F373350

General Info

Members Datasets Scaffolds Average Seq Length
265 187 530 194

Family's Representative Sequence

Representative Sequence 3300025304|Ga0209257_1096339|Ga0209257_10963391
Length 192
Sequence MNKLSVIYHSGHGHTEHIAKQVLAGALTVYDTEAHLLEAQDVTRHPDVLQGYDGYIFGSPTYLGGVSGQFKTTFMDATGRLWRTQQLKGRLAAGFTVSSLPAGDKQSTLNSMFTVSMQHGMLWVGNPILPEQHAGVPYEEAANRLGSWSGLMAQAGHSAPADSFAPGDIKTARMFGRNFAKSLERLGSTVAV

Samples

Sample ID Description Type Environment
1 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
112 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
113 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
161 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 2547132374 Acidovorax radicis N35 Isolate Unclassified
168 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
169 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
170 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
171 2643221570 Acidovorax sp. Root568 Isolate Unclassified
172 2643221596 Acidovorax sp. Root70 Isolate Unclassified
173 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
174 2643221638 Duganella sp. Root336D2 Isolate Unclassified
175 2643221652 Acidovorax sp. Root402 Isolate Unclassified
176 2643221717 Acidovorax sp. Root267 Isolate Unclassified
177 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
178 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
179 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
180 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
181 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
182 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
183 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
184 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
185 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
186 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
187 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.08
Metatranscriptomes 0
Isolates 7.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.28
Nodule 0
Rhizoplane 3.4
Rhizosphere 62.26
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209257_1096339 3300025304 Bacteria 730
2 JGI25158J39367_1000788 3300002739 Bacteria 6039
3 JGI25152J39213_1000567 3300002773 Bacteria 20201
4 JGI25152J39213_1011781 3300002773 Bacteria 1913
5 JGI25150J39212_1000411 3300002774 Bacteria 19890
6 JGI25150J39212_1002976 3300002774 Bacteria 4084
7 JGI25159J45721_1015887 3300002987 Bacteria 1628
8 JGI25153J46596_10013727 3300003215 Bacteria 3408
9 rootH1_10014665 3300003316 Bacteria 15887
10 rootH2_10102231 3300003320 Bacteria 1787
11 rootL2_10000123 3300003322 Bacteria 51034
12 rootL2_10018294 3300003322 Bacteria 3002
13 rootH1_10169853 3300003323 Bacteria 2000
14 JGI25160J50197_1002160 3300003354 Bacteria 9309
15 JGI25161J50226_1008209 3300003374 Bacteria 1632
16 JGI25161J50226_1008250 3300003374 Bacteria 1624
17 Ga0055526_1006069 3300003771 Bacteria 6680
18 Ga0055526_1031573 3300003771 Bacteria 1514
19 Ga0055526_1068586 3300003771 Bacteria 727
20 Ga0055537_1008020 3300003773 Bacteria 2476
21 Ga0055537_1017090 3300003773 Bacteria 1205
22 Ga0055524_1000318 3300003775 Bacteria 45388
23 Ga0055524_1000652 3300003775 Bacteria 24532
24 Ga0055524_1002375 3300003775 Bacteria 9765
25 Ga0055524_1039813 3300003775 Bacteria 1209
26 Ga0055528_1011814 3300003790 Bacteria 3435
27 Ga0055530_10006725 3300003791 Bacteria 5033
28 Ga0055530_10007348 3300003791 Bacteria 4663
29 Ga0055530_10027795 3300003791 Bacteria 1539
30 Ga0055540_1040282 3300003792 Bacteria 1013
31 Ga0055531_10001129 3300003794 Bacteria 20643
32 Ga0055531_10008693 3300003794 Bacteria 5306
33 Ga0055531_10011490 3300003794 Bacteria 4262
34 Ga0058692_1000067 3300003856 Bacteria 88996
35 Ga0055543_1000391 3300004625 Bacteria 28334
36 Ga0055543_1021229 3300004625 Bacteria 1185
37 Ga0065165_1022078 3300005262 Bacteria 2191
38 Ga0065703_1000507 3300005272 Bacteria 24291
39 Ga0068869_100576953 3300005334 Bacteria 948
40 Ga0070669_100007800 3300005353 Bacteria 7648
41 Ga0070671_100067243 3300005355 Bacteria 2988
42 Ga0070673_100018592 3300005364 Bacteria 4969
43 Ga0070688_100015126 3300005365 Unclassified 4382
44 Ga0070659_101250771 3300005366 Bacteria 657
45 Ga0070678_100457255 3300005456 Bacteria 1119
46 Ga0070685_10000566 3300005466 Bacteria 20735
47 Ga0070679_100044475 3300005530 Unclassified 4423
48 Ga0068853_100112091 3300005539 Unclassified 2424
49 Ga0070693_100043379 3300005547 Bacteria 2539
50 Ga0070665_100004663 3300005548 Bacteria 14320
51 Ga0070665_100010864 3300005548 Bacteria 9209
52 Ga0070665_100135128 3300005548 Unclassified 2468
53 Ga0068852_100382572 3300005616 Bacteria 1381
54 Ga0068859_100036835 3300005617 Unclassified 4912
55 Ga0068864_100128012 3300005618 Bacteria 2278
56 Ga0068863_100013354 3300005841 Bacteria 7918
57 Ga0068860_100003003 3300005843 Bacteria 17425
58 Ga0068862_100422519 3300005844 Bacteria 1251
59 Ga0075362_10113043 3300006177 Bacteria 1280
60 Ga0075366_10023228 3300006195 Bacteria 3612
61 Ga0075366_10361022 3300006195 Bacteria 892
62 Ga0097621_100393662 3300006237 Bacteria 1239
63 Ga0075370_10019645 3300006353 Bacteria 3682
64 Ga0097620_100036835 3300006931 Unclassified 4912
65 Ga0105251_10046271 3300009011 Bacteria 2094
66 Ga0105244_10014301 3300009036 Bacteria 4595
67 Ga0105244_10088740 3300009036 Bacteria 1522
68 Ga0105244_10088837 3300009036 Bacteria 1521
69 Ga0105250_10139301 3300009092 Bacteria 1005
70 Ga0105240_10026186 3300009093 Bacteria 7652
71 Ga0105247_10004673 3300009101 Bacteria 8727
72 Ga0105243_10000263 3300009148 Bacteria 59080
73 Ga0105248_10014679 3300009177 Bacteria 8621
74 Ga0105237_10540043 3300009545 Bacteria 1172
75 Ga0105238_10453620 3300009551 Unclassified 1279
76 Ga0157319_1000004 3300012497 Bacteria 394735
77 Ga0157371_10041782 3300013102 Bacteria 3271
78 Ga0157370_10436615 3300013104 Bacteria 1204
79 Ga0157370_10564841 3300013104 Bacteria 1043
80 Ga0157372_10054182 3300013307 Bacteria 4473
81 Ga0157379_10189220 3300014968 Bacteria 1860
82 Ga0157376_10405611 3300014969 Bacteria 1319
83 Ga0163161_10012349 3300017792 Bacteria 5929
84 Ga0209436_100246 3300025208 Bacteria 24967
85 Ga0207425_1000013 3300025245 Bacteria 497384
86 Ga0207425_1001515 3300025245 Bacteria 9583
87 Ga0209129_1000152 3300025258 Bacteria 112977
88 Ga0209129_1007631 3300025258 Bacteria 3173
89 Ga0209565_1000443 3300025263 Bacteria 32988
90 Ga0209565_1001844 3300025263 Bacteria 8497
91 Ga0209565_1002631 3300025263 Bacteria 6336
92 Ga0209565_1003871 3300025263 Bacteria 4713
93 Ga0209565_1003909 3300025263 Bacteria 4676
94 Ga0209565_1005650 3300025263 Bacteria 3613
95 Ga0209673_1010829 3300025273 Bacteria 3811
96 Ga0209130_1000652 3300025284 Bacteria 31893
97 Ga0209130_1001871 3300025284 Bacteria 12030
98 Ga0209675_1001155 3300025291 Bacteria 16063
99 Ga0209675_1026248 3300025291 Bacteria 1453
100 Ga0209564_1002169 3300025295 Bacteria 16539
101 Ga0209564_1006564 3300025295 Bacteria 6245
102 Ga0209758_1000031 3300025297 Bacteria 497252
103 Ga0209050_1000525 3300025298 Bacteria 63749
104 Ga0209050_1005478 3300025298 Bacteria 7950
105 Ga0209256_1000085 3300025299 Bacteria 219043
106 Ga0209256_1000414 3300025299 Bacteria 67073
107 Ga0209256_1001153 3300025299 Bacteria 29957
108 Ga0209256_1009869 3300025299 Bacteria 4103
109 Ga0207426_1001966 3300025302 Bacteria 14593
110 Ga0209051_1005967 3300025303 Bacteria 6967
111 Ga0209257_1000157 3300025304 Bacteria 181004
112 Ga0209257_1000612 3300025304 Bacteria 58171
113 Ga0209257_1007823 3300025304 Bacteria 6325
114 Ga0207696_1014948 3300025711 Bacteria 2644
115 Ga0207696_1020638 3300025711 Bacteria 2121
116 Ga0207696_1066897 3300025711 Bacteria 1003
117 Ga0207655_1014210 3300025728 Bacteria 4515
118 Ga0207655_1014306 3300025728 Bacteria 4494
119 Ga0207655_1018711 3300025728 Bacteria 3659
120 Ga0207713_1001489 3300025735 Bacteria 18523
121 Ga0207713_1029929 3300025735 Bacteria 2430
122 Ga0207710_10000455 3300025900 Bacteria 26350
123 Ga0207710_10002212 3300025900 Bacteria 9145
124 Ga0207660_10227129 3300025917 Bacteria 1467
125 Ga0207681_10000495 3300025923 Bacteria 27581
126 Ga0207644_10032179 3300025931 Bacteria 3657
127 Ga0207709_10000158 3300025935 Bacteria 91810
128 Ga0207711_10045730 3300025941 Bacteria 3741
129 Ga0207651_10011322 3300025960 Bacteria 4990
130 Ga0207702_10521242 3300026078 Bacteria 1160
131 Ga0207641_10006368 3300026088 Bacteria 9965
132 Ga0207698_10291935 3300026142 Bacteria 1514
133 Ga0209371_1000196 3300027312 Bacteria 89093
134 Ga0209974_10021323 3300027876 Bacteria 2145
135 Ga0268266_10003943 3300028379 Bacteria 14418
136 Ga0268266_10007323 3300028379 Bacteria 9973
137 Ga0268265_10405607 3300028380 Bacteria 1261
138 Ga0268264_10001628 3300028381 Bacteria 20748
139 Ga0268256_1000158 3300030500 Bacteria 89061
140 Ga0265327_10000147 3300031251 Bacteria 153254
141 Ga0307408_100000102 3300031548 Bacteria 94058
142 Ga0307408_100000861 3300031548 Bacteria 23836
143 Ga0307408_100005671 3300031548 Bacteria 8318
144 Ga0307408_100006223 3300031548 Bacteria 7927
145 Ga0307408_100012700 3300031548 Bacteria 5585
146 Ga0307408_100046871 3300031548 Bacteria 3093
147 Ga0307408_100152143 3300031548 Bacteria 1828
148 Ga0307516_10057380 3300031730 Bacteria 3793
149 Ga0307413_10391474 3300031824 Bacteria 1086
150 Ga0307406_10001224 3300031901 Bacteria 14373
151 Ga0307406_10305795 3300031901 Bacteria 1224
152 Ga0307412_10118699 3300031911 Bacteria 1901
153 Ga0307412_10811306 3300031911 Bacteria 813
154 Ga0307416_100003550 3300032002 Bacteria 9194
155 Ga0307411_10283751 3300032005 Bacteria 1319
156 Ga0307411_10283937 3300032005 Bacteria 1319
157 Ga0373937_0121307 3300036401 Bacteria 2436
158 Ga0395899_0006427 3300037312 Bacteria 9106
159 Ga0395899_0021613 3300037312 Bacteria 4879
160 Ga0395900_0221540 3300037418 Bacteria 1906
161 Ga0395905_0009255 3300037471 Bacteria 9642
162 Ga0395905_0087069 3300037471 Bacteria 2928
163 Ga0395905_0241901 3300037471 Bacteria 1686
164 Ga0395905_0485893 3300037471 Bacteria 1134
165 Ga0395901_0027415 3300038443 Bacteria 5853
166 Ga0395901_0281955 3300038443 Bacteria 1726
167 Ga0400487_09666 3300039110 Bacteria 1169
168 Ga0439466_0002729 3300041411 Bacteria 6912
169 Ga0439432_064579 3300042006 Bacteria 1123
170 Ga0450890_005747 3300042127 Bacteria 1595
171 Ga0450905_014066 3300042142 Bacteria 1138
172 Ga0439459_0000966 3300042438 Bacteria 4077
173 Ga0451577_0008279 3300042876 Bacteria 10126
174 Ga0451577_0129423 3300042876 Bacteria 2264
175 Ga0451577_0269677 3300042876 Bacteria 1541
176 Ga0451577_0332893 3300042876 Bacteria 1377
177 Ga0451577_1191170 3300042876 Unclassified 680
178 Ga0453684_0003051 3300044712 Bacteria 38906
179 Ga0466960_0105960 3300044901 Bacteria 1454
180 Ga0451576_1125029 3300045051 Bacteria 821
181 Ga0495627_005662 3300046453 Bacteria 4992
182 Ga0495627_077413 3300046453 Bacteria 966
183 Ga0495638_0080269 3300046460 Bacteria 1982
184 Ga0495650_0002446 3300046471 Bacteria 15012
185 Ga0495607_0025737 3300046501 Bacteria 3657
186 Ga0495607_0164735 3300046501 Bacteria 1123
187 Ga0495606_0345733 3300046507 Bacteria 791
188 Ga0495632_0171761 3300046519 Bacteria 995
189 Ga0495643_0120098 3300046522 Bacteria 1328
190 Ga0495663_0003137 3300046525 Bacteria 4824
191 Ga0495663_0011672 3300046525 Bacteria 2444
192 Ga0495633_0044505 3300046558 Bacteria 2103
193 Ga0495649_0020211 3300046694 Bacteria 3736
194 Ga0495681_0045377 3300047470 Bacteria 2104
195 Ga0495681_0045635 3300047470 Bacteria 2095
196 Ga0495615_0040108 3300048090 Bacteria 1164
197 Ga0496102_0065976 3300048905 Bacteria 3318
198 Ga0496105_0151318 3300048908 Bacteria 1907
199 Ga0496108_0075488 3300048911 Bacteria 2848
200 Ga0496108_0107859 3300048911 Bacteria 2378
201 Ga0496109_0126552 3300048912 Bacteria 2382
202 Ga0496109_0409026 3300048912 Bacteria 1282
203 Ga0496111_0436541 3300048914 Bacteria 967
204 Ga0496112_0141329 3300048915 Bacteria 2376
205 Ga0496113_0026104 3300048916 Bacteria 4173
206 Ga0496116_0001160 3300048919 Bacteria 31071
207 Ga0496118_0117684 3300048921 Bacteria 1742
208 Ga0496124_0028330 3300048927 Bacteria 5012
209 Ga0495682_0008116 3300049460 Bacteria 4145
210 Ga0501032_0006498 3300049569 Bacteria 8597
211 Ga0501032_0039593 3300049569 Bacteria 3206
212 Ga0501034_0054310 3300049571 Bacteria 4033
213 Ga0501034_0099210 3300049571 Bacteria 2908
214 Ga0501034_0099576 3300049571 Bacteria 2901
215 Ga0501036_0141242 3300049572 Bacteria 2032
216 Ga0501038_0067522 3300049574 Bacteria 3042
217 Ga0501039_0437349 3300049575 Bacteria 1027
218 Ga0501043_0319029 3300049579 Bacteria 1185
219 Ga0501043_0648749 3300049579 Bacteria 775
220 Ga0501046_0078681 3300049580 Bacteria 2550
221 Ga0501047_0000446 3300049581 Bacteria 45717
222 Ga0501047_0057294 3300049581 Bacteria 3768
223 Ga0501047_0384420 3300049581 Bacteria 1238
224 Ga0501067_0000639 3300049583 Bacteria 18826
225 Ga0501068_0036950 3300049584 Bacteria 2923
226 Ga0501069_0040644 3300049585 Bacteria 2570
227 Ga0501070_0071574 3300049586 Bacteria 2870
228 Ga0501072_0012915 3300049588 Bacteria 6387
229 Ga0501073_0031075 3300049589 Bacteria 3811
230 Ga0501074_0003396 3300049590 Bacteria 11272
231 Ga0501249_036194 3300049679 Bacteria 1112
232 Ga0501079_0094593 3300049741 Bacteria 2315
233 Ga0501080_0000686 3300049742 Bacteria 27086
234 Ga0501083_0000225 3300049744 Bacteria 36374
235 Ga0501263_002046 3300049760 Bacteria 2005
236 Ga0501266_000070 3300049763 Bacteria 13981
237 Ga0501035_0315225 3300049822 Bacteria 1315
238 Ga0501035_0450932 3300049822 Bacteria 1064
239 Ga0501044_0023949 3300049823 Bacteria 6488
240 Ga0501044_0069479 3300049823 Bacteria 3585
241 Ga0501044_0140868 3300049823 Bacteria 2400
242 nmdc:mga0k408_172479_c1 3300050493 Bacteria 1289
243 nmdc:mga07m45_33297_c1 3300050496 Bacteria 2861
244 Ga0501084_0049716 3300054114 Bacteria 3509
245 2548497905 2547132374 Bacteria 5530232
246 2552746419 2551306352 Bacteria 3873115
247 2640736439 2639762793 Bacteria 3943681
248 2643788994 2643221554 Bacteria 6603920
249 2643868603 2643221570 Bacteria 5103772
250 2643990978 2643221596 Bacteria 5006805
251 2644031093 2643221603 Bacteria 6147767
252 2644213081 2643221638 Bacteria 6579467
253 2644295882 2643221652 Bacteria 5140275
254 2644649530 2643221717 Bacteria 5676132
255 2678229666 2675903507 Bacteria 3737791
256 2774391359 2773857761 Bacteria 3837365
257 2774436093 2773857770 Bacteria 3911866
258 2808904685 2808606373 Bacteria 4423627
259 2858692243 2858688981 Bacteria 8184122
260 2881105050 2881101125 Bacteria 4590519
261 2886850412 2886848708 Bacteria 5632523
262 2919185236 2919182534 Bacteria 3907101
263 2990200261 2990196909 Bacteria 4054280
264 2990711498 2990710928 Bacteria 5002431
265 8011353982 8011350971 Bacteria 6158957
266 Ga0209257_1096339
267 JGI25158J39367_1000788
268 JGI25152J39213_1000567
269 JGI25152J39213_1011781
270 JGI25150J39212_1000411
271 JGI25150J39212_1002976
272 JGI25159J45721_1015887
273 JGI25153J46596_10013727
274 rootH1_10014665
275 rootH2_10102231
276 rootL2_10000123
277 rootL2_10018294
278 rootH1_10169853
279 JGI25160J50197_1002160
280 JGI25161J50226_1008209
281 JGI25161J50226_1008250
282 Ga0055526_1006069
283 Ga0055526_1031573
284 Ga0055526_1068586
285 Ga0055537_1008020
286 Ga0055537_1017090
287 Ga0055524_1000318
288 Ga0055524_1000652
289 Ga0055524_1002375
290 Ga0055524_1039813
291 Ga0055528_1011814
292 Ga0055530_10006725
293 Ga0055530_10007348
294 Ga0055530_10027795
295 Ga0055540_1040282
296 Ga0055531_10001129
297 Ga0055531_10008693
298 Ga0055531_10011490
299 Ga0058692_1000067
300 Ga0055543_1000391
301 Ga0055543_1021229
302 Ga0065165_1022078
303 Ga0065703_1000507
304 Ga0068869_100576953
305 Ga0070669_100007800
306 Ga0070671_100067243
307 Ga0070673_100018592
308 Ga0070688_100015126
309 Ga0070659_101250771
310 Ga0070678_100457255
311 Ga0070685_10000566
312 Ga0070679_100044475
313 Ga0068853_100112091
314 Ga0070693_100043379
315 Ga0070665_100004663
316 Ga0070665_100010864
317 Ga0070665_100135128
318 Ga0068852_100382572
319 Ga0068859_100036835
320 Ga0068864_100128012
321 Ga0068863_100013354
322 Ga0068860_100003003
323 Ga0068862_100422519
324 Ga0075362_10113043
325 Ga0075366_10023228
326 Ga0075366_10361022
327 Ga0097621_100393662
328 Ga0075370_10019645
329 Ga0097620_100036835
330 Ga0105251_10046271
331 Ga0105244_10014301
332 Ga0105244_10088740
333 Ga0105244_10088837
334 Ga0105250_10139301
335 Ga0105240_10026186
336 Ga0105247_10004673
337 Ga0105243_10000263
338 Ga0105248_10014679
339 Ga0105237_10540043
340 Ga0105238_10453620
341 Ga0157319_1000004
342 Ga0157371_10041782
343 Ga0157370_10436615
344 Ga0157370_10564841
345 Ga0157372_10054182
346 Ga0157379_10189220
347 Ga0157376_10405611
348 Ga0163161_10012349
349 Ga0209436_100246
350 Ga0207425_1000013
351 Ga0207425_1001515
352 Ga0209129_1000152
353 Ga0209129_1007631
354 Ga0209565_1000443
355 Ga0209565_1001844
356 Ga0209565_1002631
357 Ga0209565_1003871
358 Ga0209565_1003909
359 Ga0209565_1005650
360 Ga0209673_1010829
361 Ga0209130_1000652
362 Ga0209130_1001871
363 Ga0209675_1001155
364 Ga0209675_1026248
365 Ga0209564_1002169
366 Ga0209564_1006564
367 Ga0209758_1000031
368 Ga0209050_1000525
369 Ga0209050_1005478
370 Ga0209256_1000085
371 Ga0209256_1000414
372 Ga0209256_1001153
373 Ga0209256_1009869
374 Ga0207426_1001966
375 Ga0209051_1005967
376 Ga0209257_1000157
377 Ga0209257_1000612
378 Ga0209257_1007823
379 Ga0207696_1014948
380 Ga0207696_1020638
381 Ga0207696_1066897
382 Ga0207655_1014210
383 Ga0207655_1014306
384 Ga0207655_1018711
385 Ga0207713_1001489
386 Ga0207713_1029929
387 Ga0207710_10000455
388 Ga0207710_10002212
389 Ga0207660_10227129
390 Ga0207681_10000495
391 Ga0207644_10032179
392 Ga0207709_10000158
393 Ga0207711_10045730
394 Ga0207651_10011322
395 Ga0207702_10521242
396 Ga0207641_10006368
397 Ga0207698_10291935
398 Ga0209371_1000196
399 Ga0209974_10021323
400 Ga0268266_10003943
401 Ga0268266_10007323
402 Ga0268265_10405607
403 Ga0268264_10001628
404 Ga0268256_1000158
405 Ga0265327_10000147
406 Ga0307408_100000102
407 Ga0307408_100000861
408 Ga0307408_100005671
409 Ga0307408_100006223
410 Ga0307408_100012700
411 Ga0307408_100046871
412 Ga0307408_100152143
413 Ga0307516_10057380
414 Ga0307413_10391474
415 Ga0307406_10001224
416 Ga0307406_10305795
417 Ga0307412_10118699
418 Ga0307412_10811306
419 Ga0307416_100003550
420 Ga0307411_10283751
421 Ga0307411_10283937
422 Ga0373937_0121307
423 Ga0395899_0006427
424 Ga0395899_0021613
425 Ga0395900_0221540
426 Ga0395905_0009255
427 Ga0395905_0087069
428 Ga0395905_0241901
429 Ga0395905_0485893
430 Ga0395901_0027415
431 Ga0395901_0281955
432 Ga0400487_09666
433 Ga0439466_0002729
434 Ga0439432_064579
435 Ga0450890_005747
436 Ga0450905_014066
437 Ga0439459_0000966
438 Ga0451577_0008279
439 Ga0451577_0129423
440 Ga0451577_0269677
441 Ga0451577_0332893
442 Ga0451577_1191170
443 Ga0453684_0003051
444 Ga0466960_0105960
445 Ga0451576_1125029
446 Ga0495627_005662
447 Ga0495627_077413
448 Ga0495638_0080269
449 Ga0495650_0002446
450 Ga0495607_0025737
451 Ga0495607_0164735
452 Ga0495606_0345733
453 Ga0495632_0171761
454 Ga0495643_0120098
455 Ga0495663_0003137
456 Ga0495663_0011672
457 Ga0495633_0044505
458 Ga0495649_0020211
459 Ga0495681_0045377
460 Ga0495681_0045635
461 Ga0495615_0040108
462 Ga0496102_0065976
463 Ga0496105_0151318
464 Ga0496108_0075488
465 Ga0496108_0107859
466 Ga0496109_0126552
467 Ga0496109_0409026
468 Ga0496111_0436541
469 Ga0496112_0141329
470 Ga0496113_0026104
471 Ga0496116_0001160
472 Ga0496118_0117684
473 Ga0496124_0028330
474 Ga0495682_0008116
475 Ga0501032_0006498
476 Ga0501032_0039593
477 Ga0501034_0054310
478 Ga0501034_0099210
479 Ga0501034_0099576
480 Ga0501036_0141242
481 Ga0501038_0067522
482 Ga0501039_0437349
483 Ga0501043_0319029
484 Ga0501043_0648749
485 Ga0501046_0078681
486 Ga0501047_0000446
487 Ga0501047_0057294
488 Ga0501047_0384420
489 Ga0501067_0000639
490 Ga0501068_0036950
491 Ga0501069_0040644
492 Ga0501070_0071574
493 Ga0501072_0012915
494 Ga0501073_0031075
495 Ga0501074_0003396
496 Ga0501249_036194
497 Ga0501079_0094593
498 Ga0501080_0000686
499 Ga0501083_0000225
500 Ga0501263_002046
501 Ga0501266_000070
502 Ga0501035_0315225
503 Ga0501035_0450932
504 Ga0501044_0023949
505 Ga0501044_0069479
506 Ga0501044_0140868
507 nmdc:mga0k408_172479_c1
508 nmdc:mga07m45_33297_c1
509 Ga0501084_0049716
510 2548497905
511 2552746419
512 2640736439
513 2643788994
514 2643868603
515 2643990978
516 2644031093
517 2644213081
518 2644295882
519 2644649530
520 2678229666
521 2774391359
522 2774436093
523 2808904685
524 2858692243
525 2881105050
526 2886850412
527 2919185236
528 2990200261
529 2990711498
530 8011353982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12724

Flavodoxin_5

Flavodoxin domain

5

124

0.81

PF03358

FMN_red

NADPH-dependent FMN reductase

9

134

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7n-assembly1.cif.gz_A the crystal structure of the flavodoxin, wrba-like protein from agrobacterium tumefaciens 0.8849 1 185
5wid-assembly2.cif.gz_B structure of a flavodoxin from the domain archaea 0.8803 3 182
3d7n-assembly1.cif.gz_A the crystal structure of the flavodoxin, wrba-like protein from agrobacterium tumefaciens 0.8795 1 185
2ark-assembly2.cif.gz_E structure of a flavodoxin from aquifex aeolicus 0.8753 1 181
2a5l-assembly1.cif.gz_A the crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa 0.875 1 184
ID Description Score Start End Superfamily
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8741 1 181 3.40.50.360
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8686 1 184 3.40.50.360
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8632 1 181 3.40.50.360
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8539 1 184 3.40.50.360
af_K7MW35_1_136_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8537 12 123 3.40.50.360
ID Description Score Start End GO Terms
AF-Q46X69-F1-model_v4 Flavoprotein WrbA 0.9925 1 185 GO:0003955
GO:0009055
GO:0010181
GO:0016020
AF-I8I5S6-F1-model_v4 NADPH-dependent FMN reductase 0.992 1 184 GO:0003955
GO:0009055
GO:0010181
GO:0016020
AF-A0A833KNR6-F1-model_v4 deleted 0.9914 1 175
AF-Q46X69-F1-model_v4 Flavoprotein WrbA 0.9872 1 185 GO:0003955
GO:0009055
GO:0010181
GO:0016020
AF-N9ETE1-F1-model_v4 deleted 0.9841 1 121

Map