F373580

General Info

Members Datasets Scaffolds Average Seq Length
265 160 518 279

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0131802|Ga0496106_0131802_782_1678
Length 298
Sequence VTAVSLAAGSMSPKEKSMATRHGLTAVFGICTVGLGLTFAAPAEAGTVTVKGSDTMVVLGQRWAEEYMRKHPESTIQVTGGGSGTGISALINGTTDVCEASRAMKDAEKKQLAEKAGAQPIEIPVAKDGLSVYVNESNPLTELTMADLKAIFTGKITSWKELGGPDAKIIPYSRENSSGTYVFFKEHVLENADFTPRAQNMPGTAAVVNAVTKEKFAIGYGGAAYAKGIKVLKVKKAAGAPAIAPAAAAIKDGTYPLSRPLFFYTRAKPSAAIKAFTDWVLSPEGQAIVTKVGYFPLK

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.66
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0131802 3300048909 Bacteria 1961
2 rootH1_10012253 3300003323 Bacteria 10367
3 Ga0065712_10177966 3300005290 Bacteria 1208
4 Ga0070676_10003875 3300005328 Bacteria 7856
5 Ga0070683_100002183 3300005329 Bacteria 15476
6 Ga0070683_100024309 3300005329 Bacteria 5425
7 Ga0070690_100004509 3300005330 Bacteria 7743
8 Ga0070690_100093951 3300005330 Bacteria 1979
9 Ga0070690_100143116 3300005330 Bacteria 1624
10 Ga0070670_100046964 3300005331 Bacteria 3715
11 Ga0070666_10158781 3300005335 Bacteria 1580
12 Ga0070660_100073366 3300005339 Bacteria 2676
13 Ga0070689_100000008 3300005340 Bacteria 250116
14 Ga0070689_100054812 3300005340 Bacteria 3087
15 Ga0070691_10087884 3300005341 Bacteria 1529
16 Ga0070687_100026238 3300005343 Bacteria 2803
17 Ga0070692_10021147 3300005345 Bacteria 3163
18 Ga0070668_100160352 3300005347 Bacteria 1825
19 Ga0070674_100001726 3300005356 Bacteria 11839
20 Ga0070673_100001335 3300005364 Bacteria 14370
21 Ga0070673_100074712 3300005364 Bacteria 2732
22 Ga0070673_100187937 3300005364 Bacteria 1772
23 Ga0070673_100565635 3300005364 Unclassified 1034
24 Ga0070688_100055893 3300005365 Bacteria 2477
25 Ga0070667_100257108 3300005367 Bacteria 1563
26 Ga0070709_10629241 3300005434 Bacteria 829
27 Ga0070700_100002258 3300005441 Bacteria 9804
28 Ga0070662_100141717 3300005457 Bacteria 1864
29 Ga0068867_100079078 3300005459 Bacteria 2474
30 Ga0070685_10030281 3300005466 Bacteria 3014
31 Ga0070685_10401749 3300005466 Bacteria 949
32 Ga0070685_10532660 3300005466 Unclassified 836
33 Ga0070707_100016423 3300005468 Bacteria 6946
34 Ga0070698_100018950 3300005471 Bacteria 7239
35 Ga0070679_100077759 3300005530 Bacteria 3307
36 Ga0070684_100001361 3300005535 Bacteria 17528
37 Ga0070684_100001370 3300005535 Bacteria 17502
38 Ga0070684_100215986 3300005535 Bacteria 1749
39 Ga0070686_100003487 3300005544 Bacteria 8625
40 Ga0070686_100022074 3300005544 Bacteria 3788
41 Ga0068857_100211227 3300005577 Bacteria 1771
42 Ga0068856_100055444 3300005614 Bacteria 3911
43 Ga0070702_100046293 3300005615 Bacteria 2465
44 Ga0070702_100151686 3300005615 Bacteria 1488
45 Ga0068864_100193570 3300005618 Bacteria 1865
46 Ga0068866_10011296 3300005718 Bacteria 3859
47 Ga0068861_100012823 3300005719 Bacteria 5853
48 Ga0068863_100072943 3300005841 Bacteria 3247
49 Ga0068863_100185357 3300005841 Bacteria 1999
50 Ga0068858_100036503 3300005842 Bacteria 4557
51 Ga0068858_100319772 3300005842 Bacteria 1483
52 Ga0068862_100367922 3300005844 Bacteria 1337
53 Ga0068871_100170761 3300006358 Bacteria 1864
54 Ga0068865_100003234 3300006881 Bacteria 9760
55 Ga0075435_100045216 3300007076 Bacteria 3529
56 Ga0111539_10127275 3300009094 Bacteria 2984
57 Ga0105245_10471091 3300009098 Bacteria 1268
58 Ga0105243_10134798 3300009148 Bacteria 2100
59 Ga0105237_10079729 3300009545 Bacteria 3264
60 Ga0105238_10053651 3300009551 Bacteria 4050
61 Ga0105249_10206725 3300009553 Bacteria 1924
62 Ga0099796_10081481 3300010159 Bacteria 1187
63 Ga0157374_10198105 3300013296 Bacteria 1966
64 Ga0157378_10023024 3300013297 Bacteria 5483
65 Ga0163162_10199260 3300013306 Bacteria 2131
66 Ga0157375_10553169 3300013308 Bacteria 1312
67 Ga0157376_10282786 3300014969 Bacteria 1563
68 Ga0207666_1008727 3300025271 Bacteria 1358
69 Ga0207697_10018870 3300025315 Bacteria 2826
70 Ga0207642_10006069 3300025899 Bacteria 3993
71 Ga0207680_10456991 3300025903 Bacteria 907
72 Ga0207647_10247653 3300025904 Bacteria 1023
73 Ga0207645_10005401 3300025907 Bacteria 9269
74 Ga0207707_10501858 3300025912 Bacteria 1035
75 Ga0207671_10291201 3300025914 Bacteria 1289
76 Ga0207663_10209261 3300025916 Bacteria 1412
77 Ga0207662_10007550 3300025918 Bacteria 5922
78 Ga0207662_10038672 3300025918 Bacteria 2796
79 Ga0207652_10189760 3300025921 Bacteria 1848
80 Ga0207646_10021666 3300025922 Bacteria 5933
81 Ga0207681_10026666 3300025923 Bacteria 3729
82 Ga0207694_10100993 3300025924 Bacteria 2286
83 Ga0207650_10040026 3300025925 Bacteria 3428
84 Ga0207706_10213918 3300025933 Bacteria 1689
85 Ga0207670_10000003 3300025936 Bacteria 760449
86 Ga0207670_10123349 3300025936 Bacteria 1887
87 Ga0207669_10001841 3300025937 Bacteria 8987
88 Ga0207691_10017744 3300025940 Bacteria 6747
89 Ga0207691_10061407 3300025940 Bacteria 3414
90 Ga0207691_10157504 3300025940 Bacteria 1994
91 Ga0207689_10371761 3300025942 Bacteria 1190
92 Ga0207661_10005106 3300025944 Bacteria 9215
93 Ga0207661_10005740 3300025944 Bacteria 8754
94 Ga0207667_10125449 3300025949 Bacteria 2644
95 Ga0207667_10126520 3300025949 Bacteria 2632
96 Ga0207651_10002232 3300025960 Bacteria 9183
97 Ga0207712_10309413 3300025961 Bacteria 1300
98 Ga0207668_10025249 3300025972 Bacteria 3843
99 Ga0207658_10237052 3300025986 Bacteria 1543
100 Ga0207703_10138954 3300026035 Bacteria 2106
101 Ga0207639_10377035 3300026041 Bacteria 1273
102 Ga0207708_10001556 3300026075 Bacteria 17126
103 Ga0207702_10223974 3300026078 Bacteria 1754
104 Ga0207641_10061907 3300026088 Bacteria 3192
105 Ga0207648_10084536 3300026089 Bacteria 2768
106 Ga0207674_10147423 3300026116 Bacteria 2311
107 Ga0207675_100007303 3300026118 Bacteria 10445
108 Ga0209998_10012308 3300027717 Bacteria 1776
109 Ga0207428_10019523 3300027907 Bacteria 5777
110 Ga0268265_10383715 3300028380 Bacteria 1293
111 Ga0268264_10570516 3300028381 Bacteria 1112
112 Ga0265319_1046062 3300028563 Bacteria 1455
113 Ga0265318_10001560 3300028577 Bacteria 13311
114 Ga0265323_10013254 3300028653 Bacteria 3291
115 Ga0265323_10015183 3300028653 Bacteria 3032
116 Ga0265322_10012410 3300028654 Bacteria 2465
117 Ga0265330_10000457 3300031235 Bacteria 27235
118 Ga0265330_10002459 3300031235 Bacteria 10083
119 Ga0265330_10018115 3300031235 Bacteria 3237
120 Ga0265330_10031436 3300031235 Bacteria 2379
121 Ga0265332_10000274 3300031238 Bacteria 40638
122 Ga0265328_10007201 3300031239 Bacteria 4653
123 Ga0265328_10091338 3300031239 Bacteria 1125
124 Ga0265328_10097026 3300031239 Bacteria 1090
125 Ga0265320_10087569 3300031240 Bacteria 1446
126 Ga0265325_10001719 3300031241 Bacteria 15211
127 Ga0265325_10009310 3300031241 Bacteria 5739
128 Ga0265325_10168433 3300031241 Bacteria 1027
129 Ga0265329_10000416 3300031242 Bacteria 22434
130 Ga0265329_10000525 3300031242 Bacteria 19777
131 Ga0265329_10003086 3300031242 Bacteria 7375
132 Ga0265329_10045604 3300031242 Bacteria 1401
133 Ga0265340_10000716 3300031247 Bacteria 18788
134 Ga0265340_10022309 3300031247 Bacteria 3238
135 Ga0265339_10000008 3300031249 Bacteria 239647
136 Ga0265339_10018780 3300031249 Unclassified 4071
137 Ga0265339_10094856 3300031249 Bacteria 1559
138 Ga0265331_10009869 3300031250 Bacteria 5320
139 Ga0265331_10028108 3300031250 Bacteria 2814
140 Ga0265316_10000272 3300031344 Bacteria 58100
141 Ga0265316_10000538 3300031344 Bacteria 42718
142 Ga0265316_10001537 3300031344 Bacteria 24724
143 Ga0265316_10002406 3300031344 Bacteria 19458
144 Ga0265316_10012002 3300031344 Bacteria 7787
145 Ga0265316_10032385 3300031344 Bacteria 4266
146 Ga0265316_10100433 3300031344 Bacteria 2199
147 Ga0265316_10127097 3300031344 Bacteria 1922
148 Ga0265313_10012701 3300031595 Bacteria 5116
149 Ga0265313_10020378 3300031595 Bacteria 3659
150 Ga0265313_10036099 3300031595 Bacteria 2483
151 Ga0265314_10000075 3300031711 Bacteria 147341
152 Ga0265314_10007383 3300031711 Bacteria 9537
153 Ga0265314_10014649 3300031711 Bacteria 6258
154 Ga0265314_10085046 3300031711 Bacteria 2075
155 Ga0265342_10000036 3300031712 Bacteria 142882
156 Ga0265342_10000579 3300031712 Bacteria 38628
157 Ga0265342_10001999 3300031712 Bacteria 18168
158 Ga0265342_10006289 3300031712 Bacteria 8859
159 Ga0265342_10011311 3300031712 Bacteria 6118
160 Ga0265342_10034809 3300031712 Bacteria 3087
161 Ga0316576_10061295 3300031727 Unclassified 2757
162 Ga0316576_10450727 3300031727 Bacteria 950
163 Ga0373950_0000001 3300034818 Bacteria 1001987
164 Ga0373950_0000052 3300034818 Bacteria 83086
165 Ga0373934_0029604 3300035086 Bacteria 2139
166 Ga0373941_0008821 3300035115 Bacteria 2521
167 Ga0373956_0022817 3300035119 Bacteria 2682
168 Ga0373960_0130697 3300035121 Bacteria 842
169 Ga0373935_0167346 3300035692 Bacteria 1502
170 Ga0373933_0000343 3300035724 Bacteria 29930
171 Ga0373933_0106679 3300035724 Bacteria 1743
172 Ga0373933_0209770 3300035724 Bacteria 1248
173 Ga0373937_0000576 3300036401 Bacteria 32560
174 Ga0373937_0001790 3300036401 Bacteria 18054
175 Ga0436365_1146265 3300039437 Bacteria 7007
176 Ga0451577_0011762 3300042876 Bacteria 8260
177 Ga0451577_0081110 3300042876 Bacteria 2893
178 Ga0453683_0037436 3300044673 Bacteria 3052
179 Ga0453684_0000673 3300044712 Bacteria 122532
180 Ga0453684_0013332 3300044712 Bacteria 13373
181 Ga0453684_0032930 3300044712 Bacteria 7237
182 Ga0453684_0048850 3300044712 Bacteria 5587
183 Ga0453684_0171032 3300044712 Archaea 2561
184 Ga0453684_0238632 3300044712 Bacteria 2094
185 Ga0451576_0005480 3300045051 Bacteria 15887
186 Ga0495664_0008797 3300046477 Bacteria 5639
187 Ga0495628_0077728 3300046516 Bacteria 2581
188 Ga0495630_0029005 3300046517 Bacteria 4113
189 Ga0495586_0094897 3300046535 Bacteria 1650
190 Ga0495634_0009415 3300046642 Bacteria 7206
191 Ga0495600_0276495 3300046809 Bacteria 1064
192 Ga0495674_0000759 3300047319 Bacteria 30634
193 Ga0495684_0014802 3300047471 Bacteria 6007
194 Ga0496100_0082992 3300048903 Bacteria 2168
195 Ga0496100_0386865 3300048903 Bacteria 1063
196 Ga0496104_0047219 3300048907 Bacteria 4058
197 Ga0496105_0097337 3300048908 Bacteria 2431
198 Ga0496105_0341068 3300048908 Bacteria 1198
199 Ga0496106_0018847 3300048909 Bacteria 5113
200 Ga0496107_0044892 3300048910 Bacteria 3178
201 Ga0496107_0085592 3300048910 Bacteria 2300
202 Ga0496112_0144419 3300048915 Bacteria 2348
203 Ga0496114_0002190 3300048917 Bacteria 14879
204 Ga0496114_0011110 3300048917 Bacteria 7186
205 Ga0496114_0227184 3300048917 Bacteria 1639
206 Ga0496115_0102144 3300048918 Bacteria 2351
207 Ga0496115_0158308 3300048918 Bacteria 1871
208 Ga0501034_0000025 3300049571 Bacteria 262496
209 Ga0501036_0004497 3300049572 Bacteria 11269
210 Ga0501036_0069841 3300049572 Bacteria 2970
211 Ga0501043_0000877 3300049579 Bacteria 26683
212 Ga0501047_0000038 3300049581 Bacteria 189296
213 Ga0501048_0005896 3300049582 Bacteria 9328
214 Ga0501067_0000057 3300049583 Bacteria 64531
215 Ga0501067_0002278 3300049583 Bacteria 10595
216 Ga0501067_0006237 3300049583 Bacteria 6612
217 Ga0501067_0037209 3300049583 Bacteria 2703
218 Ga0501068_0010676 3300049584 Bacteria 5166
219 Ga0501068_0094042 3300049584 Bacteria 1852
220 Ga0501069_0011916 3300049585 Bacteria 4613
221 Ga0501069_0038880 3300049585 Unclassified 2627
222 Ga0501070_0000007 3300049586 Bacteria 219869
223 Ga0501070_0000022 3300049586 Bacteria 165335
224 Ga0501070_0002477 3300049586 Bacteria 16186
225 Ga0501070_0094484 3300049586 Bacteria 2474
226 Ga0501072_0000055 3300049588 Bacteria 83678
227 Ga0501073_0000420 3300049589 Bacteria 29044
228 Ga0501073_0000993 3300049589 Bacteria 20470
229 Ga0501073_0003018 3300049589 Bacteria 12614
230 Ga0501073_0004445 3300049589 Bacteria 10534
231 Ga0501073_0007959 3300049589 Bacteria 7866
232 Ga0501073_0018263 3300049589 Bacteria 5067
233 Ga0501073_0066807 3300049589 Bacteria 2506
234 Ga0501073_0117354 3300049589 Bacteria 1844
235 Ga0501074_0016636 3300049590 Bacteria 5337
236 Ga0501074_0052036 3300049590 Bacteria 2956
237 Ga0501079_0001466 3300049741 Bacteria 16686
238 Ga0501079_0080178 3300049741 Bacteria 2524
239 Ga0501079_0114813 3300049741 Bacteria 2093
240 Ga0501080_0030636 3300049742 Bacteria 5013
241 Ga0501081_0138804 3300049743 Bacteria 1741
242 Ga0501081_0164305 3300049743 Bacteria 1601
243 Ga0501083_0000283 3300049744 Bacteria 32216
244 Ga0501083_0002643 3300049744 Bacteria 12332
245 Ga0501083_0004746 3300049744 Bacteria 9600
246 Ga0501083_0009025 3300049744 Bacteria 7037
247 Ga0501035_0000098 3300049822 Bacteria 109731
248 nmdc:mga08y16_6797_c1 3300050511 Bacteria 12000
249 nmdc:mga0rr50_14040_c1 3300050513 Bacteria 5237
250 Ga0495601_0118664 3300053077 Bacteria 1717
251 Ga0495601_0122327 3300053077 Bacteria 1691
252 Ga0495595_0072763 3300053084 Bacteria 1627
253 Ga0495619_0078022 3300053085 Bacteria 2226
254 Ga0501084_0094458 3300054114 Unclassified 2511
255 Ga0501082_0002105 3300060353 Bacteria 17530
256 Ga0501082_0004621 3300060353 Bacteria 12018
257 Ga0501082_0010809 3300060353 Bacteria 7860
258 Ga0501082_0013281 3300060353 Bacteria 7083
259 Ga0501082_0027011 3300060353 Bacteria 4946
260 Ga0496106_0131802
261 rootH1_10012253
262 Ga0065712_10177966
263 Ga0070676_10003875
264 Ga0070683_100002183
265 Ga0070683_100024309
266 Ga0070690_100004509
267 Ga0070690_100093951
268 Ga0070690_100143116
269 Ga0070670_100046964
270 Ga0070666_10158781
271 Ga0070660_100073366
272 Ga0070689_100000008
273 Ga0070689_100054812
274 Ga0070691_10087884
275 Ga0070687_100026238
276 Ga0070692_10021147
277 Ga0070668_100160352
278 Ga0070674_100001726
279 Ga0070673_100001335
280 Ga0070673_100074712
281 Ga0070673_100187937
282 Ga0070673_100565635
283 Ga0070688_100055893
284 Ga0070667_100257108
285 Ga0070709_10629241
286 Ga0070700_100002258
287 Ga0070662_100141717
288 Ga0068867_100079078
289 Ga0070685_10030281
290 Ga0070685_10401749
291 Ga0070685_10532660
292 Ga0070707_100016423
293 Ga0070698_100018950
294 Ga0070679_100077759
295 Ga0070684_100001361
296 Ga0070684_100001370
297 Ga0070684_100215986
298 Ga0070686_100003487
299 Ga0070686_100022074
300 Ga0068857_100211227
301 Ga0068856_100055444
302 Ga0070702_100046293
303 Ga0070702_100151686
304 Ga0068864_100193570
305 Ga0068866_10011296
306 Ga0068861_100012823
307 Ga0068863_100072943
308 Ga0068863_100185357
309 Ga0068858_100036503
310 Ga0068858_100319772
311 Ga0068862_100367922
312 Ga0068871_100170761
313 Ga0068865_100003234
314 Ga0075435_100045216
315 Ga0111539_10127275
316 Ga0105245_10471091
317 Ga0105243_10134798
318 Ga0105237_10079729
319 Ga0105238_10053651
320 Ga0105249_10206725
321 Ga0099796_10081481
322 Ga0157374_10198105
323 Ga0157378_10023024
324 Ga0163162_10199260
325 Ga0157375_10553169
326 Ga0157376_10282786
327 Ga0207666_1008727
328 Ga0207697_10018870
329 Ga0207642_10006069
330 Ga0207680_10456991
331 Ga0207647_10247653
332 Ga0207645_10005401
333 Ga0207707_10501858
334 Ga0207671_10291201
335 Ga0207663_10209261
336 Ga0207662_10007550
337 Ga0207662_10038672
338 Ga0207652_10189760
339 Ga0207646_10021666
340 Ga0207681_10026666
341 Ga0207694_10100993
342 Ga0207650_10040026
343 Ga0207706_10213918
344 Ga0207670_10000003
345 Ga0207670_10123349
346 Ga0207669_10001841
347 Ga0207691_10017744
348 Ga0207691_10061407
349 Ga0207691_10157504
350 Ga0207689_10371761
351 Ga0207661_10005106
352 Ga0207661_10005740
353 Ga0207667_10125449
354 Ga0207667_10126520
355 Ga0207651_10002232
356 Ga0207712_10309413
357 Ga0207668_10025249
358 Ga0207658_10237052
359 Ga0207703_10138954
360 Ga0207639_10377035
361 Ga0207708_10001556
362 Ga0207702_10223974
363 Ga0207641_10061907
364 Ga0207648_10084536
365 Ga0207674_10147423
366 Ga0207675_100007303
367 Ga0209998_10012308
368 Ga0207428_10019523
369 Ga0268265_10383715
370 Ga0268264_10570516
371 Ga0265319_1046062
372 Ga0265318_10001560
373 Ga0265323_10013254
374 Ga0265323_10015183
375 Ga0265322_10012410
376 Ga0265330_10000457
377 Ga0265330_10002459
378 Ga0265330_10018115
379 Ga0265330_10031436
380 Ga0265332_10000274
381 Ga0265328_10007201
382 Ga0265328_10091338
383 Ga0265328_10097026
384 Ga0265320_10087569
385 Ga0265325_10001719
386 Ga0265325_10009310
387 Ga0265325_10168433
388 Ga0265329_10000416
389 Ga0265329_10000525
390 Ga0265329_10003086
391 Ga0265329_10045604
392 Ga0265340_10000716
393 Ga0265340_10022309
394 Ga0265339_10000008
395 Ga0265339_10018780
396 Ga0265339_10094856
397 Ga0265331_10009869
398 Ga0265331_10028108
399 Ga0265316_10000272
400 Ga0265316_10000538
401 Ga0265316_10001537
402 Ga0265316_10002406
403 Ga0265316_10012002
404 Ga0265316_10032385
405 Ga0265316_10100433
406 Ga0265316_10127097
407 Ga0265313_10012701
408 Ga0265313_10020378
409 Ga0265313_10036099
410 Ga0265314_10000075
411 Ga0265314_10007383
412 Ga0265314_10014649
413 Ga0265314_10085046
414 Ga0265342_10000036
415 Ga0265342_10000579
416 Ga0265342_10001999
417 Ga0265342_10006289
418 Ga0265342_10011311
419 Ga0265342_10034809
420 Ga0316576_10061295
421 Ga0316576_10450727
422 Ga0373950_0000001
423 Ga0373950_0000052
424 Ga0373934_0029604
425 Ga0373941_0008821
426 Ga0373956_0022817
427 Ga0373960_0130697
428 Ga0373935_0167346
429 Ga0373933_0000343
430 Ga0373933_0106679
431 Ga0373933_0209770
432 Ga0373937_0000576
433 Ga0373937_0001790
434 Ga0436365_1146265
435 Ga0451577_0011762
436 Ga0451577_0081110
437 Ga0453683_0037436
438 Ga0453684_0000673
439 Ga0453684_0013332
440 Ga0453684_0032930
441 Ga0453684_0048850
442 Ga0453684_0171032
443 Ga0453684_0238632
444 Ga0451576_0005480
445 Ga0495664_0008797
446 Ga0495628_0077728
447 Ga0495630_0029005
448 Ga0495586_0094897
449 Ga0495634_0009415
450 Ga0495600_0276495
451 Ga0495674_0000759
452 Ga0495684_0014802
453 Ga0496100_0082992
454 Ga0496100_0386865
455 Ga0496104_0047219
456 Ga0496105_0097337
457 Ga0496105_0341068
458 Ga0496106_0018847
459 Ga0496107_0044892
460 Ga0496107_0085592
461 Ga0496112_0144419
462 Ga0496114_0002190
463 Ga0496114_0011110
464 Ga0496114_0227184
465 Ga0496115_0102144
466 Ga0496115_0158308
467 Ga0501034_0000025
468 Ga0501036_0004497
469 Ga0501036_0069841
470 Ga0501043_0000877
471 Ga0501047_0000038
472 Ga0501048_0005896
473 Ga0501067_0000057
474 Ga0501067_0002278
475 Ga0501067_0006237
476 Ga0501067_0037209
477 Ga0501068_0010676
478 Ga0501068_0094042
479 Ga0501069_0011916
480 Ga0501069_0038880
481 Ga0501070_0000007
482 Ga0501070_0000022
483 Ga0501070_0002477
484 Ga0501070_0094484
485 Ga0501072_0000055
486 Ga0501073_0000420
487 Ga0501073_0000993
488 Ga0501073_0003018
489 Ga0501073_0004445
490 Ga0501073_0007959
491 Ga0501073_0018263
492 Ga0501073_0066807
493 Ga0501073_0117354
494 Ga0501074_0016636
495 Ga0501074_0052036
496 Ga0501079_0001466
497 Ga0501079_0080178
498 Ga0501079_0114813
499 Ga0501080_0030636
500 Ga0501081_0138804
501 Ga0501081_0164305
502 Ga0501083_0000283
503 Ga0501083_0002643
504 Ga0501083_0004746
505 Ga0501083_0009025
506 Ga0501035_0000098
507 nmdc:mga08y16_6797_c1
508 nmdc:mga0rr50_14040_c1
509 Ga0495601_0118664
510 Ga0495601_0122327
511 Ga0495595_0072763
512 Ga0495619_0078022
513 Ga0501084_0094458
514 Ga0501082_0002105
515 Ga0501082_0004621
516 Ga0501082_0010809
517 Ga0501082_0013281
518 Ga0501082_0027011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

38

284

0.91

PF12727

PBP_like

PBP superfamily domain

64

252

0.87

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

53

287

0.8

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

48

295

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h1x-assembly1.cif.gz_A crystal structure of a phosphate abc transporter, phosphate-binding protein (sp_2084) from streptococcus pneumoniae tigr4 at 1.77 a resolution 0.9186 28 94
1twy-assembly10.cif.gz_B crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8834 31 278
4omb-assembly4.cif.gz_D phosphate binding protein 0.8794 28 279
1twy-assembly1.cif.gz_A crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.871 29 278
1twy-assembly10.cif.gz_B crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8698 31 278
ID Description Score Start End Superfamily
4ombA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9676 112 240 3.40.190.10
4jwoA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9581 28 109 3.40.190.10
4gd5B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9411 29 109 3.40.190.10
af_Q2FYP6_33_111_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9329 29 101 3.40.190.10
1twyF01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9275 29 109 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A419H5H3-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.9486 39 281
AF-A0A7W0WUT2-F1-model_v4 Substrate-binding domain-containing protein 0.9453 64 279 GO:0016020
AF-A0A645ECC8-F1-model_v4 Phosphate-binding protein PstS 0.9352 104 279
AF-A0A1F5RLJ8-F1-model_v4 PBP domain-containing protein 0.9316 44 279
AF-A0A2V8JUA6-F1-model_v4 Phosphate-binding protein 0.9275 18 112

Map