F373418

General Info

Members Datasets Scaffolds Average Seq Length
265 176 530 150

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000110|Ga0265327_1000011017
Length 179
Sequence LTGRPKGAAETGPGGGAGGDSIPAGATDVYGPDKRSAVMRRVKGKDTGPEMAVRRLLTGLGARYRLHRADLPGKPDIVLPGRRLAVFVHGCFWHGHDCARGARVPKANRDYWTAKVARNRARDEATRAALQAAGWRVETVWECELKDADALKARAKGWLAQSLPLAVRVRRQGGGGERG

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
147 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
152 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
153 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
154 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
155 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
160 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
161 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
166 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
167 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
168 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
169 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
170 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
171 2643221584 Caulobacter sp. Root656 Isolate Unclassified
172 2643221640 Caulobacter sp. Root342 Isolate Unclassified
173 2643221642 Caulobacter sp. Root343 Isolate Unclassified
174 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
175 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
176 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.87
Nodule 0
Rhizoplane 3.02
Rhizosphere 66.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10000110 3300031251 Bacteria 181251
2 rootL2_10230060 3300003322 Bacteria 1258
3 Ga0055537_1032817 3300003773 Bacteria 657
4 Ga0055536_1000948 3300003781 Bacteria 18586
5 Ga0055528_1009040 3300003790 Bacteria 4200
6 Ga0055530_10001447 3300003791 Bacteria 17355
7 Ga0055530_10005529 3300003791 Bacteria 5967
8 Ga0055540_1052103 3300003792 Bacteria 841
9 Ga0055531_10001318 3300003794 Bacteria 18618
10 Ga0055531_10001786 3300003794 Bacteria 15286
11 Ga0065165_1000711 3300005262 Bacteria 47122
12 Ga0070658_10086735 3300005327 Bacteria 2575
13 Ga0070658_10186217 3300005327 Bacteria 1748
14 Ga0070680_100001074 3300005336 Bacteria 19621
15 Ga0070680_100049223 3300005336 Bacteria 3435
16 Ga0070660_100095284 3300005339 Bacteria 2352
17 Ga0070660_101152076 3300005339 Bacteria 657
18 Ga0070691_10118884 3300005341 Bacteria 1329
19 Ga0070661_100611812 3300005344 Bacteria 882
20 Ga0070668_100000675 3300005347 Bacteria 23180
21 Ga0070668_100006190 3300005347 Bacteria 8863
22 Ga0070659_100000158 3300005366 Bacteria 51870
23 Ga0070659_100007641 3300005366 Bacteria 7859
24 Ga0070667_100000917 3300005367 Bacteria 27218
25 Ga0070667_100016680 3300005367 Bacteria 6079
26 Ga0070663_100946959 3300005455 Bacteria 746
27 Ga0070681_10011447 3300005458 Bacteria 8780
28 Ga0070681_10151063 3300005458 Bacteria 2249
29 Ga0070679_100164532 3300005530 Bacteria 2192
30 Ga0070679_100223457 3300005530 Bacteria 1844
31 Ga0068853_100416975 3300005539 Bacteria 1258
32 Ga0070665_100000732 3300005548 Bacteria 43745
33 Ga0070665_100003164 3300005548 Bacteria 17712
34 Ga0070665_100443190 3300005548 Bacteria 1308
35 Ga0070665_101143184 3300005548 Bacteria 790
36 Ga0068855_100187927 3300005563 Bacteria 2332
37 Ga0068855_100408705 3300005563 Bacteria 1486
38 Ga0070664_100011307 3300005564 Bacteria 7241
39 Ga0068859_100104203 3300005617 Bacteria 2896
40 Ga0068864_100000131 3300005618 Bacteria 72744
41 Ga0068863_100000266 3300005841 Bacteria 54663
42 Ga0068858_100004555 3300005842 Bacteria 13573
43 Ga0068860_100000136 3300005843 Bacteria 120083
44 Ga0068862_100000573 3300005844 Bacteria 38295
45 Ga0068862_100048683 3300005844 Bacteria 3619
46 Ga0075369_10001640 3300006186 Bacteria 7713
47 Ga0075366_10023345 3300006195 Bacteria 3603
48 Ga0075366_10208647 3300006195 Bacteria 1189
49 Ga0075370_10156278 3300006353 Bacteria 1337
50 Ga0075370_10160107 3300006353 Bacteria 1321
51 Ga0068865_100016172 3300006881 Bacteria 4768
52 Ga0097620_100104201 3300006931 Bacteria 2896
53 Ga0105240_10948201 3300009093 Bacteria 923
54 Ga0105248_10079531 3300009177 Bacteria 3685
55 Ga0105248_10088974 3300009177 Bacteria 3476
56 Ga0105248_11477201 3300009177 Bacteria 769
57 Ga0105238_10496245 3300009551 Bacteria 1221
58 Ga0105238_10884338 3300009551 Bacteria 911
59 Ga0105249_10256785 3300009553 Bacteria 1735
60 Ga0105239_10703606 3300010375 Bacteria 1155
61 Ga0157373_10000590 3300013100 Bacteria 28279
62 Ga0157373_10007443 3300013100 Bacteria 8145
63 Ga0157370_10714354 3300013104 Bacteria 914
64 Ga0157369_10324025 3300013105 Bacteria 1601
65 Ga0157372_11058204 3300013307 Bacteria 939
66 Ga0163163_10636233 3300014325 Bacteria 1130
67 Ga0157379_10035325 3300014968 Bacteria 4456
68 Ga0213876_10000391 3300021384 Bacteria 36827
69 Ga0213875_10267075 3300021388 Bacteria 807
70 Ga0209565_1000149 3300025263 Bacteria 96195
71 Ga0209673_1000932 3300025273 Bacteria 36724
72 Ga0209676_1000272 3300025292 Bacteria 107765
73 Ga0209676_1000373 3300025292 Bacteria 83050
74 Ga0209564_1018992 3300025295 Bacteria 2590
75 Ga0209758_1000967 3300025297 Bacteria 38765
76 Ga0209050_1000344 3300025298 Bacteria 92033
77 Ga0209050_1000387 3300025298 Bacteria 83122
78 Ga0209256_1002622 3300025299 Bacteria 14210
79 Ga0209256_1019682 3300025299 Bacteria 2138
80 Ga0209051_1011327 3300025303 Bacteria 4410
81 Ga0209257_1000272 3300025304 Bacteria 118294
82 Ga0209257_1000769 3300025304 Bacteria 47756
83 Ga0209257_1001003 3300025304 Bacteria 38243
84 Ga0209257_1002699 3300025304 Bacteria 16931
85 Ga0207680_10173784 3300025903 Bacteria 1452
86 Ga0207705_10003550 3300025909 Bacteria 11875
87 Ga0207705_10166009 3300025909 Bacteria 1660
88 Ga0207707_10070516 3300025912 Bacteria 3045
89 Ga0207695_10003252 3300025913 Bacteria 23096
90 Ga0207695_10006079 3300025913 Bacteria 15750
91 Ga0207660_10000832 3300025917 Bacteria 20361
92 Ga0207657_10001914 3300025919 Bacteria 22475
93 Ga0207657_10400539 3300025919 Bacteria 1079
94 Ga0207649_10146613 3300025920 Bacteria 1621
95 Ga0207652_10045156 3300025921 Bacteria 3755
96 Ga0207652_10266080 3300025921 Bacteria 1546
97 Ga0207652_10734795 3300025921 Bacteria 879
98 Ga0207694_10243474 3300025924 Bacteria 1470
99 Ga0207694_10369861 3300025924 Bacteria 1189
100 Ga0207650_10000016 3300025925 Bacteria 361958
101 Ga0207690_10019218 3300025932 Bacteria 4202
102 Ga0207706_10453439 3300025933 Bacteria 1109
103 Ga0207704_10002959 3300025938 Bacteria 7670
104 Ga0207711_10045837 3300025941 Bacteria 3736
105 Ga0207711_10137793 3300025941 Bacteria 2193
106 Ga0207711_10927889 3300025941 Bacteria 809
107 Ga0207679_10006645 3300025945 Bacteria 7319
108 Ga0207667_10016460 3300025949 Bacteria 8356
109 Ga0207667_10298067 3300025949 Bacteria 1647
110 Ga0207667_11760053 3300025949 Bacteria 585
111 Ga0207712_10001245 3300025961 Bacteria 17578
112 Ga0207712_10275713 3300025961 Bacteria 1370
113 Ga0207668_10000042 3300025972 Bacteria 103877
114 Ga0207668_10030999 3300025972 Bacteria 3517
115 Ga0207658_10000326 3300025986 Bacteria 48082
116 Ga0207658_10041530 3300025986 Bacteria 3331
117 Ga0207703_10003623 3300026035 Bacteria 12889
118 Ga0207639_10501109 3300026041 Bacteria 1109
119 Ga0207678_10436074 3300026067 Bacteria 1137
120 Ga0207678_10715458 3300026067 Bacteria 882
121 Ga0207702_10839172 3300026078 Bacteria 909
122 Ga0207641_10000996 3300026088 Bacteria 28985
123 Ga0207676_10000055 3300026095 Bacteria 124678
124 Ga0209970_1009129 3300027614 Bacteria 1622
125 Ga0209983_1004034 3300027665 Bacteria 3101
126 Ga0268266_10001959 3300028379 Bacteria 23104
127 Ga0268266_10006340 3300028379 Bacteria 10845
128 Ga0268266_10172644 3300028379 Bacteria 1963
129 Ga0268266_10765313 3300028379 Bacteria 932
130 Ga0268265_10001487 3300028380 Bacteria 19628
131 Ga0268264_10000113 3300028381 Bacteria 203262
132 Ga0268264_10000265 3300028381 Bacteria 92655
133 Ga0307517_10268213 3300028786 Bacteria 984
134 Ga0307515_10159281 3300028794 Bacteria 2312
135 Ga0307511_10007230 3300030521 Bacteria 11187
136 Ga0265327_10002818 3300031251 Bacteria 17555
137 Ga0265327_10005394 3300031251 Bacteria 10687
138 Ga0265327_10296746 3300031251 Bacteria 712
139 Ga0265314_10103725 3300031711 Bacteria 1822
140 Ga0307516_10000006 3300031730 Bacteria 298586
141 Ga0307414_10172433 3300032004 Bacteria 1731
142 Ga0373925_1239310 3300037068 Bacteria 613
143 Ga0395899_0191376 3300037312 Bacteria 1431
144 Ga0395900_0323207 3300037418 Bacteria 1523
145 Ga0395900_0471064 3300037418 Bacteria 1209
146 Ga0395900_0563190 3300037418 Bacteria 1083
147 Ga0395898_0072140 3300037466 Bacteria 3336
148 Ga0395898_0189288 3300037466 Bacteria 1966
149 Ga0395898_0257365 3300037466 Bacteria 1664
150 Ga0436364_0175718 3300037853 Bacteria 655
151 Ga0436364_0556003 3300037853 Bacteria 1047
152 Ga0436364_1189272 3300037853 Bacteria 1073
153 Ga0395901_0224918 3300038443 Bacteria 1961
154 Ga0395901_0687701 3300038443 Bacteria 1022
155 Ga0395901_0720131 3300038443 Bacteria 993
156 Ga0436365_0439594 3300039437 Bacteria 58263
157 Ga0436361_1011154 3300039447 Bacteria 11130
158 Ga0451851_0783616 3300041507 Bacteria 682
159 Ga0466966_0633346 3300044684 Bacteria 644
160 Ga0466971_0708537 3300044719 Bacteria 506
161 Ga0466959_0066544 3300045049 Bacteria 2614
162 Ga0495638_0000768 3300046460 Bacteria 34065
163 Ga0495638_0001642 3300046460 Bacteria 19845
164 Ga0495638_0003376 3300046460 Bacteria 12591
165 Ga0495650_0021211 3300046471 Bacteria 3147
166 Ga0495585_0481598 3300046492 Bacteria 591
167 Ga0495583_0000003 3300046506 Bacteria 709273
168 Ga0495606_0040536 3300046507 Bacteria 3130
169 Ga0495606_0145188 3300046507 Bacteria 1398
170 Ga0495610_0000633 3300046512 Bacteria 34507
171 Ga0495610_0043025 3300046512 Bacteria 2253
172 Ga0495616_0001195 3300046513 Bacteria 18312
173 Ga0495616_0058750 3300046513 Bacteria 1893
174 Ga0495620_0009038 3300046515 Bacteria 5320
175 Ga0495631_0005954 3300046518 Bacteria 6343
176 Ga0495632_0046859 3300046519 Bacteria 2146
177 Ga0495637_0006783 3300046520 Bacteria 5732
178 Ga0495637_0023775 3300046520 Bacteria 2777
179 Ga0495643_0315719 3300046522 Bacteria 708
180 Ga0495643_0430373 3300046522 Bacteria 577
181 Ga0495644_0084341 3300046523 Bacteria 1198
182 Ga0495648_0073972 3300046524 Bacteria 1965
183 Ga0495648_0112586 3300046524 Bacteria 1478
184 Ga0495648_0406078 3300046524 Bacteria 607
185 Ga0495654_0000039 3300046530 Bacteria 185363
186 Ga0495597_0024182 3300046542 Bacteria 2805
187 Ga0495597_0080352 3300046542 Bacteria 1395
188 Ga0495668_0000250 3300046616 Bacteria 76436
189 Ga0495668_0004075 3300046616 Bacteria 10600
190 Ga0495668_0012701 3300046616 Bacteria 4989
191 Ga0495668_0053234 3300046616 Bacteria 2238
192 Ga0495625_0025167 3300046660 Bacteria 4517
193 Ga0495625_0178966 3300046660 Bacteria 1411
194 Ga0495625_0420250 3300046660 Bacteria 831
195 Ga0495625_0445734 3300046660 Bacteria 801
196 Ga0495599_0243597 3300046678 Bacteria 1096
197 Ga0495669_0135818 3300046684 Bacteria 1159
198 Ga0495670_0576829 3300046691 Bacteria 612
199 Ga0495671_0110419 3300046692 Bacteria 1343
200 Ga0495589_0090796 3300046794 Bacteria 1483
201 Ga0495660_0013081 3300046810 Bacteria 4809
202 Ga0495660_0154154 3300046810 Bacteria 1132
203 Ga0495660_0278935 3300046810 Bacteria 765
204 Ga0495683_0124698 3300047323 Bacteria 1219
205 Ga0495686_0001569 3300047472 Bacteria 24295
206 Ga0495686_0012170 3300047472 Bacteria 6033
207 Ga0495686_0028938 3300047472 Bacteria 3606
208 Ga0495686_0160178 3300047472 Bacteria 1315
209 Ga0496103_0028636 3300048906 Bacteria 3382
210 Ga0496106_0007556 3300048909 Bacteria 8041
211 Ga0496106_0268747 3300048909 Bacteria 1365
212 Ga0496106_1157941 3300048909 Bacteria 604
213 Ga0496107_0000323 3300048910 Bacteria 25872
214 Ga0496107_0361165 3300048910 Bacteria 1081
215 Ga0496115_0548776 3300048918 Bacteria 924
216 Ga0496115_0808831 3300048918 Bacteria 729
217 Ga0496116_0036791 3300048919 Bacteria 3421
218 Ga0496117_0024880 3300048920 Bacteria 4719
219 Ga0496118_0002092 3300048921 Bacteria 28049
220 Ga0496121_0000042 3300048924 Bacteria 342304
221 Ga0496121_0006043 3300048924 Bacteria 15246
222 Ga0496121_0410811 3300048924 Bacteria 884
223 Ga0496124_0007826 3300048927 Bacteria 11281
224 Ga0496124_0817155 3300048927 Bacteria 575
225 Ga0496125_0114439 3300048928 Bacteria 1943
226 Ga0496126_0002112 3300048929 Bacteria 27831
227 Ga0496126_0797203 3300048929 Bacteria 725
228 Ga0495678_000532 3300049459 Bacteria 36945
229 Ga0495678_267804 3300049459 Bacteria 503
230 Ga0501034_0614106 3300049571 Bacteria 992
231 Ga0501043_0327606 3300049579 Bacteria 1167
232 Ga0501238_006647 3300049671 Bacteria 1492
233 Ga0501241_073565 3300049758 Bacteria 702
234 Ga0501035_1207833 3300049822 Bacteria 586
235 nmdc:mga0k408_103223_c1 3300050493 Bacteria 1682
236 nmdc:mga0k408_20127_c1 3300050493 Bacteria 3734
237 nmdc:mga0sz30_3604_c1 3300050516 Bacteria 5585
238 Ga0500643_007386 3300053087 Bacteria 4441
239 Ga0500644_0000194 3300053088 Bacteria 37615
240 Ga0500646_0086203 3300053090 Bacteria 966
241 Ga0500554_001561 3300053102 Bacteria 4417
242 Ga0500555_015890 3300053103 Bacteria 2169
243 Ga0500562_002955 3300053108 Bacteria 4242
244 Ga0500594_0000102 3300053118 Bacteria 25131
245 Ga0500595_027176 3300053119 Bacteria 1963
246 Ga0500608_000018 3300053122 Bacteria 76628
247 Ga0500608_232335 3300053122 Bacteria 735
248 Ga0500614_008076 3300053123 Bacteria 2228
249 Ga0500658_0011516 3300053134 Bacteria 3259
250 Ga0500559_0004432 3300053136 Bacteria 6669
251 Ga0500564_000391 3300053138 Bacteria 12546
252 Ga0500622_0002293 3300053156 Bacteria 14014
253 Ga0500622_0006920 3300053156 Bacteria 6500
254 Ga0500627_0145756 3300053158 Bacteria 1069
255 Ga0500609_000089 3300053731 Bacteria 11891
256 2585196845 2582581293 Bacteria 5907401
257 2587915692 2585428106 Bacteria 5179711
258 2643748894 2643221545 Bacteria 5083237
259 2643783051 2643221552 Bacteria 5708754
260 2643930339 2643221584 Bacteria 5511711
261 2644223242 2643221640 Bacteria 5258820
262 2644236488 2643221642 Bacteria 5357871
263 2644509347 2643221691 Bacteria 5093099
264 2857505619 2857504554 Bacteria 5369913
265 2884965644 2884960567 Bacteria 5437054
266 Ga0265327_10000110
267 rootL2_10230060
268 Ga0055537_1032817
269 Ga0055536_1000948
270 Ga0055528_1009040
271 Ga0055530_10001447
272 Ga0055530_10005529
273 Ga0055540_1052103
274 Ga0055531_10001318
275 Ga0055531_10001786
276 Ga0065165_1000711
277 Ga0070658_10086735
278 Ga0070658_10186217
279 Ga0070680_100001074
280 Ga0070680_100049223
281 Ga0070660_100095284
282 Ga0070660_101152076
283 Ga0070691_10118884
284 Ga0070661_100611812
285 Ga0070668_100000675
286 Ga0070668_100006190
287 Ga0070659_100000158
288 Ga0070659_100007641
289 Ga0070667_100000917
290 Ga0070667_100016680
291 Ga0070663_100946959
292 Ga0070681_10011447
293 Ga0070681_10151063
294 Ga0070679_100164532
295 Ga0070679_100223457
296 Ga0068853_100416975
297 Ga0070665_100000732
298 Ga0070665_100003164
299 Ga0070665_100443190
300 Ga0070665_101143184
301 Ga0068855_100187927
302 Ga0068855_100408705
303 Ga0070664_100011307
304 Ga0068859_100104203
305 Ga0068864_100000131
306 Ga0068863_100000266
307 Ga0068858_100004555
308 Ga0068860_100000136
309 Ga0068862_100000573
310 Ga0068862_100048683
311 Ga0075369_10001640
312 Ga0075366_10023345
313 Ga0075366_10208647
314 Ga0075370_10156278
315 Ga0075370_10160107
316 Ga0068865_100016172
317 Ga0097620_100104201
318 Ga0105240_10948201
319 Ga0105248_10079531
320 Ga0105248_10088974
321 Ga0105248_11477201
322 Ga0105238_10496245
323 Ga0105238_10884338
324 Ga0105249_10256785
325 Ga0105239_10703606
326 Ga0157373_10000590
327 Ga0157373_10007443
328 Ga0157370_10714354
329 Ga0157369_10324025
330 Ga0157372_11058204
331 Ga0163163_10636233
332 Ga0157379_10035325
333 Ga0213876_10000391
334 Ga0213875_10267075
335 Ga0209565_1000149
336 Ga0209673_1000932
337 Ga0209676_1000272
338 Ga0209676_1000373
339 Ga0209564_1018992
340 Ga0209758_1000967
341 Ga0209050_1000344
342 Ga0209050_1000387
343 Ga0209256_1002622
344 Ga0209256_1019682
345 Ga0209051_1011327
346 Ga0209257_1000272
347 Ga0209257_1000769
348 Ga0209257_1001003
349 Ga0209257_1002699
350 Ga0207680_10173784
351 Ga0207705_10003550
352 Ga0207705_10166009
353 Ga0207707_10070516
354 Ga0207695_10003252
355 Ga0207695_10006079
356 Ga0207660_10000832
357 Ga0207657_10001914
358 Ga0207657_10400539
359 Ga0207649_10146613
360 Ga0207652_10045156
361 Ga0207652_10266080
362 Ga0207652_10734795
363 Ga0207694_10243474
364 Ga0207694_10369861
365 Ga0207650_10000016
366 Ga0207690_10019218
367 Ga0207706_10453439
368 Ga0207704_10002959
369 Ga0207711_10045837
370 Ga0207711_10137793
371 Ga0207711_10927889
372 Ga0207679_10006645
373 Ga0207667_10016460
374 Ga0207667_10298067
375 Ga0207667_11760053
376 Ga0207712_10001245
377 Ga0207712_10275713
378 Ga0207668_10000042
379 Ga0207668_10030999
380 Ga0207658_10000326
381 Ga0207658_10041530
382 Ga0207703_10003623
383 Ga0207639_10501109
384 Ga0207678_10436074
385 Ga0207678_10715458
386 Ga0207702_10839172
387 Ga0207641_10000996
388 Ga0207676_10000055
389 Ga0209970_1009129
390 Ga0209983_1004034
391 Ga0268266_10001959
392 Ga0268266_10006340
393 Ga0268266_10172644
394 Ga0268266_10765313
395 Ga0268265_10001487
396 Ga0268264_10000113
397 Ga0268264_10000265
398 Ga0307517_10268213
399 Ga0307515_10159281
400 Ga0307511_10007230
401 Ga0265327_10002818
402 Ga0265327_10005394
403 Ga0265327_10296746
404 Ga0265314_10103725
405 Ga0307516_10000006
406 Ga0307414_10172433
407 Ga0373925_1239310
408 Ga0395899_0191376
409 Ga0395900_0323207
410 Ga0395900_0471064
411 Ga0395900_0563190
412 Ga0395898_0072140
413 Ga0395898_0189288
414 Ga0395898_0257365
415 Ga0436364_0175718
416 Ga0436364_0556003
417 Ga0436364_1189272
418 Ga0395901_0224918
419 Ga0395901_0687701
420 Ga0395901_0720131
421 Ga0436365_0439594
422 Ga0436361_1011154
423 Ga0451851_0783616
424 Ga0466966_0633346
425 Ga0466971_0708537
426 Ga0466959_0066544
427 Ga0495638_0000768
428 Ga0495638_0001642
429 Ga0495638_0003376
430 Ga0495650_0021211
431 Ga0495585_0481598
432 Ga0495583_0000003
433 Ga0495606_0040536
434 Ga0495606_0145188
435 Ga0495610_0000633
436 Ga0495610_0043025
437 Ga0495616_0001195
438 Ga0495616_0058750
439 Ga0495620_0009038
440 Ga0495631_0005954
441 Ga0495632_0046859
442 Ga0495637_0006783
443 Ga0495637_0023775
444 Ga0495643_0315719
445 Ga0495643_0430373
446 Ga0495644_0084341
447 Ga0495648_0073972
448 Ga0495648_0112586
449 Ga0495648_0406078
450 Ga0495654_0000039
451 Ga0495597_0024182
452 Ga0495597_0080352
453 Ga0495668_0000250
454 Ga0495668_0004075
455 Ga0495668_0012701
456 Ga0495668_0053234
457 Ga0495625_0025167
458 Ga0495625_0178966
459 Ga0495625_0420250
460 Ga0495625_0445734
461 Ga0495599_0243597
462 Ga0495669_0135818
463 Ga0495670_0576829
464 Ga0495671_0110419
465 Ga0495589_0090796
466 Ga0495660_0013081
467 Ga0495660_0154154
468 Ga0495660_0278935
469 Ga0495683_0124698
470 Ga0495686_0001569
471 Ga0495686_0012170
472 Ga0495686_0028938
473 Ga0495686_0160178
474 Ga0496103_0028636
475 Ga0496106_0007556
476 Ga0496106_0268747
477 Ga0496106_1157941
478 Ga0496107_0000323
479 Ga0496107_0361165
480 Ga0496115_0548776
481 Ga0496115_0808831
482 Ga0496116_0036791
483 Ga0496117_0024880
484 Ga0496118_0002092
485 Ga0496121_0000042
486 Ga0496121_0006043
487 Ga0496121_0410811
488 Ga0496124_0007826
489 Ga0496124_0817155
490 Ga0496125_0114439
491 Ga0496126_0002112
492 Ga0496126_0797203
493 Ga0495678_000532
494 Ga0495678_267804
495 Ga0501034_0614106
496 Ga0501043_0327606
497 Ga0501238_006647
498 Ga0501241_073565
499 Ga0501035_1207833
500 nmdc:mga0k408_103223_c1
501 nmdc:mga0k408_20127_c1
502 nmdc:mga0sz30_3604_c1
503 Ga0500643_007386
504 Ga0500644_0000194
505 Ga0500646_0086203
506 Ga0500554_001561
507 Ga0500555_015890
508 Ga0500562_002955
509 Ga0500594_0000102
510 Ga0500595_027176
511 Ga0500608_000018
512 Ga0500608_232335
513 Ga0500614_008076
514 Ga0500658_0011516
515 Ga0500559_0004432
516 Ga0500564_000391
517 Ga0500622_0002293
518 Ga0500622_0006920
519 Ga0500627_0145756
520 Ga0500609_000089
521 2585196845
522 2587915692
523 2643748894
524 2643783051
525 2643930339
526 2644223242
527 2644236488
528 2644509347
529 2857505619
530 2884965644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03852

Vsr

DNA mismatch endonuclease Vsr

27

100

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vsr-assembly1.cif.gz_A very short patch repair (vsr) endonuclease from escherichia coli 0.9337 28 130
1cw0-assembly1.cif.gz_A crystal structure analysis of very short patch repair (vsr) endonuclease in complex with a duplex dna 0.8751 3 130
3r3p-assembly1.cif.gz_B homing endonuclease i-bth0305i catalytic domain 0.8539 24 137
3r3p-assembly1.cif.gz_B homing endonuclease i-bth0305i catalytic domain 0.8047 24 137
1cw0-assembly1.cif.gz_A crystal structure analysis of very short patch repair (vsr) endonuclease in complex with a duplex dna 0.7401 3 130
ID Description Score Start End Superfamily
1vsrA00 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.9337 28 130 3.40.960.10
1cw0A00 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.8751 3 130 3.40.960.10
3r3pA00 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.8425 22 131 3.40.960.10
af_P45736_13_113_3.40.960.10 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.7823 22 136 3.40.960.10
af_P9WLG5_163_267_3.40.960.10 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.7768 21 137 3.40.960.10
ID Description Score Start End GO Terms
AF-A0A258KMP2-F1-model_v4 Very short patch repair endonuclease 0.9936 33 141 GO:0004519
GO:0006298
AF-A0A3R9DB99-F1-model_v4 deleted 0.9856 17 134
AF-A0A528TLB3-F1-model_v4 DNA mismatch endonuclease Vsr 0.9853 22 130 GO:0004519
GO:0006298
AF-A0A318QHG7-F1-model_v4 Very short patch repair endonuclease 0.9852 53 134 GO:0004519
GO:0006298
AF-A0A1Y2K8N7-F1-model_v4 Putative DNA G:T-mismatch repair endonuclease 0.9851 33 134 GO:0004519
GO:0006298

Map