10000948 | 3300013307 | Bacteria | 31645 |
| 133 | Ga0157372_10015753 | 3300013307 | Bacteria | 8109 |
| 134 | Ga0157372_10067231 | 3300013307 | Bacteria | 4027 |
| 135 | Ga0182008_10007422 | 3300014497 | Bacteria | 6054 |
| 136 | Ga0157377_10306156 | 3300014745 | Bacteria | 1050 |
| 137 | Ga0157376_10005194 | 3300014969 | Bacteria | 9084 |
| 138 | Ga0182007_10006898 | 3300015262 | Bacteria | 4828 |
| 139 | Ga0207692_10018608 | 3300025898 | Bacteria | 3122 |
| 140 | Ga0207642_10012143 | 3300025899 | Bacteria | 3100 |
| 141 | Ga0207699_10015466 | 3300025906 | Bacteria | 3964 |
| 142 | Ga0207684_10001148 | 3300025910 | Bacteria | 29555 |
| 143 | Ga0207684_10068018 | 3300025910 | Unclassified | 3028 |
| 144 | Ga0207654_10220465 | 3300025911 | Bacteria | 1258 |
| 145 | Ga0207707_10003069 | 3300025912 | Bacteria | 14828 |
| 146 | Ga0207707_10008706 | 3300025912 | Bacteria | 8806 |
| 147 | Ga0207660_10207033 | 3300025917 | Bacteria | 1534 |
| 148 | Ga0207657_10003001 | 3300025919 | Bacteria | 18081 |
| 149 | Ga0207649_10005549 | 3300025920 | Bacteria | 6826 |
| 150 | Ga0207649_10073528 | 3300025920 | Bacteria | 2190 |
| 151 | Ga0207652_10130999 | 3300025921 | Bacteria | 2237 |
| 152 | Ga0207652_10136066 | 3300025921 | Bacteria | 2194 |
| 153 | Ga0207646_10000855 | 3300025922 | Bacteria | 39420 |
| 154 | Ga0207646_10006871 | 3300025922 | Bacteria | 11686 |
| 155 | Ga0207646_10127032 | 3300025922 | Bacteria | 2293 |
| 156 | Ga0207694_10018480 | 3300025924 | Bacteria | 5269 |
| 157 | Ga0207650_10009446 | 3300025925 | Bacteria | 6665 |
| 158 | Ga0207700_10051950 | 3300025928 | Bacteria | 3062 |
| 159 | Ga0207664_10031102 | 3300025929 | Bacteria | 4081 |
| 160 | Ga0207664_10043803 | 3300025929 | Bacteria | 3503 |
| 161 | Ga0207670_10078512 | 3300025936 | Bacteria | 2302 |
| 162 | Ga0207704_10058895 | 3300025938 | Bacteria | 2368 |
| 163 | Ga0207665_10220045 | 3300025939 | Bacteria | 1391 |
| 164 | Ga0207661_10075924 | 3300025944 | Unclassified | 2759 |
| 165 | Ga0207661_10090860 | 3300025944 | Bacteria | 2543 |
| 166 | Ga0207679_10004874 | 3300025945 | Bacteria | 8363 |
| 167 | Ga0207679_10092199 | 3300025945 | Bacteria | 2347 |
| 168 | Ga0207667_10000170 | 3300025949 | Bacteria | 95740 |
| 169 | Ga0207667_10008764 | 3300025949 | Bacteria | 11980 |
| 170 | Ga0207667_10012711 | 3300025949 | Bacteria | 9672 |
| 171 | Ga0207640_10009055 | 3300025981 | Bacteria | 5556 |
| 172 | Ga0207677_10001452 | 3300026023 | Bacteria | 12553 |
| 173 | Ga0207677_10021372 | 3300026023 | Unclassified | 3953 |
| 174 | Ga0207639_10150597 | 3300026041 | Bacteria | 1948 |
| 175 | Ga0207702_10000131 | 3300026078 | Bacteria | 89131 |
| 176 | Ga0207702_10001252 | 3300026078 | Bacteria | 25632 |
| 177 | Ga0207702_10008063 | 3300026078 | Bacteria | 8910 |
| 178 | Ga0207702_10013286 | 3300026078 | Bacteria | 6848 |
| 179 | Ga0207641_10056892 | 3300026088 | Unclassified | 3325 |
| 180 | Ga0207648_10010603 | 3300026089 | Bacteria | 8716 |
| 181 | Ga0207676_10001648 | 3300026095 | Bacteria | 16441 |
| 182 | Ga0207676_10011169 | 3300026095 | Bacteria | 6412 |
| 183 | Ga0207674_10001066 | 3300026116 | Bacteria | 35666 |
| 184 | Ga0207674_10024079 | 3300026116 | Bacteria | 6511 |
| 185 | Ga0207674_10056443 | 3300026116 | Bacteria | 3988 |
| 186 | Ga0207698_10042956 | 3300026142 | Bacteria | 3383 |
| 187 | Ga0265326_10004077 | 3300028558 | Bacteria | 4717 |
| 188 | Ga0265338_10000009 | 3300028800 | Bacteria | 448611 |
| 189 | Ga0265338_10000240 | 3300028800 | Bacteria | 101444 |
| 190 | Ga0265338_10028135 | 3300028800 | Bacteria | 5616 |
| 191 | Ga0265338_10117942 | 3300028800 | Bacteria | 2122 |
| 192 | Ga0265324_10000693 | 3300029957 | Bacteria | 22492 |
| 193 | Ga0265324_10024058 | 3300029957 | Bacteria | 2166 |
| 194 | Ga0265760_10001034 | 3300031090 | Bacteria | 8094 |
| 195 | Ga0265325_10012794 | 3300031241 | Bacteria | 4788 |
| 196 | Ga0265340_10007519 | 3300031247 | Bacteria | 5914 |
| 197 | Ga0265339_10085893 | 3300031249 | Bacteria | 1656 |
| 198 | Ga0265313_10041690 | 3300031595 | Bacteria | 2259 |
| 199 | Ga0265314_10151524 | 3300031711 | Bacteria | 1421 |
| 200 | Ga0265342_10081237 | 3300031712 | Bacteria | 1872 |
| 201 | Ga0307413_10119102 | 3300031824 | Bacteria | 1784 |
| 202 | Ga0307410_10002274 | 3300031852 | Bacteria | 9207 |
| 203 | Ga0307410_10057432 | 3300031852 | Bacteria | 2650 |
| 204 | Ga0307406_10034952 | 3300031901 | Bacteria | 3087 |
| 205 | Ga0307409_100057916 | 3300031995 | Bacteria | 3006 |
| 206 | Ga0307414_10131162 | 3300032004 | Bacteria | 1946 |
| 207 | Ga0307411_10284982 | 3300032005 | Bacteria | 1317 |
| 208 | Ga0307415_100574076 | 3300032126 | Bacteria | 999 |
| 209 | Ga0395898_0152880 | 3300037466 | Unclassified | 2208 |
| 210 | Ga0436365_0676328 | 3300039437 | Bacteria | 5837 |
| 211 | Ga0436365_1097751 | 3300039437 | Bacteria | 3593 |
| 212 | Ga0436363_0707383 | 3300039450 | Bacteria | 7601 |
| 213 | Ga0436363_0741830 | 3300039450 | Bacteria | 3053 |
| 214 | Ga0436362_0287470 | 3300039453 | Bacteria | 4133 |
| 215 | Ga0436362_0945821 | 3300039453 | Bacteria | 1484 |
| 216 | Ga0466963_0017273 | 3300044694 | Bacteria | 4496 |
| 217 | Ga0466963_0084309 | 3300044694 | Bacteria | 2156 |
| 218 | Ga0466963_0261266 | 3300044694 | Bacteria | 1216 |
| 219 | Ga0451576_0130285 | 3300045051 | Bacteria | 2622 |
| 220 | Ga0466967_0001038 | 3300045976 | Bacteria | 15242 |
| 221 | Ga0495580_0003297 | 3300046472 | Bacteria | 13795 |
| 222 | Ga0495580_0004476 | 3300046472 | Bacteria | 11738 |
| 223 | Ga0495580_0023514 | 3300046472 | Unclassified | 4524 |
| 224 | Ga0495582_0212950 | 3300046473 | Bacteria | 1105 |
| 225 | Ga0495594_0040150 | 3300046499 | Bacteria | 2560 |
| 226 | Ga0495628_0203777 | 3300046516 | Bacteria | 1490 |
| 227 | Ga0495625_0141923 | 3300046660 | Unclassified | 1620 |
| 228 | Ga0495669_0003332 | 3300046684 | Bacteria | 6612 |
| 229 | Ga0496100_0018545 | 3300048903 | Bacteria | 4130 |
| 230 | Ga0496101_0331935 | 3300048904 | Unclassified | 1194 |
| 231 | Ga0496102_0092459 | 3300048905 | Unclassified | 2801 |
| 232 | Ga0496102_0212791 | 3300048905 | Bacteria | 1822 |
| 233 | Ga0496103_0068177 | 3300048906 | Unclassified | 2223 |
| 234 | Ga0496104_0393652 | 3300048907 | Bacteria | 1298 |
| 235 | Ga0496104_0571052 | 3300048907 | Bacteria | 1041 |
| 236 | Ga0496108_0045441 | 3300048911 | Bacteria | 3668 |
| 237 | Ga0496109_0050037 | 3300048912 | Bacteria | 3806 |
| 238 | Ga0496110_0074527 | 3300048913 | Bacteria | 3014 |
| 239 | Ga0496111_0020199 | 3300048914 | Bacteria | 4635 |
| 240 | Ga0496112_0002774 | 3300048915 | Bacteria | 14209 |
| 241 | Ga0496112_0092911 | 3300048915 | Bacteria | 2987 |
| 242 | Ga0496112_0173057 | 3300048915 | Bacteria | 2124 |
| 243 | Ga0496112_0548464 | 3300048915 | Unclassified | 1090 |
| 244 | Ga0496113_0059240 | 3300048916 | Unclassified | 2884 |
| 245 | Ga0496115_0224243 | 3300048918 | Unclassified | 1551 |
| 246 | Ga0496126_0003974 | 3300048929 | Bacteria | 18064 |
| 247 | Ga0501299_028938 | 3300049522 | Unclassified | 1059 |
| 248 | Ga0501033_0163241 | 3300049570 | Bacteria | 1603 |
| 249 | Ga0501040_0323732 | 3300049576 | Unclassified | 1103 |
| 250 | Ga0501074_0224344 | 3300049590 | Unclassified | 1338 |
| 251 | Ga0501077_0247557 | 3300049593 | Unclassified | 1133 |
| 252 | nmdc:mga03n38_35455_c1 | 3300050490 | Bacteria | 2137 |
| 253 | nmdc:mga00v17_169804_c1 | 3300050491 | Bacteria | 1406 |
| 254 | nmdc:mga00v17_172139_c1 | 3300050491 | Bacteria | 1396 |
| 255 | nmdc:mga0yw44_65812_c1 | 3300050492 | Bacteria | 2235 |
| 256 | nmdc:mga06z11_13539_c1 | 3300050494 | Bacteria | 3585 |
| 257 | nmdc:mga05p37_2086_c1 | 3300050507 | Bacteria | 23329 |
| 258 | nmdc:mga09592_159619_c1 | 3300050508 | Bacteria | 1947 |
| 259 | nmdc:mga09592_7466_c1 | 3300050508 | Bacteria | 8885 |
| 260 | nmdc:mga06r32_94409_c1 | 3300050510 | Bacteria | 2927 |
| 261 | nmdc:mga08y16_272642_c1 | 3300050511 | Bacteria | 1746 |
| 262 | nmdc:mga08y16_8945_c1 | 3300050511 | Bacteria | 10517 |
| 263 | nmdc:mga0a205_31733_c1 | 3300050515 | Bacteria | 5063 |
| 264 | nmdc:mga0a205_32147_c1 | 3300050515 | Bacteria | 5031 |
| 265 | Ga0501084_0150534 | 3300054114 | Bacteria | 1961 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049590 | Ga0501074_0224344 | Ga0501074_0224344_492_1322 | 262 |
| 2 | 3300050515 | nmdc:mga0a205_32147_c1 | nmdc:mga0a205_32147_c1_3642_4466 | 268 |
| 3 | 3300031852 | Ga0307410_10002274 | Ga0307410_100022746 | 275 |
| 4 | 3300006178 | Ga0075367_10054484 | Ga0075367_100544842 | 276 |
| 5 | 3300044694 | Ga0466963_0084309 | Ga0466963_0084309_639_1508 | 276 |
| 6 | 3300050494 | nmdc:mga06z11_13539_c1 | nmdc:mga06z11_13539_c1_1082_1939 | 276 |
| 7 | 3300046499 | Ga0495594_0040150 | Ga0495594_0040150_671_1603 | 281 |
| 8 | 3300046684 | Ga0495669_0003332 | Ga0495669_0003332_2496_3416 | 282 |
| 9 | 3300049522 | Ga0501299_028938 | Ga0501299_028938_33_953 | 282 |
| 10 | 3300005339 | Ga0070660_100159586 | Ga0070660_1001595862 | 283 |
| 11 | 3300005436 | Ga0070713_100056414 | Ga0070713_1000564142 | 283 |
| 12 | 3300048915 | Ga0496112_0173057 | Ga0496112_0173057_70_948 | 283 |
| 13 | 3300006844 | Ga0075428_100039593 | Ga0075428_1000395933 | 286 |
| 14 | 3300006880 | Ga0075429_100003095 | Ga0075429_1000030955 | 286 |
| 15 | 3300009098 | Ga0105245_10020465 | Ga0105245_100204654 | 286 |
| 16 | 3300009147 | Ga0114129_10008591 | Ga0114129_100085919 | 286 |
| 17 | 3300050507 | nmdc:mga05p37_2086_c1 | nmdc:mga05p37_2086_c1_8635_9522 | 286 |
| 18 | 3300050508 | nmdc:mga09592_7466_c1 | nmdc:mga09592_7466_c1_527_1414 | 286 |
| 19 | 3300046472 | Ga0495580_0003297 | Ga0495580_0003297_4220_5179 | 288 |
| 20 | 3300046473 | Ga0495582_0212950 | Ga0495582_0212950_74_1033 | 288 |
| 21 | 3300049570 | Ga0501033_0163241 | Ga0501033_0163241_520_1461 | 288 |
| 22 | 3300049576 | Ga0501040_0323732 | Ga0501040_0323732_55_996 | 288 |
| 23 | 3300005563 | Ga0068855_100045068 | Ga0068855_1000450684 | 289 |
| 24 | 3300026078 | Ga0207702_10013286 | Ga0207702_100132864 | 289 |
| 25 | 3300037466 | Ga0395898_0152880 | Ga0395898_0152880_1003_1935 | 289 |
| 26 | 3300039437 | Ga0436365_1097751 | Ga0436365_1097751_2091_3041 | 289 |
| 27 | 3300039453 | Ga0436362_0287470 | Ga0436362_0287470_1132_2082 | 289 |
| 28 | 3300045976 | Ga0466967_0001038 | Ga0466967_0001038_4389_5315 | 289 |
| 29 | 3300045051 | Ga0451576_0130285 | Ga0451576_0130285_151_1038 | 290 |
| 30 | 3300046472 | Ga0495580_0004476 | Ga0495580_0004476_2354_3316 | 290 |
| 31 | 3300005468 | Ga0070707_100087974 | Ga0070707_1000879743 | 291 |
| 32 | 3300006051 | Ga0075364_10181663 | Ga0075364_101816632 | 291 |
| 33 | 3300025922 | Ga0207646_10127032 | Ga0207646_101270322 | 291 |
| 34 | 3300050491 | nmdc:mga00v17_172139_c1 | nmdc:mga00v17_172139_c1_119_1048 | 291 |
| 35 | 3300005437 | Ga0070710_10044023 | Ga0070710_100440232 | 293 |
| 36 | 3300025898 | Ga0207692_10018608 | Ga0207692_100186083 | 293 |
| 37 | 3300005353 | Ga0070669_100248773 | Ga0070669_1002487732 | 294 |
| 38 | 3300005471 | Ga0070698_100046230 | Ga0070698_1000462304 | 294 |
| 39 | 3300005719 | Ga0068861_100312423 | Ga0068861_1003124232 | 294 |
| 40 | 3300006844 | Ga0075428_100009581 | Ga0075428_10000958111 | 294 |
| 41 | 3300006844 | Ga0075428_100036314 | Ga0075428_1000363142 | 294 |
| 42 | 3300006844 | Ga0075428_100545471 | Ga0075428_1005454711 | 294 |
| 43 | 3300006847 | Ga0075431_100035712 | Ga0075431_1000357122 | 294 |
| 44 | 3300006852 | Ga0075433_10067791 | Ga0075433_100677912 | 294 |
| 45 | 3300009094 | Ga0111539_10006409 | Ga0111539_1000640914 | 294 |
| 46 | 3300009094 | Ga0111539_10115149 | Ga0111539_101151492 | 294 |
| 47 | 3300014745 | Ga0157377_10306156 | Ga0157377_103061562 | 294 |
| 48 | 3300025929 | Ga0207664_10043803 | Ga0207664_100438032 | 294 |
| 49 | 3300031824 | Ga0307413_10119102 | Ga0307413_101191022 | 294 |
| 50 | 3300031852 | Ga0307410_10057432 | Ga0307410_100574322 | 294 |
| 51 | 3300031901 | Ga0307406_10034952 | Ga0307406_100349522 | 294 |
| 52 | 3300031995 | Ga0307409_100057916 | Ga0307409_1000579162 | 294 |
| 53 | 3300032004 | Ga0307414_10131162 | Ga0307414_101311622 | 294 |
| 54 | 3300032005 | Ga0307411_10284982 | Ga0307411_102849822 | 294 |
| 55 | 3300032126 | Ga0307415_100574076 | Ga0307415_1005740761 | 294 |
| 56 | 3300050508 | nmdc:mga09592_159619_c1 | nmdc:mga09592_159619_c1_200_1120 | 294 |
| 57 | 3300050510 | nmdc:mga06r32_94409_c1 | nmdc:mga06r32_94409_c1_1911_2831 | 294 |
| 58 | 3300050511 | nmdc:mga08y16_272642_c1 | nmdc:mga08y16_272642_c1_393_1313 | 294 |
| 59 | 3300050511 | nmdc:mga08y16_8945_c1 | nmdc:mga08y16_8945_c1_8189_9109 | 294 |
| 60 | 3300005445 | Ga0070708_100006061 | Ga0070708_1000060612 | 296 |
| 61 | 3300005467 | Ga0070706_100013738 | Ga0070706_1000137382 | 296 |
| 62 | 3300005468 | Ga0070707_100003256 | Ga0070707_1000032569 | 296 |
| 63 | 3300005536 | Ga0070697_100040580 | Ga0070697_1000405803 | 296 |
| 64 | 3300025910 | Ga0207684_10068018 | Ga0207684_100680182 | 296 |
| 65 | 3300025922 | Ga0207646_10006871 | Ga0207646_100068718 | 296 |
| 66 | 3300028558 | Ga0265326_10004077 | Ga0265326_100040772 | 296 |
| 67 | 3300028800 | Ga0265338_10000009 | Ga0265338_10000009131 | 296 |
| 68 | 3300028800 | Ga0265338_10000240 | Ga0265338_1000024077 | 296 |
| 69 | 3300028800 | Ga0265338_10117942 | Ga0265338_101179422 | 296 |
| 70 | 3300029957 | Ga0265324_10000693 | Ga0265324_100006939 | 296 |
| 71 | 3300029957 | Ga0265324_10024058 | Ga0265324_100240582 | 296 |
| 72 | 3300031711 | Ga0265314_10151524 | Ga0265314_101515242 | 296 |
| 73 | 3300005329 | Ga0070683_100081646 | Ga0070683_1000816462 | 297 |
| 74 | 3300005329 | Ga0070683_100253935 | Ga0070683_1002539352 | 297 |
| 75 | 3300005331 | Ga0070670_100021939 | Ga0070670_1000219392 | 297 |
| 76 | 3300005336 | Ga0070680_100082456 | Ga0070680_1000824561 | 297 |
| 77 | 3300005338 | Ga0068868_100000948 | Ga0068868_1000009488 | 297 |
| 78 | 3300005338 | Ga0068868_100017827 | Ga0068868_1000178272 | 297 |
| 79 | 3300005339 | Ga0070660_100183992 | Ga0070660_1001839922 | 297 |
| 80 | 3300005340 | Ga0070689_100096012 | Ga0070689_1000960122 | 297 |
| 81 | 3300005344 | Ga0070661_100004819 | Ga0070661_1000048194 | 297 |
| 82 | 3300005344 | Ga0070661_100246218 | Ga0070661_1002462182 | 297 |
| 83 | 3300005435 | Ga0070714_100001244 | Ga0070714_1000012449 | 297 |
| 84 | 3300005436 | Ga0070713_100005742 | Ga0070713_1000057424 | 297 |
| 85 | 3300005458 | Ga0070681_10000201 | Ga0070681_1000020136 | 297 |
| 86 | 3300005458 | Ga0070681_10011383 | Ga0070681_100113835 | 297 |
| 87 | 3300005459 | Ga0068867_100028194 | Ga0068867_1000281944 | 297 |
| 88 | 3300005539 | Ga0068853_100013973 | Ga0068853_1000139734 | 297 |
| 89 | 3300005547 | Ga0070693_100008422 | Ga0070693_1000084223 | 297 |
| 90 | 3300005563 | Ga0068855_100000282 | Ga0068855_10000028216 | 297 |
| 91 | 3300005563 | Ga0068855_100006263 | Ga0068855_1000062639 | 297 |
| 92 | 3300005563 | Ga0068855_100008514 | Ga0068855_1000085146 | 297 |
| 93 | 3300005564 | Ga0070664_100000302 | Ga0070664_10000030215 | 297 |
| 94 | 3300005577 | Ga0068857_100036870 | Ga0068857_1000368704 | 297 |
| 95 | 3300005577 | Ga0068857_100050459 | Ga0068857_1000504592 | 297 |
| 96 | 3300005578 | Ga0068854_100018072 | Ga0068854_1000180724 | 297 |
| 97 | 3300005614 | Ga0068856_100000026 | Ga0068856_10000002625 | 297 |
| 98 | 3300005614 | Ga0068856_100000506 | Ga0068856_10000050633 | 297 |
| 99 | 3300005614 | Ga0068856_100001494 | Ga0068856_10000149418 | 297 |
| 100 | 3300005614 | Ga0068856_100032885 | Ga0068856_1000328853 | 297 |
| 101 | 3300005616 | Ga0068852_100074860 | Ga0068852_1000748602 | 297 |
| 102 | 3300005617 | Ga0068859_100000193 | Ga0068859_10000019338 | 297 |
| 103 | 3300005618 | Ga0068864_100000449 | Ga0068864_10000044921 | 297 |
| 104 | 3300005618 | Ga0068864_100033853 | Ga0068864_1000338532 | 297 |
| 105 | 3300005718 | Ga0068866_10002811 | Ga0068866_100028112 | 297 |
| 106 | 3300005834 | Ga0068851_10111289 | Ga0068851_101112892 | 297 |
| 107 | 3300005841 | Ga0068863_100122728 | Ga0068863_1001227283 | 297 |
| 108 | 3300005842 | Ga0068858_100006271 | Ga0068858_1000062715 | 297 |
| 109 | 3300005842 | Ga0068858_100007985 | Ga0068858_1000079855 | 297 |
| 110 | 3300005843 | Ga0068860_100026246 | Ga0068860_1000262463 | 297 |
| 111 | 3300006028 | Ga0070717_10026351 | Ga0070717_100263513 | 297 |
| 112 | 3300006237 | Ga0097621_100000520 | Ga0097621_10000052014 | 297 |
| 113 | 3300006237 | Ga0097621_100002293 | Ga0097621_1000022938 | 297 |
| 114 | 3300006237 | Ga0097621_100007442 | Ga0097621_1000074423 | 297 |
| 115 | 3300006358 | Ga0068871_100000211 | Ga0068871_10000021122 | 297 |
| 116 | 3300006358 | Ga0068871_100002566 | Ga0068871_1000025667 | 297 |
| 117 | 3300006358 | Ga0068871_100143983 | Ga0068871_1001439831 | 297 |
| 118 | 3300006931 | Ga0097620_100000193 | Ga0097620_10000019338 | 297 |
| 119 | 3300009093 | Ga0105240_10080816 | Ga0105240_100808164 | 297 |
| 120 | 3300009148 | Ga0105243_10164484 | Ga0105243_101644841 | 297 |
| 121 | 3300009177 | Ga0105248_10003075 | Ga0105248_100030751 | 297 |
| 122 | 3300009545 | Ga0105237_10054798 | Ga0105237_100547983 | 297 |
| 123 | 3300009545 | Ga0105237_10255381 | Ga0105237_102553812 | 297 |
| 124 | 3300009551 | Ga0105238_10005366 | Ga0105238_1000536611 | 297 |
| 125 | 3300010375 | Ga0105239_10024447 | Ga0105239_100244473 | 297 |
| 126 | 3300010375 | Ga0105239_10035721 | Ga0105239_100357215 | 297 |
| 127 | 3300011119 | Ga0105246_10066700 | Ga0105246_100667002 | 297 |
| 128 | 3300013102 | Ga0157371_10023735 | Ga0157371_100237354 | 297 |
| 129 | 3300013102 | Ga0157371_10038585 | Ga0157371_100385852 | 297 |
| 130 | 3300013105 | Ga0157369_10000229 | Ga0157369_1000022936 | 297 |
| 131 | 3300013105 | Ga0157369_10103665 | Ga0157369_101036653 | 297 |
| 132 | 3300013296 | Ga0157374_10000090 | Ga0157374_1000009080 | 297 |
| 133 | 3300013296 | Ga0157374_10000750 | Ga0157374_100007507 | 297 |
| 134 | 3300013296 | Ga0157374_10001253 | Ga0157374_100012537 | 297 |
| 135 | 3300013297 | Ga0157378_10000070 | Ga0157378_1000007028 | 297 |
| 136 | 3300013297 | Ga0157378_10000596 | Ga0157378_1000059610 | 297 |
| 137 | 3300013297 | Ga0157378_10001219 | Ga0157378_1000121910 | 297 |
| 138 | 3300013307 | Ga0157372_10000100 | Ga0157372_1000010036 | 297 |
| 139 | 3300013307 | Ga0157372_10000211 | Ga0157372_100002113 | 297 |
| 140 | 3300013307 | Ga0157372_10000948 | Ga0157372_100009484 | 297 |
| 141 | 3300013307 | Ga0157372_10067231 | Ga0157372_100672312 | 297 |
| 142 | 3300014969 | Ga0157376_10005194 | Ga0157376_100051947 | 297 |
| 143 | 3300025899 | Ga0207642_10012143 | Ga0207642_100121433 | 297 |
| 144 | 3300025912 | Ga0207707_10003069 | Ga0207707_1000306912 | 297 |
| 145 | 3300025912 | Ga0207707_10008706 | Ga0207707_100087064 | 297 |
| 146 | 3300025920 | Ga0207649_10005549 | Ga0207649_100055494 | 297 |
| 147 | 3300025921 | Ga0207652_10130999 | Ga0207652_101309992 | 297 |
| 148 | 3300025924 | Ga0207694_10018480 | Ga0207694_100184804 | 297 |
| 149 | 3300025925 | Ga0207650_10009446 | Ga0207650_100094466 | 297 |
| 150 | 3300025928 | Ga0207700_10051950 | Ga0207700_100519502 | 297 |
| 151 | 3300025936 | Ga0207670_10078512 | Ga0207670_100785122 | 297 |
| 152 | 3300025938 | Ga0207704_10058895 | Ga0207704_100588952 | 297 |
| 153 | 3300025944 | Ga0207661_10075924 | Ga0207661_100759242 | 297 |
| 154 | 3300025944 | Ga0207661_10090860 | Ga0207661_100908602 | 297 |
| 155 | 3300025945 | Ga0207679_10004874 | Ga0207679_100048743 | 297 |
| 156 | 3300025945 | Ga0207679_10092199 | Ga0207679_100921992 | 297 |
| 157 | 3300025949 | Ga0207667_10000170 | Ga0207667_1000017052 | 297 |
| 158 | 3300025949 | Ga0207667_10008764 | Ga0207667_100087648 | 297 |
| 159 | 3300025949 | Ga0207667_10012711 | Ga0207667_100127119 | 297 |
| 160 | 3300025981 | Ga0207640_10009055 | Ga0207640_100090553 | 297 |
| 161 | 3300026023 | Ga0207677_10001452 | Ga0207677_100014528 | 297 |
| 162 | 3300026023 | Ga0207677_10021372 | Ga0207677_100213724 | 297 |
| 163 | 3300026078 | Ga0207702_10000131 | Ga0207702_1000013128 | 297 |
| 164 | 3300026078 | Ga0207702_10001252 | Ga0207702_1000125211 | 297 |
| 165 | 3300026078 | Ga0207702_10008063 | Ga0207702_100080637 | 297 |
| 166 | 3300026088 | Ga0207641_10056892 | Ga0207641_100568924 | 297 |
| 167 | 3300026089 | Ga0207648_10010603 | Ga0207648_100106033 | 297 |
| 168 | 3300026095 | Ga0207676_10001648 | Ga0207676_1000164810 | 297 |
| 169 | 3300026095 | Ga0207676_10011169 | Ga0207676_100111695 | 297 |
| 170 | 3300026116 | Ga0207674_10001066 | Ga0207674_1000106629 | 297 |
| 171 | 3300026116 | Ga0207674_10024079 | Ga0207674_100240793 | 297 |
| 172 | 3300026142 | Ga0207698_10042956 | Ga0207698_100429562 | 297 |
| 173 | 3300031249 | Ga0265339_10085893 | Ga0265339_100858932 | 297 |
| 174 | 3300039453 | Ga0436362_0945821 | Ga0436362_0945821_376_1314 | 297 |
| 175 | 3300044694 | Ga0466963_0017273 | Ga0466963_0017273_72_1022 | 297 |
| 176 | 3300048904 | Ga0496101_0331935 | Ga0496101_0331935_25_975 | 297 |
| 177 | 3300048905 | Ga0496102_0092459 | Ga0496102_0092459_1653_2603 | 297 |
| 178 | 3300048915 | Ga0496112_0002774 | Ga0496112_0002774_7266_8216 | 297 |
| 179 | 3300048915 | Ga0496112_0092911 | Ga0496112_0092911_144_1157 | 297 |
| 180 | 3300048918 | Ga0496115_0224243 | Ga0496115_0224243_325_1275 | 297 |
| 181 | 3300005436 | Ga0070713_100242135 | Ga0070713_1002421351 | 298 |
| 182 | 3300005545 | Ga0070695_100325171 | Ga0070695_1003251712 | 298 |
| 183 | 3300025939 | Ga0207665_10220045 | Ga0207665_102200452 | 298 |
| 184 | 3300048929 | Ga0496126_0003974 | Ga0496126_0003974_13022_13918 | 298 |
| 185 | 3300005439 | Ga0070711_100001945 | Ga0070711_1000019457 | 299 |
| 186 | 3300005445 | Ga0070708_100001670 | Ga0070708_1000016707 | 299 |
| 187 | 3300005467 | Ga0070706_100008356 | Ga0070706_1000083564 | 299 |
| 188 | 3300005468 | Ga0070707_100008252 | Ga0070707_1000082524 | 299 |
| 189 | 3300005471 | Ga0070698_100007842 | Ga0070698_1000078426 | 299 |
| 190 | 3300005518 | Ga0070699_100000976 | Ga0070699_10000097617 | 299 |
| 191 | 3300005536 | Ga0070697_100000337 | Ga0070697_10000033716 | 299 |
| 192 | 3300006038 | Ga0075365_10078244 | Ga0075365_100782442 | 299 |
| 193 | 3300006048 | Ga0075363_100019951 | Ga0075363_1000199515 | 299 |
| 194 | 3300006051 | Ga0075364_10150212 | Ga0075364_101502122 | 299 |
| 195 | 3300006852 | Ga0075433_10046434 | Ga0075433_100464342 | 299 |
| 196 | 3300006871 | Ga0075434_100043323 | Ga0075434_1000433234 | 299 |
| 197 | 3300009147 | Ga0114129_10007504 | Ga0114129_100075044 | 299 |
| 198 | 3300025910 | Ga0207684_10001148 | Ga0207684_100011488 | 299 |
| 199 | 3300025922 | Ga0207646_10000855 | Ga0207646_1000085516 | 299 |
| 200 | 3300028800 | Ga0265338_10028135 | Ga0265338_100281354 | 299 |
| 201 | 3300031241 | Ga0265325_10012794 | Ga0265325_100127942 | 299 |
| 202 | 3300031247 | Ga0265340_10007519 | Ga0265340_100075194 | 299 |
| 203 | 3300039437 | Ga0436365_0676328 | Ga0436365_0676328_1686_2645 | 299 |
| 204 | 3300039450 | Ga0436363_0741830 | Ga0436363_0741830_1152_2111 | 299 |
| 205 | 3300046472 | Ga0495580_0023514 | Ga0495580_0023514_3089_4021 | 299 |
| 206 | 3300048915 | Ga0496112_0548464 | Ga0496112_0548464_19_981 | 299 |
| 207 | 3300049593 | Ga0501077_0247557 | Ga0501077_0247557_22_951 | 299 |
| 208 | 3300050490 | nmdc:mga03n38_35455_c1 | nmdc:mga03n38_35455_c1_450_1442 | 299 |
| 209 | 3300050491 | nmdc:mga00v17_169804_c1 | nmdc:mga00v17_169804_c1_391_1383 | 299 |
| 210 | 3300050492 | nmdc:mga0yw44_65812_c1 | nmdc:mga0yw44_65812_c1_598_1590 | 299 |
| 211 | 3300050515 | nmdc:mga0a205_31733_c1 | nmdc:mga0a205_31733_c1_731_1666 | 299 |
| 212 | 3300044694 | Ga0466963_0261266 | Ga0466963_0261266_279_1187 | 300 |
| 213 | 3300013105 | Ga0157369_10000442 | Ga0157369_1000044228 | 301 |
| 214 | 3300005329 | Ga0070683_100297784 | Ga0070683_1002977842 | 302 |
| 215 | 3300005344 | Ga0070661_100048894 | Ga0070661_1000488943 | 302 |
| 216 | 3300005458 | Ga0070681_10074104 | Ga0070681_100741043 | 302 |
| 217 | 3300005458 | Ga0070681_10094704 | Ga0070681_100947044 | 302 |
| 218 | 3300005530 | Ga0070679_100130387 | Ga0070679_1001303872 | 302 |
| 219 | 3300005530 | Ga0070679_100203311 | Ga0070679_1002033112 | 302 |
| 220 | 3300005539 | Ga0068853_100158019 | Ga0068853_1001580192 | 302 |
| 221 | 3300005577 | Ga0068857_100036989 | Ga0068857_1000369894 | 302 |
| 222 | 3300005577 | Ga0068857_100195500 | Ga0068857_1001955002 | 302 |
| 223 | 3300005614 | Ga0068856_100303225 | Ga0068856_1003032251 | 302 |
| 224 | 3300005834 | Ga0068851_10064294 | Ga0068851_100642942 | 302 |
| 225 | 3300009545 | Ga0105237_10483969 | Ga0105237_104839692 | 302 |
| 226 | 3300009551 | Ga0105238_10142629 | Ga0105238_101426292 | 302 |
| 227 | 3300010375 | Ga0105239_10131125 | Ga0105239_101311253 | 302 |
| 228 | 3300013102 | Ga0157371_10081876 | Ga0157371_100818762 | 302 |
| 229 | 3300013105 | Ga0157369_10058587 | Ga0157369_100585874 | 302 |
| 230 | 3300013297 | Ga0157378_10382082 | Ga0157378_103820821 | 302 |
| 231 | 3300013307 | Ga0157372_10015753 | Ga0157372_100157535 | 302 |
| 232 | 3300014497 | Ga0182008_10007422 | Ga0182008_100074226 | 302 |
| 233 | 3300015262 | Ga0182007_10006898 | Ga0182007_100068984 | 302 |
| 234 | 3300025911 | Ga0207654_10220465 | Ga0207654_102204652 | 302 |
| 235 | 3300025917 | Ga0207660_10207033 | Ga0207660_102070332 | 302 |
| 236 | 3300025919 | Ga0207657_10003001 | Ga0207657_100030019 | 302 |
| 237 | 3300025920 | Ga0207649_10073528 | Ga0207649_100735282 | 302 |
| 238 | 3300025921 | Ga0207652_10136066 | Ga0207652_101360663 | 302 |
| 239 | 3300026041 | Ga0207639_10150597 | Ga0207639_101505972 | 302 |
| 240 | 3300026116 | Ga0207674_10056443 | Ga0207674_100564434 | 302 |
| 241 | 3300039450 | Ga0436363_0707383 | Ga0436363_0707383_1668_2654 | 302 |
| 242 | 3300048903 | Ga0496100_0018545 | Ga0496100_0018545_72_1100 | 302 |
| 243 | 3300048905 | Ga0496102_0212791 | Ga0496102_0212791_41_1069 | 302 |
| 244 | 3300048906 | Ga0496103_0068177 | Ga0496103_0068177_833_1822 | 302 |
| 245 | 3300048907 | Ga0496104_0393652 | Ga0496104_0393652_270_1256 | 302 |
| 246 | 3300048907 | Ga0496104_0571052 | Ga0496104_0571052_39_1016 | 302 |
| 247 | 3300048911 | Ga0496108_0045441 | Ga0496108_0045441_2300_3328 | 302 |
| 248 | 3300048912 | Ga0496109_0050037 | Ga0496109_0050037_497_1525 | 302 |
| 249 | 3300048913 | Ga0496110_0074527 | Ga0496110_0074527_915_1943 | 302 |
| 250 | 3300048914 | Ga0496111_0020199 | Ga0496111_0020199_3061_4050 | 302 |
| 251 | 3300048916 | Ga0496113_0059240 | Ga0496113_0059240_1623_2651 | 302 |
| 252 | 3300005434 | Ga0070709_10016024 | Ga0070709_100160242 | 303 |
| 253 | 3300005435 | Ga0070714_100646991 | Ga0070714_1006469911 | 303 |
| 254 | 3300006914 | Ga0075436_100028834 | Ga0075436_1000288343 | 303 |
| 255 | 3300025906 | Ga0207699_10015466 | Ga0207699_100154662 | 303 |
| 256 | 3300025929 | Ga0207664_10031102 | Ga0207664_100311023 | 303 |
| 257 | 3300031090 | Ga0265760_10001034 | Ga0265760_100010345 | 303 |
| 258 | 3300046660 | Ga0495625_0141923 | Ga0495625_0141923_57_971 | 304 |
| 259 | 3300054114 | Ga0501084_0150534 | Ga0501084_0150534_611_1603 | 305 |
| 260 | 3300000546 | LJNas_1000684 | LJNas_10006845 | 306 |
| 261 | 3300005327 | Ga0070658_10358896 | Ga0070658_103588961 | 306 |
| 262 | 3300005436 | Ga0070713_100266509 | Ga0070713_1002665092 | 306 |
| 263 | 3300031595 | Ga0265313_10041690 | Ga0265313_100416902 | 306 |
| 264 | 3300031712 | Ga0265342_10081237 | Ga0265342_100812372 | 306 |
| 265 | 3300046516 | Ga0495628_0203777 | Ga0495628_0203777_522_1445 | 306 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5usd-assembly2.cif.gz_C | crystal structure of mccf-like protein (ba_5613) in the complex with aspartyl sulfamoyl adenylate | 0.9046 | 1 | 298 |
| 6uuk-assembly1.cif.gz_A | crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes | 0.9036 | 8 | 299 |
| 4h1h-assembly1.cif.gz_A | crystal structure of mccf homolog from listeria monocytogenes egd-e | 0.9022 | 1 | 298 |
| 6uuk-assembly1.cif.gz_B | crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes | 0.901 | 6 | 296 |
| 6uuk-assembly1.cif.gz_A | crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes | 0.8976 | 8 | 299 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4mjxB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain | 0.9396 | 1 | 133 | 3.40.50.10740 |
| 1zrsA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain | 0.916 | 1 | 132 | 3.40.50.10740 |
| af_P76008_4_153_3.40.50.10740 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain | 0.9082 | 8 | 135 | 3.40.50.10740 |
| 4h1hB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain | 0.9077 | 1 | 134 | 3.40.50.10740 |
| 3sr3B02 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like | 0.8712 | 159 | 301 | 3.50.30.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1D2UFI3-F1-model_v4 | LD-carboxypeptidase | 0.9742 | 4 | 297 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A7G8BCY5-F1-model_v4 | LD-carboxypeptidase | 0.9732 | 1 | 295 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A321LRL8-F1-model_v4 | LD-carboxypeptidase | 0.9676 | 4 | 297 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A2V9NZ59-F1-model_v4 | LD-carboxypeptidase | 0.9635 | 4 | 263 |
GO:0004180
GO:0006508 GO:0008236 |
| AF-A0A7V9TH61-F1-model_v4 | LD-carboxypeptidase | 0.9608 | 4 | 128 |
GO:0004180
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar