F373344

General Info

Members Datasets Scaffolds Average Seq Length
265 191 530 281

Family's Representative Sequence

Representative Sequence 3300021441|Ga0213871_10036439|Ga0213871_100364392
Length 332
Sequence MATTSAHSETTLAGRIDPDASVGTVRLTVTDLDRSRAFYERAIGLPSTECEDGTLALGVAGERPLIELRGDSVAPRLNRRAPGLYHLAILVPTRLDLAFALARLAEARYPLDGASDHLVSEALYLSDPDGNGIEIYRDRPRAEWPYADDQLQMSTLALDLNDVLGELQAASELQTHVPSGTKIGHVHLQVSDLGEAETFYHGVLGFDVVVRGYPGALFVSAGGYHHHIGLNTWESLGGQPPPRGTTGLYHLAVLYPSRSALADGLRRLLAAGIHLDGASDHGVSEALYLRDPDENGVELYRDRPPAEWPRTPDGKLAMYTRRLDIDDLLREP

Samples

Sample ID Description Type Environment
1 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
113 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
185 2738541295 Bacillus sp. OK085 Isolate Unclassified
186 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
187 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
188 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
189 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
190 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
191 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.6
Metatranscriptomes 0.38
Isolates 3.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 0
Rhizoplane 2.64
Rhizosphere 81.89
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213871_10036439 3300021441 Bacteria 1305
2 JGI25159J45721_1000001 3300002987 Bacteria 303489
3 JGI25160J50197_1000002 3300003354 Bacteria 561707
4 Ga0055526_1001202 3300003771 Bacteria 18643
5 Ga0055524_1015277 3300003775 Bacteria 2807
6 Ga0055536_1036639 3300003781 Bacteria 1211
7 Ga0055531_10004945 3300003794 Bacteria 7923
8 Ga0055543_1000137 3300004625 Bacteria 60651
9 Ga0065165_1000004 3300005262 Bacteria 377081
10 Ga0070670_100166351 3300005331 Bacteria 1912
11 Ga0070666_10101013 3300005335 Bacteria 1988
12 Ga0070680_100553647 3300005336 Archaea 986
13 Ga0070689_100102163 3300005340 Bacteria 2271
14 Ga0070687_100100823 3300005343 Bacteria 1616
15 Ga0070692_10270822 3300005345 Bacteria 1025
16 Ga0070668_100134721 3300005347 Bacteria 1985
17 Ga0070669_100007254 3300005353 Bacteria 7955
18 Ga0070671_100009088 3300005355 Bacteria 7975
19 Ga0070673_100108485 3300005364 Bacteria 2299
20 Ga0070673_100469744 3300005364 Bacteria 1134
21 Ga0070688_100028364 3300005365 Bacteria 3341
22 Ga0070700_100494709 3300005441 Unclassified 939
23 Ga0070681_10130002 3300005458 Bacteria 2450
24 Ga0070698_100017279 3300005471 Bacteria 7602
25 Ga0070698_100399213 3300005471 Bacteria 1308
26 Ga0070699_100024080 3300005518 Bacteria 5247
27 Ga0070679_100025916 3300005530 Bacteria 5753
28 Ga0070684_100005927 3300005535 Bacteria 9410
29 Ga0070684_100189870 3300005535 Bacteria 1869
30 Ga0070697_100165467 3300005536 Bacteria 1870
31 Ga0070672_100186781 3300005543 Bacteria 1729
32 Ga0070672_100195803 3300005543 Bacteria 1689
33 Ga0070686_100058450 3300005544 Bacteria 2481
34 Ga0070695_100071850 3300005545 Archaea 2267
35 Ga0070665_100562128 3300005548 Bacteria 1153
36 Ga0070704_100015559 3300005549 Bacteria 4782
37 Ga0068854_100121377 3300005578 Bacteria 1984
38 Ga0070702_100139118 3300005615 Bacteria 1544
39 Ga0068859_100360080 3300005617 Bacteria 1550
40 Ga0068864_100140749 3300005618 Bacteria 2176
41 Ga0068863_100013519 3300005841 Bacteria 7874
42 Ga0068858_100275497 3300005842 Bacteria 1601
43 Ga0068860_100046753 3300005843 Bacteria 4127
44 Ga0068862_100025466 3300005844 Bacteria 4967
45 Ga0068862_100136858 3300005844 Bacteria 2171
46 Ga0081455_10104602 3300005937 Bacteria 2264
47 Ga0081538_10000058 3300005981 Bacteria 102121
48 Ga0081538_10002406 3300005981 Bacteria 18373
49 Ga0081540_1003574 3300005983 Bacteria 12220
50 Ga0075365_10170322 3300006038 Bacteria 1520
51 Ga0075428_100105053 3300006844 Bacteria 3080
52 Ga0075428_100171320 3300006844 Bacteria 2353
53 Ga0075431_100273281 3300006847 Bacteria 1712
54 Ga0075433_10202397 3300006852 Bacteria 1765
55 Ga0075433_10250522 3300006852 Bacteria 1571
56 Ga0075434_100025549 3300006871 Bacteria 5778
57 Ga0075434_100053292 3300006871 Bacteria 4020
58 Ga0075434_100525471 3300006871 Bacteria 1204
59 Ga0075434_100673361 3300006871 Bacteria 1052
60 Ga0068865_100207310 3300006881 Bacteria 1525
61 Ga0097620_100360074 3300006931 Bacteria 1550
62 Ga0075435_100003450 3300007076 Bacteria 10729
63 Ga0105240_10070820 3300009093 Bacteria 4313
64 Ga0111539_10180022 3300009094 Archaea 2469
65 Ga0114129_10002435 3300009147 Bacteria 25826
66 Ga0114129_10052771 3300009147 Bacteria 5705
67 Ga0114129_10128454 3300009147 Bacteria 3483
68 Ga0114129_10145231 3300009147 Bacteria 3250
69 Ga0114129_10287264 3300009147 Bacteria 2196
70 Ga0114129_10322662 3300009147 Bacteria 2053
71 Ga0105242_10358638 3300009176 Bacteria 1349
72 Ga0105248_10005561 3300009177 Bacteria 13850
73 Ga0105248_10027180 3300009177 Bacteria 6365
74 Ga0157373_10283948 3300013100 Bacteria 1173
75 Ga0157370_10123426 3300013104 Bacteria 2418
76 Ga0157370_10145803 3300013104 Bacteria 2205
77 Ga0157369_10377080 3300013105 Bacteria 1472
78 Ga0171463_1001 3300013249 Bacteria 1406070
79 Ga0163162_10177291 3300013306 Bacteria 2257
80 Ga0157372_10478325 3300013307 Bacteria 1452
81 Ga0157375_10066210 3300013308 Bacteria 3605
82 Ga0163163_10604721 3300014325 Bacteria 1160
83 Ga0157380_10101329 3300014326 Bacteria 2399
84 Ga0157379_10049170 3300014968 Bacteria 3764
85 Ga0213876_10038229 3300021384 Bacteria 2532
86 Ga0213876_10116637 3300021384 Bacteria 1417
87 Ga0213875_10087231 3300021388 Bacteria 1455
88 Ga0224712_10007569 3300022467 Bacteria 3169
89 Ga0209436_100270 3300025208 Bacteria 23759
90 Ga0209130_1000008 3300025284 Bacteria 581232
91 Ga0209676_1005535 3300025292 Bacteria 6549
92 Ga0209025_1000100 3300025294 Bacteria 229182
93 Ga0209564_1000104 3300025295 Bacteria 219017
94 Ga0209256_1000723 3300025299 Bacteria 43638
95 Ga0207426_1000016 3300025302 Bacteria 581232
96 Ga0209051_1039817 3300025303 Bacteria 1692
97 Ga0209257_1002305 3300025304 Bacteria 19326
98 Ga0207680_10018128 3300025903 Bacteria 3735
99 Ga0207645_10092627 3300025907 Bacteria 1944
100 Ga0207695_10012398 3300025913 Bacteria 10237
101 Ga0207695_10127978 3300025913 Bacteria 2500
102 Ga0207660_10342100 3300025917 Archaea 1198
103 Ga0207662_10139975 3300025918 Bacteria 1532
104 Ga0207652_10155523 3300025921 Bacteria 2048
105 Ga0207652_10474324 3300025921 Bacteria 1127
106 Ga0207681_10032835 3300025923 Bacteria 3401
107 Ga0207659_10311455 3300025926 Bacteria 1296
108 Ga0207664_10148074 3300025929 Bacteria 1992
109 Ga0207644_10021338 3300025931 Bacteria 4411
110 Ga0207670_10081529 3300025936 Bacteria 2265
111 Ga0207669_10420388 3300025937 Bacteria 1052
112 Ga0207691_10042620 3300025940 Bacteria 4183
113 Ga0207691_10157400 3300025940 Bacteria 1994
114 Ga0207711_10582225 3300025941 Bacteria 1044
115 Ga0207661_10017089 3300025944 Bacteria 5360
116 Ga0207667_10103918 3300025949 Bacteria 2930
117 Ga0207651_10517186 3300025960 Bacteria 1034
118 Ga0207668_10017109 3300025972 Bacteria 4537
119 Ga0207658_10003721 3300025986 Bacteria 10740
120 Ga0207708_10042330 3300026075 Bacteria 3472
121 Ga0207641_10012385 3300026088 Bacteria 6996
122 Ga0207675_100034057 3300026118 Bacteria 4747
123 Ga0207675_100229854 3300026118 Bacteria 1789
124 Ga0268265_10007982 3300028380 Bacteria 7145
125 Ga0268265_10146058 3300028380 Bacteria 1987
126 Ga0268265_10274301 3300028380 Bacteria 1506
127 Ga0268264_10013934 3300028381 Bacteria 6609
128 Ga0265338_10183962 3300028800 Bacteria 1590
129 Ga0316576_10061510 3300031727 Bacteria 2752
130 Ga0316576_10210128 3300031727 Bacteria 1465
131 Ga0316578_10003763 3300031728 Bacteria 7018
132 Ga0307410_10154705 3300031852 Bacteria 1711
133 Ga0307406_10087462 3300031901 Unclassified 2089
134 Ga0307409_100145939 3300031995 Bacteria 2046
135 Ga0307416_100147962 3300032002 Bacteria 2148
136 Ga0307416_100291380 3300032002 Unclassified 1616
137 Ga0307416_100433275 3300032002 Bacteria 1363
138 Ga0307414_10678796 3300032004 Bacteria 931
139 Ga0307411_10117473 3300032005 Unclassified 1917
140 Ga0316585_10008395 3300032137 Bacteria 2998
141 Ga0316580_10004439 3300032139 Bacteria 4069
142 Ga0373941_0004351 3300035115 Bacteria 3265
143 Ga0316574_0004650 3300035398 Bacteria 7227
144 Ga0373931_0025795 3300035691 Bacteria 2986
145 Ga0373937_0089469 3300036401 Bacteria 2851
146 Ga0316582_0009100 3300036647 Bacteria 5374
147 Ga0316582_0072730 3300036647 Bacteria 2229
148 Ga0316584_0046536 3300036712 Bacteria 3241
149 Ga0316584_0385209 3300036712 Bacteria 1001
150 Ga0395898_0051766 3300037466 Bacteria 4014
151 Ga0436364_0286170 3300037853 Bacteria 9832
152 Ga0436364_0679275 3300037853 Bacteria 6069
153 Ga0436365_0139065 3300039437 Bacteria 6181
154 Ga0436365_0973085 3300039437 Bacteria 6600
155 Ga0436365_1122890 3300039437 Bacteria 13860
156 Ga0436365_1307463 3300039437 Bacteria 3653
157 Ga0436365_1408956 3300039437 Bacteria 6385
158 Ga0436365_1700333 3300039437 Bacteria 6253
159 Ga0436363_0320074 3300039450 Bacteria 2081
160 Ga0436362_0047855 3300039453 Bacteria 4214
161 Ga0436362_0394040 3300039453 Bacteria 1219
162 Ga0466969_0006254 3300044656 Bacteria 6335
163 Ga0466969_0021205 3300044656 Bacteria 3360
164 Ga0466966_0066411 3300044684 Bacteria 2267
165 Ga0466961_0020320 3300044693 Bacteria 4271
166 Ga0466963_0017572 3300044694 Bacteria 4460
167 Ga0466963_0026891 3300044694 Bacteria 3680
168 Ga0466963_0162824 3300044694 Bacteria 1553
169 Ga0466968_0015408 3300044735 Bacteria 3030
170 Ga0466968_0047338 3300044735 Bacteria 1828
171 Ga0466957_0117987 3300044842 Bacteria 1689
172 Ga0466957_0161258 3300044842 Bacteria 1456
173 Ga0466959_0000495 3300045049 Bacteria 22922
174 Ga0466959_0029134 3300045049 Bacteria 4091
175 Ga0466959_0037136 3300045049 Bacteria 3599
176 Ga0466959_0134245 3300045049 Bacteria 1753
177 Ga0466959_0174420 3300045049 Bacteria 1507
178 Ga0466958_0002170 3300045836 Bacteria 9782
179 Ga0466958_0062413 3300045836 Bacteria 2272
180 Ga0466967_0049316 3300045976 Bacteria 3681
181 Ga0466967_0216967 3300045976 Bacteria 1816
182 Ga0466967_0809698 3300045976 Bacteria 930
183 Ga0495584_0181490 3300046491 Unclassified 1070
184 Ga0495642_0136657 3300046528 Bacteria 1057
185 Ga0495656_0106874 3300046615 Bacteria 1303
186 Ga0495674_0046945 3300047319 Bacteria 3832
187 Ga0495672_0025451 3300047320 Bacteria 3787
188 Ga0496101_0031100 3300048904 Bacteria 3750
189 Ga0496102_0469635 3300048905 Bacteria 1179
190 Ga0496105_0154411 3300048908 Bacteria 1886
191 Ga0496106_0167904 3300048909 Bacteria 1738
192 Ga0496107_0051805 3300048910 Bacteria 2961
193 Ga0496108_0174949 3300048911 Bacteria 1858
194 Ga0496110_0122041 3300048913 Bacteria 2348
195 Ga0496119_0000664 3300048922 Bacteria 46081
196 Ga0496122_0011134 3300048925 Bacteria 9161
197 Ga0496123_0001292 3300048926 Bacteria 35699
198 Ga0496124_0055114 3300048927 Bacteria 3362
199 Ga0501031_0300626 3300049568 Bacteria 1040
200 Ga0501039_0226681 3300049575 Bacteria 1469
201 Ga0501040_0022034 3300049576 Bacteria 4261
202 Ga0501040_0069260 3300049576 Bacteria 2434
203 Ga0501041_0026631 3300049577 Bacteria 3479
204 Ga0501041_0041824 3300049577 Bacteria 2784
205 Ga0501041_0204069 3300049577 Bacteria 1240
206 Ga0501042_0015805 3300049578 Bacteria 5173
207 Ga0501043_0204000 3300049579 Bacteria 1534
208 Ga0501046_0156850 3300049580 Bacteria 1714
209 Ga0501048_0395828 3300049582 Bacteria 987
210 Ga0501068_0070942 3300049584 Bacteria 2126
211 Ga0501069_0060662 3300049585 Bacteria 2112
212 Ga0501070_0362075 3300049586 Bacteria 1176
213 Ga0501071_0065199 3300049587 Bacteria 2644
214 Ga0501071_0165611 3300049587 Bacteria 1654
215 Ga0501071_0165781 3300049587 Unclassified 1653
216 Ga0501072_0032030 3300049588 Bacteria 4116
217 Ga0501072_0052245 3300049588 Bacteria 3218
218 Ga0501072_0216302 3300049588 Bacteria 1527
219 Ga0501075_0173604 3300049591 Bacteria 1645
220 Ga0501075_0214489 3300049591 Bacteria 1468
221 Ga0501075_0285222 3300049591 Unclassified 1258
222 Ga0501076_0036852 3300049592 Bacteria 3834
223 Ga0501077_0025079 3300049593 Bacteria 3787
224 Ga0501077_0110894 3300049593 Bacteria 1739
225 Ga0501079_0081010 3300049741 Bacteria 2510
226 Ga0501079_0113736 3300049741 Bacteria 2104
227 Ga0501079_0468789 3300049741 Unclassified 989
228 Ga0501080_0080158 3300049742 Bacteria 3035
229 Ga0501045_0012520 3300049824 Bacteria 5975
230 Ga0501045_0141019 3300049824 Bacteria 1792
231 nmdc:mga05p37_216888_c1 3300050507 Bacteria 2311
232 nmdc:mga05p37_308681_c1 3300050507 Bacteria 1876
233 nmdc:mga05p37_52261_c1 3300050507 Bacteria 5025
234 nmdc:mga05p37_562474_c1 3300050507 Unclassified 1295
235 nmdc:mga05p37_591_c1 3300050507 Bacteria 39971
236 nmdc:mga09592_113668_c1 3300050508 Bacteria 2323
237 nmdc:mga09592_208378_c1 3300050508 Bacteria 1693
238 nmdc:mga08y16_45278_c1 3300050511 Bacteria 4610
239 nmdc:mga0n895_156460_c1 3300050512 Bacteria 2310
240 nmdc:mga0n895_20597_c1 3300050512 Bacteria 6153
241 nmdc:mga0rr50_146588_c1 3300050513 Bacteria 1904
242 nmdc:mga08x19_24825_c1 3300050514 Bacteria 3729
243 nmdc:mga0a205_221457_c1 3300050515 Bacteria 1777
244 nmdc:mga0a205_297223_c1 3300050515 Bacteria 1488
245 nmdc:mga0a205_29753_c1 3300050515 Bacteria 3544
246 Ga0495612_0061256 3300053078 Bacteria 1559
247 Ga0500556_0000367 3300053104 Bacteria 33149
248 Ga0500616_0012820 3300053153 Bacteria 4892
249 Ga0500645_002787 3300053730 Bacteria 7540
250 Ga0501084_0038400 3300054114 Bacteria 4003
251 Ga0501084_0127478 3300054114 Bacteria 2142
252 Ga0501082_0080430 3300060353 Bacteria 2812
253 Ga0501082_0080682 3300060353 Bacteria 2808
254 Ga0466962_0074586 3300061719 Bacteria 1621
255 Ga0530510_0003421 3300061734 Bacteria 10913
256 Ga0530510_0123979 3300061734 Bacteria 1898
257 Ga0530510_0178823 3300061734 Bacteria 1573
258 2556065892 2554235469 Bacteria 3590176
259 2738817790 2738541295 Bacteria 5730091
260 2828308591 2828305725 Bacteria 4916900
261 2857609869 2857609550 Bacteria 3753890
262 2990276529 2990275345 Bacteria 4887158
263 3001892894 3001892409 Bacteria 6328293
264 3006980337 3006978542 Bacteria 5328100
265 8054282166 8054280661 Bacteria 4232245
266 Ga0213871_10036439
267 JGI25159J45721_1000001
268 JGI25160J50197_1000002
269 Ga0055526_1001202
270 Ga0055524_1015277
271 Ga0055536_1036639
272 Ga0055531_10004945
273 Ga0055543_1000137
274 Ga0065165_1000004
275 Ga0070670_100166351
276 Ga0070666_10101013
277 Ga0070680_100553647
278 Ga0070689_100102163
279 Ga0070687_100100823
280 Ga0070692_10270822
281 Ga0070668_100134721
282 Ga0070669_100007254
283 Ga0070671_100009088
284 Ga0070673_100108485
285 Ga0070673_100469744
286 Ga0070688_100028364
287 Ga0070700_100494709
288 Ga0070681_10130002
289 Ga0070698_100017279
290 Ga0070698_100399213
291 Ga0070699_100024080
292 Ga0070679_100025916
293 Ga0070684_100005927
294 Ga0070684_100189870
295 Ga0070697_100165467
296 Ga0070672_100186781
297 Ga0070672_100195803
298 Ga0070686_100058450
299 Ga0070695_100071850
300 Ga0070665_100562128
301 Ga0070704_100015559
302 Ga0068854_100121377
303 Ga0070702_100139118
304 Ga0068859_100360080
305 Ga0068864_100140749
306 Ga0068863_100013519
307 Ga0068858_100275497
308 Ga0068860_100046753
309 Ga0068862_100025466
310 Ga0068862_100136858
311 Ga0081455_10104602
312 Ga0081538_10000058
313 Ga0081538_10002406
314 Ga0081540_1003574
315 Ga0075365_10170322
316 Ga0075428_100105053
317 Ga0075428_100171320
318 Ga0075431_100273281
319 Ga0075433_10202397
320 Ga0075433_10250522
321 Ga0075434_100025549
322 Ga0075434_100053292
323 Ga0075434_100525471
324 Ga0075434_100673361
325 Ga0068865_100207310
326 Ga0097620_100360074
327 Ga0075435_100003450
328 Ga0105240_10070820
329 Ga0111539_10180022
330 Ga0114129_10002435
331 Ga0114129_10052771
332 Ga0114129_10128454
333 Ga0114129_10145231
334 Ga0114129_10287264
335 Ga0114129_10322662
336 Ga0105242_10358638
337 Ga0105248_10005561
338 Ga0105248_10027180
339 Ga0157373_10283948
340 Ga0157370_10123426
341 Ga0157370_10145803
342 Ga0157369_10377080
343 Ga0171463_1001
344 Ga0163162_10177291
345 Ga0157372_10478325
346 Ga0157375_10066210
347 Ga0163163_10604721
348 Ga0157380_10101329
349 Ga0157379_10049170
350 Ga0213876_10038229
351 Ga0213876_10116637
352 Ga0213875_10087231
353 Ga0224712_10007569
354 Ga0209436_100270
355 Ga0209130_1000008
356 Ga0209676_1005535
357 Ga0209025_1000100
358 Ga0209564_1000104
359 Ga0209256_1000723
360 Ga0207426_1000016
361 Ga0209051_1039817
362 Ga0209257_1002305
363 Ga0207680_10018128
364 Ga0207645_10092627
365 Ga0207695_10012398
366 Ga0207695_10127978
367 Ga0207660_10342100
368 Ga0207662_10139975
369 Ga0207652_10155523
370 Ga0207652_10474324
371 Ga0207681_10032835
372 Ga0207659_10311455
373 Ga0207664_10148074
374 Ga0207644_10021338
375 Ga0207670_10081529
376 Ga0207669_10420388
377 Ga0207691_10042620
378 Ga0207691_10157400
379 Ga0207711_10582225
380 Ga0207661_10017089
381 Ga0207667_10103918
382 Ga0207651_10517186
383 Ga0207668_10017109
384 Ga0207658_10003721
385 Ga0207708_10042330
386 Ga0207641_10012385
387 Ga0207675_100034057
388 Ga0207675_100229854
389 Ga0268265_10007982
390 Ga0268265_10146058
391 Ga0268265_10274301
392 Ga0268264_10013934
393 Ga0265338_10183962
394 Ga0316576_10061510
395 Ga0316576_10210128
396 Ga0316578_10003763
397 Ga0307410_10154705
398 Ga0307406_10087462
399 Ga0307409_100145939
400 Ga0307416_100147962
401 Ga0307416_100291380
402 Ga0307416_100433275
403 Ga0307414_10678796
404 Ga0307411_10117473
405 Ga0316585_10008395
406 Ga0316580_10004439
407 Ga0373941_0004351
408 Ga0316574_0004650
409 Ga0373931_0025795
410 Ga0373937_0089469
411 Ga0316582_0009100
412 Ga0316582_0072730
413 Ga0316584_0046536
414 Ga0316584_0385209
415 Ga0395898_0051766
416 Ga0436364_0286170
417 Ga0436364_0679275
418 Ga0436365_0139065
419 Ga0436365_0973085
420 Ga0436365_1122890
421 Ga0436365_1307463
422 Ga0436365_1408956
423 Ga0436365_1700333
424 Ga0436363_0320074
425 Ga0436362_0047855
426 Ga0436362_0394040
427 Ga0466969_0006254
428 Ga0466969_0021205
429 Ga0466966_0066411
430 Ga0466961_0020320
431 Ga0466963_0017572
432 Ga0466963_0026891
433 Ga0466963_0162824
434 Ga0466968_0015408
435 Ga0466968_0047338
436 Ga0466957_0117987
437 Ga0466957_0161258
438 Ga0466959_0000495
439 Ga0466959_0029134
440 Ga0466959_0037136
441 Ga0466959_0134245
442 Ga0466959_0174420
443 Ga0466958_0002170
444 Ga0466958_0062413
445 Ga0466967_0049316
446 Ga0466967_0216967
447 Ga0466967_0809698
448 Ga0495584_0181490
449 Ga0495642_0136657
450 Ga0495656_0106874
451 Ga0495674_0046945
452 Ga0495672_0025451
453 Ga0496101_0031100
454 Ga0496102_0469635
455 Ga0496105_0154411
456 Ga0496106_0167904
457 Ga0496107_0051805
458 Ga0496108_0174949
459 Ga0496110_0122041
460 Ga0496119_0000664
461 Ga0496122_0011134
462 Ga0496123_0001292
463 Ga0496124_0055114
464 Ga0501031_0300626
465 Ga0501039_0226681
466 Ga0501040_0022034
467 Ga0501040_0069260
468 Ga0501041_0026631
469 Ga0501041_0041824
470 Ga0501041_0204069
471 Ga0501042_0015805
472 Ga0501043_0204000
473 Ga0501046_0156850
474 Ga0501048_0395828
475 Ga0501068_0070942
476 Ga0501069_0060662
477 Ga0501070_0362075
478 Ga0501071_0065199
479 Ga0501071_0165611
480 Ga0501071_0165781
481 Ga0501072_0032030
482 Ga0501072_0052245
483 Ga0501072_0216302
484 Ga0501075_0173604
485 Ga0501075_0214489
486 Ga0501075_0285222
487 Ga0501076_0036852
488 Ga0501077_0025079
489 Ga0501077_0110894
490 Ga0501079_0081010
491 Ga0501079_0113736
492 Ga0501079_0468789
493 Ga0501080_0080158
494 Ga0501045_0012520
495 Ga0501045_0141019
496 nmdc:mga05p37_216888_c1
497 nmdc:mga05p37_308681_c1
498 nmdc:mga05p37_52261_c1
499 nmdc:mga05p37_562474_c1
500 nmdc:mga05p37_591_c1
501 nmdc:mga09592_113668_c1
502 nmdc:mga09592_208378_c1
503 nmdc:mga08y16_45278_c1
504 nmdc:mga0n895_156460_c1
505 nmdc:mga0n895_20597_c1
506 nmdc:mga0rr50_146588_c1
507 nmdc:mga08x19_24825_c1
508 nmdc:mga0a205_221457_c1
509 nmdc:mga0a205_297223_c1
510 nmdc:mga0a205_29753_c1
511 Ga0495612_0061256
512 Ga0500556_0000367
513 Ga0500616_0012820
514 Ga0500645_002787
515 Ga0501084_0038400
516 Ga0501084_0127478
517 Ga0501082_0080430
518 Ga0501082_0080682
519 Ga0466962_0074586
520 Ga0530510_0003421
521 Ga0530510_0123979
522 Ga0530510_0178823
523 2556065892
524 2738817790
525 2828308591
526 2857609869
527 2990276529
528 3001892894
529 3006980337
530 8054282166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

182

299

0.93

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

135

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.8194 14 129
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8008 14 132
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7951 14 134
3r4q-assembly3.cif.gz_E-2 crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.7925 13 130
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.7843 12 130
ID Description Score Start End Superfamily
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9309 14 139 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9238 14 139 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.915 16 148 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9083 16 148 3.10.180.10
af_P52096_9_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8379 18 129 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A356I999-F1-model_v4 Glyoxalase 0.9677 14 134
AF-A0A2H5Z0Z5-F1-model_v4 Catechol-2,3-dioxygenase (EC 1.13.11.2) 0.9557 162 270 GO:0018577
AF-A0A436QZA0-F1-model_v4 VOC family protein 0.9504 13 139
AF-A0A430AQ59-F1-model_v4 VOC domain-containing protein 0.9496 12 126
AF-A0A1M2YU79-F1-model_v4 deleted 0.9482 13 155

Map