F373342

General Info

Members Datasets Scaffolds Average Seq Length
265 181 530 182

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10006502|Ga0213872_100065025
Length 209
Sequence MIAMQYSFTLPADYDMDIIRRRIAERGHFTDDFPLLGFKAYVYAESAQGRSRDNLYAPFYLWEDNEGMNAFLGGPGFAALVASFGRPAISVWSVWHAQRPNDAGAARYATREIVAIPPEASLEAWREAETVWLKQDIAMRDAVGGVVAFEPSTWTLVSFRLWAHQPRTLDTERAQCYAVGHVSVPTNGRDARDTVLTRSASADHVTASV

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
60 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
61 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
156 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
157 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
160 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
161 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
162 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
163 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
164 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
165 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
166 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
167 2739367700 Dyella sp. YR388 Isolate Unclassified
168 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
169 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
170 2811994870 Bacillus sp. JB4 Isolate Unclassified
171 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
172 2884411467 Dyella sp. AD56 Isolate Rhizosphere
173 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
174 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
175 2919150387 Rahnella aceris 1817 Isolate Unclassified
176 2927143783 Rahnella sp. 2050 Isolate Unclassified
177 2928963466 Dyella japonica 1073 Isolate Unclassified
178 2937967321 Serratia sp. YC16 Isolate Unclassified
179 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
180 640753048 Serratia proteamaculans 568 Isolate Endosphere
181 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.94
Metatranscriptomes 0.38
Isolates 8.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.7
Nodule 0.75
Rhizoplane 3.4
Rhizosphere 44.53
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10006502 3300021361 Bacteria 5853
2 JGI24735J21928_10000803 3300002067 Bacteria 11182
3 JGI25162J39368_1000521 3300002737 Bacteria 28709
4 JGI25162J39368_1003364 3300002737 Bacteria 4740
5 JGI25158J39367_1000180 3300002739 Bacteria 14916
6 JGI25157J39369_1000434 3300002741 Bacteria 27188
7 JGI25163J39215_1000064 3300002771 Bacteria 47794
8 JGI25163J39215_1001632 3300002771 Bacteria 3338
9 JGI25164J39214_1000006 3300002772 Bacteria 342675
10 JGI25164J39214_1000288 3300002772 Bacteria 35469
11 JGI25152J39213_1001981 3300002773 Bacteria 8104
12 JGI25152J39213_1014175 3300002773 Bacteria 1627
13 JGI25159J45721_1001406 3300002987 Bacteria 9996
14 JGI25151J46595_10016424 3300003187 Bacteria 3237
15 JGI25165J46597_1000532 3300003214 Bacteria 35455
16 JGI25153J46596_10003024 3300003215 Bacteria 9511
17 JGI25153J46596_10035163 3300003215 Bacteria 1627
18 JGI25153J46596_10036896 3300003215 Bacteria 1560
19 rootH2_10044954 3300003320 Bacteria 11828
20 rootH2_10102738 3300003320 Bacteria 1830
21 rootH2_10159621 3300003320 Bacteria 1096
22 rootL2_10008532 3300003322 Bacteria 2497
23 rootH1_10078253 3300003323 Bacteria 2975
24 JGI25160J50197_1038817 3300003354 Bacteria 1122
25 JGI25161J50226_1000114 3300003374 Bacteria 62957
26 Ga0006562J51391_1001226 3300003578 Bacteria 12640
27 Ga0055538_1000003 3300003751 Bacteria 663004
28 Ga0055538_1001162 3300003751 Bacteria 5585
29 Ga0055539_1000003 3300003752 Bacteria 663004
30 Ga0055533_1000005 3300003756 Bacteria 663004
31 Ga0055533_1000410 3300003756 Bacteria 16685
32 Ga0055525_1000005 3300003759 Bacteria 663004
33 Ga0055535_1000429 3300003761 Bacteria 39272
34 Ga0055535_1007899 3300003761 Bacteria 1974
35 Ga0055542_1000292 3300003762 Bacteria 56160
36 Ga0055542_1000648 3300003762 Bacteria 28709
37 Ga0055529_1000467 3300003763 Bacteria 39162
38 Ga0055526_1002600 3300003771 Bacteria 12067
39 Ga0055524_1014713 3300003775 Bacteria 2885
40 Ga0055528_1019582 3300003790 Bacteria 2235
41 Ga0055540_1001218 3300003792 Bacteria 15814
42 Ga0055541_1000003 3300003841 Bacteria 663004
43 Ga0055543_1000077 3300004625 Bacteria 86457
44 Ga0065165_1020441 3300005262 Bacteria 2329
45 Ga0065703_1020905 3300005272 Bacteria 1490
46 Ga0065704_10000011 3300005289 Bacteria 56608
47 Ga0070682_100245349 3300005337 Bacteria 1288
48 Ga0070668_100360476 3300005347 Bacteria 1232
49 Ga0070688_100331253 3300005365 Bacteria 1109
50 Ga0070710_10931639 3300005437 Bacteria 629
51 Ga0070663_100187018 3300005455 Bacteria 1610
52 Ga0070685_10010846 3300005466 Bacteria 4749
53 Ga0070665_100056753 3300005548 Bacteria 3926
54 Ga0070665_100164099 3300005548 Bacteria 2224
55 Ga0070665_100347106 3300005548 Bacteria 1489
56 Ga0068860_100232443 3300005843 Bacteria 1792
57 Ga0081455_10028180 3300005937 Bacteria 5134
58 Ga0079104_1006595 3300006946 Bacteria 4356
59 Ga0079104_1043406 3300006946 Bacteria 1036
60 Ga0105251_10015616 3300009011 Bacteria 4141
61 Ga0105251_10152530 3300009011 Bacteria 1043
62 Ga0105244_10000276 3300009036 Bacteria 51408
63 Ga0105244_10001366 3300009036 Bacteria 19816
64 Ga0105244_10350280 3300009036 Unclassified 681
65 Ga0105250_10000141 3300009092 Bacteria 62782
66 Ga0105240_10027351 3300009093 Bacteria 7467
67 Ga0105240_10059422 3300009093 Bacteria 4771
68 Ga0105240_10347369 3300009093 Bacteria 1684
69 Ga0105237_10762044 3300009545 Bacteria 974
70 Ga0105238_10231768 3300009551 Bacteria 1823
71 Ga0105238_10633277 3300009551 Bacteria 1079
72 Ga0105249_10552507 3300009553 Bacteria 1202
73 Ga0157371_10000134 3300013102 Bacteria 108562
74 Ga0157369_10334811 3300013105 Bacteria 1572
75 Ga0157369_10990739 3300013105 Bacteria 861
76 Ga0163162_10028268 3300013306 Bacteria 5547
77 Ga0163163_10585375 3300014325 Bacteria 1179
78 Ga0182008_10136890 3300014497 Bacteria 1223
79 Ga0182008_10534885 3300014497 Bacteria 649
80 Ga0157379_10052887 3300014968 Bacteria 3628
81 Ga0182007_10005061 3300015262 Bacteria 5854
82 Ga0183368_1002 3300015687 Bacteria 1865598
83 Ga0213872_10001721 3300021361 Bacteria 13758
84 Ga0209435_102371 3300025206 Bacteria 2215
85 Ga0209760_100062 3300025207 Bacteria 92359
86 Ga0209436_100050 3300025208 Bacteria 65942
87 Ga0209784_100001 3300025224 Bacteria 3600592
88 Ga0209784_100216 3300025224 Bacteria 39416
89 Ga0209566_100001 3300025225 Bacteria 3600765
90 Ga0209566_102232 3300025225 Bacteria 3811
91 Ga0209674_100002 3300025226 Bacteria 3600592
92 Ga0209674_100014 3300025226 Bacteria 704989
93 Ga0209672_100994 3300025228 Bacteria 12455
94 Ga0209672_107210 3300025228 Bacteria 1731
95 Ga0209563_100002 3300025230 Bacteria 2045675
96 Ga0207427_100009 3300025231 Bacteria 663036
97 Ga0207427_100267 3300025231 Bacteria 39803
98 Ga0209437_100001 3300025233 Bacteria 2045675
99 Ga0209437_100037 3300025233 Bacteria 459730
100 Ga0209437_100138 3300025233 Bacteria 172839
101 Ga0209258_100034 3300025242 Bacteria 437372
102 Ga0209258_100620 3300025242 Bacteria 28259
103 Ga0209258_102433 3300025242 Bacteria 4813
104 Ga0207425_1002635 3300025245 Bacteria 6193
105 Ga0207425_1009621 3300025245 Bacteria 2394
106 Ga0207425_1019085 3300025245 Bacteria 1481
107 Ga0209646_1000436 3300025246 Bacteria 22879
108 Ga0209026_1000255 3300025250 Bacteria 66879
109 Ga0209026_1001319 3300025250 Bacteria 11179
110 Ga0209677_100002 3300025253 Bacteria 2045675
111 Ga0209148_1000001 3300025254 Bacteria 2545271
112 Ga0209148_1000002 3300025254 Bacteria 2399500
113 Ga0209759_1000678 3300025256 Bacteria 31063
114 Ga0209759_1005908 3300025256 Bacteria 4188
115 Ga0209129_1001687 3300025258 Bacteria 11953
116 Ga0209129_1002355 3300025258 Bacteria 9336
117 Ga0209129_1003334 3300025258 Bacteria 7075
118 Ga0209233_1000002 3300025261 Bacteria 2501366
119 Ga0209233_1005855 3300025261 Bacteria 4035
120 Ga0209455_1000054 3300025272 Bacteria 358936
121 Ga0209455_1002220 3300025272 Bacteria 7665
122 Ga0209673_1003647 3300025273 Bacteria 8902
123 Ga0209130_1000030 3300025284 Bacteria 323323
124 Ga0209025_1019307 3300025294 Bacteria 3795
125 Ga0209564_1000364 3300025295 Bacteria 84138
126 Ga0209758_1000357 3300025297 Bacteria 82792
127 Ga0209758_1001342 3300025297 Bacteria 29705
128 Ga0209758_1001459 3300025297 Bacteria 27768
129 Ga0209256_1002320 3300025299 Bacteria 15934
130 Ga0207426_1000047 3300025302 Bacteria 417011
131 Ga0209051_1001764 3300025303 Bacteria 17175
132 Ga0209257_1016732 3300025304 Bacteria 2944
133 Ga0207696_1000258 3300025711 Bacteria 68746
134 Ga0207655_1000011 3300025728 Bacteria 643321
135 Ga0207655_1000349 3300025728 Bacteria 66933
136 Ga0207713_1002024 3300025735 Bacteria 15188
137 Ga0207713_1152821 3300025735 Bacteria 743
138 Ga0207647_10105232 3300025904 Bacteria 1672
139 Ga0207647_10222766 3300025904 Bacteria 1087
140 Ga0207645_10267676 3300025907 Unclassified 1133
141 Ga0207695_10230850 3300025913 Bacteria 1755
142 Ga0207695_10472573 3300025913 Bacteria 1136
143 Ga0207671_10546234 3300025914 Bacteria 924
144 Ga0207664_11474847 3300025929 Bacteria 602
145 Ga0207668_10275284 3300025972 Bacteria 1378
146 Ga0207678_10079153 3300026067 Bacteria 2815
147 Ga0268266_10000234 3300028379 Bacteria 94817
148 Ga0268266_10122780 3300028379 Bacteria 2313
149 Ga0268264_10168760 3300028381 Bacteria 1977
150 Ga0265330_10047385 3300031235 Bacteria 1892
151 Ga0265330_10054526 3300031235 Bacteria 1747
152 Ga0265328_10020319 3300031239 Bacteria 2543
153 Ga0265325_10031541 3300031241 Bacteria 2835
154 Ga0265325_10231792 3300031241 Bacteria 841
155 Ga0265340_10216815 3300031247 Bacteria 858
156 Ga0265339_10009553 3300031249 Bacteria 6082
157 Ga0265339_10048976 3300031249 Bacteria 2315
158 Ga0265316_10213031 3300031344 Bacteria 1428
159 Ga0265316_10536957 3300031344 Bacteria 833
160 Ga0265314_10058763 3300031711 Bacteria 2634
161 Ga0265342_10141173 3300031712 Bacteria 1344
162 Ga0316576_10209157 3300031727 Bacteria 1469
163 Ga0316578_10052050 3300031728 Bacteria 2399
164 Ga0316583_10038843 3300032133 Unclassified 1686
165 Ga0316583_10071905 3300032133 Bacteria 1210
166 Ga0316574_0024092 3300035398 Bacteria 3639
167 Ga0316584_0023303 3300036712 Bacteria 4523
168 Ga0436361_0001950 3300039447 Bacteria 15059
169 Ga0436361_0053779 3300039447 Bacteria 8562
170 Ga0436361_0471854 3300039447 Bacteria 1568
171 Ga0436361_0858438 3300039447 Bacteria 992
172 Ga0439465_0007535 3300041413 Bacteria 3457
173 Ga0439465_0065673 3300041413 Bacteria 1208
174 Ga0466961_0257796 3300044693 Bacteria 1070
175 Ga0466959_0065897 3300045049 Bacteria 2628
176 Ga0495590_0026811 3300046457 Bacteria 2022
177 Ga0495638_0000116 3300046460 Bacteria 128087
178 Ga0495650_0000064 3300046471 Bacteria 275412
179 Ga0495650_0000404 3300046471 Bacteria 71360
180 Ga0495583_0065248 3300046506 Bacteria 1613
181 Ga0495606_0005316 3300046507 Bacteria 12390
182 Ga0495610_0019884 3300046512 Bacteria 3743
183 Ga0495643_0009269 3300046522 Bacteria 6132
184 Ga0495643_0214107 3300046522 Unclassified 918
185 Ga0495642_0034381 3300046528 Bacteria 2041
186 Ga0495654_0000540 3300046530 Bacteria 30505
187 Ga0495633_0001360 3300046558 Bacteria 19136
188 Ga0495633_0129161 3300046558 Unclassified 1169
189 Ga0495625_0097369 3300046660 Bacteria 2025
190 Ga0495649_0004914 3300046694 Bacteria 8616
191 Ga0495649_0422948 3300046694 Bacteria 667
192 Ga0495589_0000002 3300046794 Bacteria 758846
193 Ga0495660_0000004 3300046810 Bacteria 1003183
194 Ga0496102_0002998 3300048905 Bacteria 14302
195 Ga0496104_0000367 3300048907 Bacteria 39923
196 Ga0496106_0000106 3300048909 Bacteria 64785
197 Ga0496115_0000413 3300048918 Bacteria 34949
198 Ga0496115_0000455 3300048918 Bacteria 32821
199 Ga0496115_0003925 3300048918 Bacteria 10713
200 Ga0496115_0035557 3300048918 Bacteria 3941
201 Ga0496115_0521956 3300048918 Bacteria 952
202 Ga0496116_0000074 3300048919 Bacteria 231767
203 Ga0496116_0036053 3300048919 Bacteria 3467
204 Ga0496117_0003119 3300048920 Bacteria 19789
205 Ga0496117_0020870 3300048920 Bacteria 5328
206 Ga0496117_0042063 3300048920 Bacteria 3339
207 Ga0496117_0046265 3300048920 Bacteria 3131
208 Ga0496118_0001323 3300048921 Bacteria 37559
209 Ga0496118_0016317 3300048921 Bacteria 6819
210 Ga0496118_0020746 3300048921 Bacteria 5817
211 Ga0496119_0000885 3300048922 Bacteria 39222
212 Ga0496119_0004212 3300048922 Bacteria 14445
213 Ga0496119_0010571 3300048922 Bacteria 7744
214 Ga0496120_0000084 3300048923 Bacteria 156678
215 Ga0496120_0000275 3300048923 Bacteria 86166
216 Ga0496120_0029344 3300048923 Bacteria 3358
217 Ga0496121_0033035 3300048924 Bacteria 4691
218 Ga0496121_0102395 3300048924 Bacteria 2206
219 Ga0496122_0000064 3300048925 Bacteria 239959
220 Ga0496122_0029057 3300048925 Bacteria 4674
221 Ga0496123_0000049 3300048926 Bacteria 239949
222 Ga0496123_0030152 3300048926 Bacteria 3975
223 Ga0496124_0000017 3300048927 Bacteria 444389
224 Ga0496124_0000027 3300048927 Bacteria 376097
225 Ga0496124_0079899 3300048927 Bacteria 2692
226 Ga0496125_0013718 3300048928 Bacteria 7948
227 Ga0496126_0001207 3300048929 Bacteria 42120
228 Ga0496126_0002616 3300048929 Bacteria 23990
229 Ga0496126_0002718 3300048929 Bacteria 23385
230 Ga0496126_0010047 3300048929 Bacteria 9987
231 Ga0495678_124288 3300049459 Bacteria 862
232 Ga0495682_0003389 3300049460 Bacteria 7102
233 Ga0501043_0075005 3300049579 Bacteria 2657
234 Ga0501047_0247125 3300049581 Bacteria 1633
235 Ga0501068_0380815 3300049584 Bacteria 908
236 Ga0501073_0535694 3300049589 Bacteria 809
237 Ga0500658_0125606 3300053134 Bacteria 1140
238 Ga0500568_0002618 3300053139 Bacteria 10468
239 Ga0500586_001283 3300053145 Bacteria 5267
240 Ga0500622_0000237 3300053156 Bacteria 57253
241 Ga0500633_0003057 3300053160 Bacteria 3579
242 Ga0501082_0072958 3300060353 Bacteria 2956
243 2508851405 2508501071 Bacteria 5454741
244 2511198468 2510917030 Bacteria 7460662
245 2585224847 2582581298 Bacteria 7315509
246 2585547403 2585427529 Bacteria 7395659
247 2585827648 2585427591 Bacteria 5482980
248 2585834757 2585427592 Bacteria 5370892
249 2671107192 2667528173 Bacteria 5375747
250 2687496860 2687453109 Bacteria 3860091
251 2739733459 2739367700 Bacteria 4747630
252 2772437971 2772190666 Bacteria 5117644
253 2807177040 2806310673 Bacteria 4801221
254 2812314762 2811994870 Bacteria 3776934
255 2823526733 2823526263 Bacteria 3765752
256 2884412743 2884411467 Bacteria 5246714
257 2904476130 2904474040 Bacteria 5504324
258 2919104499 2919100787 Bacteria 7710546
259 2919152299 2919150387 Bacteria 5500879
260 2927144968 2927143783 Bacteria 5504251
261 2928966744 2928963466 Bacteria 5165703
262 2937969714 2937967321 Bacteria 5094075
263 3005449214 3005445848 Bacteria 6906074
264 640936962 640753048 Bacteria 5495657
265 8015394956 8015394850 Bacteria 5064660
266 Ga0213872_10006502
267 JGI24735J21928_10000803
268 JGI25162J39368_1000521
269 JGI25162J39368_1003364
270 JGI25158J39367_1000180
271 JGI25157J39369_1000434
272 JGI25163J39215_1000064
273 JGI25163J39215_1001632
274 JGI25164J39214_1000006
275 JGI25164J39214_1000288
276 JGI25152J39213_1001981
277 JGI25152J39213_1014175
278 JGI25159J45721_1001406
279 JGI25151J46595_10016424
280 JGI25165J46597_1000532
281 JGI25153J46596_10003024
282 JGI25153J46596_10035163
283 JGI25153J46596_10036896
284 rootH2_10044954
285 rootH2_10102738
286 rootH2_10159621
287 rootL2_10008532
288 rootH1_10078253
289 JGI25160J50197_1038817
290 JGI25161J50226_1000114
291 Ga0006562J51391_1001226
292 Ga0055538_1000003
293 Ga0055538_1001162
294 Ga0055539_1000003
295 Ga0055533_1000005
296 Ga0055533_1000410
297 Ga0055525_1000005
298 Ga0055535_1000429
299 Ga0055535_1007899
300 Ga0055542_1000292
301 Ga0055542_1000648
302 Ga0055529_1000467
303 Ga0055526_1002600
304 Ga0055524_1014713
305 Ga0055528_1019582
306 Ga0055540_1001218
307 Ga0055541_1000003
308 Ga0055543_1000077
309 Ga0065165_1020441
310 Ga0065703_1020905
311 Ga0065704_10000011
312 Ga0070682_100245349
313 Ga0070668_100360476
314 Ga0070688_100331253
315 Ga0070710_10931639
316 Ga0070663_100187018
317 Ga0070685_10010846
318 Ga0070665_100056753
319 Ga0070665_100164099
320 Ga0070665_100347106
321 Ga0068860_100232443
322 Ga0081455_10028180
323 Ga0079104_1006595
324 Ga0079104_1043406
325 Ga0105251_10015616
326 Ga0105251_10152530
327 Ga0105244_10000276
328 Ga0105244_10001366
329 Ga0105244_10350280
330 Ga0105250_10000141
331 Ga0105240_10027351
332 Ga0105240_10059422
333 Ga0105240_10347369
334 Ga0105237_10762044
335 Ga0105238_10231768
336 Ga0105238_10633277
337 Ga0105249_10552507
338 Ga0157371_10000134
339 Ga0157369_10334811
340 Ga0157369_10990739
341 Ga0163162_10028268
342 Ga0163163_10585375
343 Ga0182008_10136890
344 Ga0182008_10534885
345 Ga0157379_10052887
346 Ga0182007_10005061
347 Ga0183368_1002
348 Ga0213872_10001721
349 Ga0209435_102371
350 Ga0209760_100062
351 Ga0209436_100050
352 Ga0209784_100001
353 Ga0209784_100216
354 Ga0209566_100001
355 Ga0209566_102232
356 Ga0209674_100002
357 Ga0209674_100014
358 Ga0209672_100994
359 Ga0209672_107210
360 Ga0209563_100002
361 Ga0207427_100009
362 Ga0207427_100267
363 Ga0209437_100001
364 Ga0209437_100037
365 Ga0209437_100138
366 Ga0209258_100034
367 Ga0209258_100620
368 Ga0209258_102433
369 Ga0207425_1002635
370 Ga0207425_1009621
371 Ga0207425_1019085
372 Ga0209646_1000436
373 Ga0209026_1000255
374 Ga0209026_1001319
375 Ga0209677_100002
376 Ga0209148_1000001
377 Ga0209148_1000002
378 Ga0209759_1000678
379 Ga0209759_1005908
380 Ga0209129_1001687
381 Ga0209129_1002355
382 Ga0209129_1003334
383 Ga0209233_1000002
384 Ga0209233_1005855
385 Ga0209455_1000054
386 Ga0209455_1002220
387 Ga0209673_1003647
388 Ga0209130_1000030
389 Ga0209025_1019307
390 Ga0209564_1000364
391 Ga0209758_1000357
392 Ga0209758_1001342
393 Ga0209758_1001459
394 Ga0209256_1002320
395 Ga0207426_1000047
396 Ga0209051_1001764
397 Ga0209257_1016732
398 Ga0207696_1000258
399 Ga0207655_1000011
400 Ga0207655_1000349
401 Ga0207713_1002024
402 Ga0207713_1152821
403 Ga0207647_10105232
404 Ga0207647_10222766
405 Ga0207645_10267676
406 Ga0207695_10230850
407 Ga0207695_10472573
408 Ga0207671_10546234
409 Ga0207664_11474847
410 Ga0207668_10275284
411 Ga0207678_10079153
412 Ga0268266_10000234
413 Ga0268266_10122780
414 Ga0268264_10168760
415 Ga0265330_10047385
416 Ga0265330_10054526
417 Ga0265328_10020319
418 Ga0265325_10031541
419 Ga0265325_10231792
420 Ga0265340_10216815
421 Ga0265339_10009553
422 Ga0265339_10048976
423 Ga0265316_10213031
424 Ga0265316_10536957
425 Ga0265314_10058763
426 Ga0265342_10141173
427 Ga0316576_10209157
428 Ga0316578_10052050
429 Ga0316583_10038843
430 Ga0316583_10071905
431 Ga0316574_0024092
432 Ga0316584_0023303
433 Ga0436361_0001950
434 Ga0436361_0053779
435 Ga0436361_0471854
436 Ga0436361_0858438
437 Ga0439465_0007535
438 Ga0439465_0065673
439 Ga0466961_0257796
440 Ga0466959_0065897
441 Ga0495590_0026811
442 Ga0495638_0000116
443 Ga0495650_0000064
444 Ga0495650_0000404
445 Ga0495583_0065248
446 Ga0495606_0005316
447 Ga0495610_0019884
448 Ga0495643_0009269
449 Ga0495643_0214107
450 Ga0495642_0034381
451 Ga0495654_0000540
452 Ga0495633_0001360
453 Ga0495633_0129161
454 Ga0495625_0097369
455 Ga0495649_0004914
456 Ga0495649_0422948
457 Ga0495589_0000002
458 Ga0495660_0000004
459 Ga0496102_0002998
460 Ga0496104_0000367
461 Ga0496106_0000106
462 Ga0496115_0000413
463 Ga0496115_0000455
464 Ga0496115_0003925
465 Ga0496115_0035557
466 Ga0496115_0521956
467 Ga0496116_0000074
468 Ga0496116_0036053
469 Ga0496117_0003119
470 Ga0496117_0020870
471 Ga0496117_0042063
472 Ga0496117_0046265
473 Ga0496118_0001323
474 Ga0496118_0016317
475 Ga0496118_0020746
476 Ga0496119_0000885
477 Ga0496119_0004212
478 Ga0496119_0010571
479 Ga0496120_0000084
480 Ga0496120_0000275
481 Ga0496120_0029344
482 Ga0496121_0033035
483 Ga0496121_0102395
484 Ga0496122_0000064
485 Ga0496122_0029057
486 Ga0496123_0000049
487 Ga0496123_0030152
488 Ga0496124_0000017
489 Ga0496124_0000027
490 Ga0496124_0079899
491 Ga0496125_0013718
492 Ga0496126_0001207
493 Ga0496126_0002616
494 Ga0496126_0002718
495 Ga0496126_0010047
496 Ga0495678_124288
497 Ga0495682_0003389
498 Ga0501043_0075005
499 Ga0501047_0247125
500 Ga0501068_0380815
501 Ga0501073_0535694
502 Ga0500658_0125606
503 Ga0500568_0002618
504 Ga0500586_001283
505 Ga0500622_0000237
506 Ga0500633_0003057
507 Ga0501082_0072958
508 2508851405
509 2511198468
510 2585224847
511 2585547403
512 2585827648
513 2585834757
514 2671107192
515 2687496860
516 2739733459
517 2772437971
518 2807177040
519 2812314762
520 2823526733
521 2884412743
522 2904476130
523 2919104499
524 2919152299
525 2927144968
526 2928966744
527 2937969714
528 3005449214
529 640936962
530 8015394956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16157

DUF4865

Domain of unknown function (DUF4865)

1

183

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.7638 2 99
1r6y-assembly1.cif.gz_A crystal structure of ygin from escherichia coli 0.7509 1 92
3bgu-assembly1.cif.gz_A crystal structure of a dimeric ferredoxin-like protein of unknown function (tfu_0763) from thermobifida fusca yx at 1.50 a resolution 0.7476 2 90
3kng-assembly1.cif.gz_B crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution 0.7439 2 92
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.7343 2 91
ID Description Score Start End Superfamily
af_Q2G1Q7_1_176_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8951 1 181 3.30.70.100
af_Q2G1Q7_1_176_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8901 1 181 3.30.70.100
af_P9WLA3_114_212_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7739 91 162 3.30.70.100
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7618 2 90 3.30.70.100
3bguB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.746 1 90 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3N7D8T0-F1-model_v4 DUF4865 domain-containing protein 0.9786 2 182
AF-A0A0G9H484-F1-model_v4 DUF4865 domain-containing protein 0.9785 1 183
AF-A0A0G9H484-F1-model_v4 DUF4865 domain-containing protein 0.9732 1 183
AF-A0A2K4MQY7-F1-model_v4 DUF4865 domain-containing protein 0.9697 1 182
AF-A0A370X6G0-F1-model_v4 DUF4865 family protein 0.9686 1 183

Map