F373790

General Info

Members Datasets Scaffolds Average Seq Length
266 145 265 263

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10004520|Ga0065715_100045203
Length 288
Sequence MNSFAISDADRRLIPSSGLRGPVPLLIAIMTFVMVVVAAAGLALANTGAVIRAGVEHRYSIQIADGAAKAPAAIAAARAQPGVGRVNQVDPAELRRTLERWLGPASAEADLPLPAVIDVDLKPGADPAAVASAIRKAVPSARFVGHRTSLAPLLKALRGLTLLAMGLVLMIALAXXXXIVLAARGALDTHRGTIEVMHGIGATDEQVVRLFVRQIAVDALLGGMAGAAAAGLTIALIIGGAGTATMLAGAPPLGWNDAIWLLMLPLAIALLATQVARIALVRALRERL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
122 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
123 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 3.01
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6947300 2162886012 Bacteria 1277
2 JGI24741J21665_1011965 3300001915 Bacteria 1504
3 JGI24740J21852_10000820 3300001979 Bacteria 13657
4 Ga0065715_10004520 3300005293 Bacteria 3515
5 Ga0070658_10000256 3300005327 Bacteria 46854
6 Ga0070658_10216770 3300005327 Bacteria 1618
7 Ga0070676_10014438 3300005328 Bacteria 4340
8 Ga0070683_100002147 3300005329 Bacteria 15585
9 Ga0070690_100138715 3300005330 Bacteria 1649
10 Ga0070670_100001335 3300005331 Bacteria 19717
11 Ga0070670_100005097 3300005331 Bacteria 11057
12 Ga0070670_100012617 3300005331 Bacteria 7234
13 Ga0070670_100020181 3300005331 Bacteria 5725
14 Ga0070670_100038733 3300005331 Bacteria 4099
15 Ga0070670_100270661 3300005331 Bacteria 1482
16 Ga0070666_10119166 3300005335 Bacteria 1829
17 Ga0070680_100000105 3300005336 Bacteria 48515
18 Ga0068868_100034443 3300005338 Bacteria 3909
19 Ga0070660_100000064 3300005339 Bacteria 62554
20 Ga0070660_100064006 3300005339 Bacteria 2860
21 Ga0070660_100314759 3300005339 Bacteria 1285
22 Ga0070661_100013723 3300005344 Bacteria 5691
23 Ga0070661_100031564 3300005344 Bacteria 3832
24 Ga0070661_100066236 3300005344 Bacteria 2654
25 Ga0070661_100071027 3300005344 Bacteria 2561
26 Ga0070692_10017485 3300005345 Bacteria 3429
27 Ga0070668_100013179 3300005347 Bacteria 6164
28 Ga0070668_100149996 3300005347 Bacteria 1884
29 Ga0070668_100183768 3300005347 Bacteria 1709
30 Ga0070669_100017560 3300005353 Bacteria 5104
31 Ga0070675_100003250 3300005354 Bacteria 12310
32 Ga0070671_100011834 3300005355 Bacteria 7019
33 Ga0070671_100021220 3300005355 Bacteria 5304
34 Ga0070671_100103844 3300005355 Bacteria 2385
35 Ga0070674_100021255 3300005356 Bacteria 4162
36 Ga0070674_100041707 3300005356 Bacteria 3113
37 Ga0070673_100007664 3300005364 Bacteria 7140
38 Ga0070659_100031240 3300005366 Bacteria 4124
39 Ga0070659_100052843 3300005366 Bacteria 3196
40 Ga0070659_100103763 3300005366 Bacteria 2290
41 Ga0070714_100044099 3300005435 Bacteria 3775
42 Ga0070714_100119907 3300005435 Bacteria 2339
43 Ga0070713_100016291 3300005436 Bacteria 5587
44 Ga0070713_100050382 3300005436 Bacteria 3440
45 Ga0070663_100036551 3300005455 Bacteria 3412
46 Ga0070663_100038411 3300005455 Bacteria 3340
47 Ga0070678_100002909 3300005456 Bacteria 9486
48 Ga0070662_100010487 3300005457 Bacteria 6084
49 Ga0070662_100098645 3300005457 Bacteria 2207
50 Ga0070662_100155710 3300005457 Bacteria 1784
51 Ga0070681_10050209 3300005458 Bacteria 4163
52 Ga0070681_10156813 3300005458 Bacteria 2201
53 Ga0068867_100013826 3300005459 Bacteria 5713
54 Ga0068867_100046865 3300005459 Bacteria 3176
55 Ga0070679_100000125 3300005530 Bacteria 61348
56 Ga0068853_100168269 3300005539 Bacteria 1982
57 Ga0068853_100360465 3300005539 Bacteria 1354
58 Ga0070672_100005595 3300005543 Bacteria 8355
59 Ga0070695_100006471 3300005545 Bacteria 6925
60 Ga0070696_100063471 3300005546 Bacteria 2587
61 Ga0070696_100111422 3300005546 Bacteria 1971
62 Ga0070704_100127983 3300005549 Bacteria 1963
63 Ga0068855_100016190 3300005563 Bacteria 8966
64 Ga0070664_100000849 3300005564 Bacteria 23590
65 Ga0070664_100002063 3300005564 Bacteria 16046
66 Ga0070664_100069220 3300005564 Bacteria 3019
67 Ga0070664_100244948 3300005564 Bacteria 1610
68 Ga0068857_100520618 3300005577 Bacteria 1118
69 Ga0068854_100004966 3300005578 Bacteria 8385
70 Ga0068854_100021812 3300005578 Bacteria 4352
71 Ga0068854_100033020 3300005578 Bacteria 3605
72 Ga0068856_100001220 3300005614 Bacteria 26928
73 Ga0068856_100419231 3300005614 Bacteria 1359
74 Ga0068852_100123101 3300005616 Bacteria 2378
75 Ga0068859_100069278 3300005617 Bacteria 3562
76 Ga0068864_100026361 3300005618 Bacteria 4903
77 Ga0068864_100102264 3300005618 Bacteria 2543
78 Ga0068861_100053121 3300005719 Bacteria 3082
79 Ga0068863_100011392 3300005841 Bacteria 8604
80 Ga0068863_100021346 3300005841 Bacteria 6180
81 Ga0068863_100166154 3300005841 Bacteria 2116
82 Ga0068862_100097285 3300005844 Bacteria 2570
83 Ga0070717_10055953 3300006028 Bacteria 3257
84 Ga0075364_10186612 3300006051 Bacteria 1404
85 Ga0075431_100009478 3300006847 Bacteria 9776
86 Ga0075429_100183298 3300006880 Bacteria 1835
87 Ga0097620_100016663 3300006931 Bacteria 7378
88 Ga0097620_100069275 3300006931 Bacteria 3562
89 Ga0111539_10157647 3300009094 Bacteria 2656
90 Ga0105241_10342710 3300009174 Bacteria 1295
91 Ga0105248_10006386 3300009177 Bacteria 12938
92 Ga0105248_10031122 3300009177 Bacteria 5963
93 Ga0105237_10355580 3300009545 Bacteria 1469
94 Ga0105249_10390873 3300009553 Bacteria 1419
95 Ga0105249_10451293 3300009553 Bacteria 1325
96 Ga0157373_10112934 3300013100 Bacteria 1909
97 Ga0157370_10010104 3300013104 Bacteria 9968
98 Ga0157370_10119384 3300013104 Bacteria 2462
99 Ga0157369_10011511 3300013105 Bacteria 10049
100 Ga0157378_10471553 3300013297 Bacteria 1249
101 Ga0157372_10367673 3300013307 Bacteria 1676
102 Ga0157380_10140191 3300014326 Bacteria 2076
103 Ga0163161_10013343 3300017792 Bacteria 5715
104 Ga0207697_10000969 3300025315 Bacteria 16134
105 Ga0207682_10000494 3300025893 Bacteria 18198
106 Ga0207688_10149726 3300025901 Bacteria 1378
107 Ga0207647_10033341 3300025904 Bacteria 3298
108 Ga0207705_10000067 3300025909 Bacteria 136004
109 Ga0207707_10014856 3300025912 Bacteria 6780
110 Ga0207695_10094901 3300025913 Bacteria 2989
111 Ga0207660_10000379 3300025917 Bacteria 29073
112 Ga0207657_10019943 3300025919 Bacteria 6352
113 Ga0207657_10041930 3300025919 Bacteria 4042
114 Ga0207657_10065188 3300025919 Bacteria 3106
115 Ga0207657_10432511 3300025919 Unclassified 1034
116 Ga0207649_10011307 3300025920 Bacteria 4919
117 Ga0207649_10045369 3300025920 Bacteria 2694
118 Ga0207652_10000058 3300025921 Bacteria 113620
119 Ga0207681_10008796 3300025923 Bacteria 6168
120 Ga0207650_10017606 3300025925 Bacteria 5005
121 Ga0207650_10029028 3300025925 Bacteria 3972
122 Ga0207650_10132950 3300025925 Bacteria 1949
123 Ga0207650_10256459 3300025925 Bacteria 1417
124 Ga0207650_10353095 3300025925 Bacteria 1210
125 Ga0207659_10013644 3300025926 Bacteria 5212
126 Ga0207664_10165161 3300025929 Bacteria 1891
127 Ga0207644_10000138 3300025931 Bacteria 52145
128 Ga0207690_10044073 3300025932 Bacteria 2939
129 Ga0207706_10000276 3300025933 Bacteria 55889
130 Ga0207706_10085028 3300025933 Bacteria 2781
131 Ga0207706_10156825 3300025933 Bacteria 2001
132 Ga0207706_10267100 3300025933 Bacteria 1493
133 Ga0207669_10021869 3300025937 Bacteria 3386
134 Ga0207669_10324367 3300025937 Bacteria 1180
135 Ga0207665_10049051 3300025939 Bacteria 2836
136 Ga0207691_10035726 3300025940 Bacteria 4609
137 Ga0207711_10001163 3300025941 Bacteria 25054
138 Ga0207711_10129799 3300025941 Bacteria 2259
139 Ga0207661_10024457 3300025944 Bacteria 4579
140 Ga0207679_10025785 3300025945 Bacteria 4047
141 Ga0207679_10027981 3300025945 Bacteria 3906
142 Ga0207679_10095305 3300025945 Bacteria 2313
143 Ga0207679_10321985 3300025945 Bacteria 1339
144 Ga0207667_10000828 3300025949 Bacteria 39983
145 Ga0207668_10004430 3300025972 Bacteria 8246
146 Ga0207668_10057467 3300025972 Bacteria 2714
147 Ga0207640_10036970 3300025981 Bacteria 3069
148 Ga0207640_10071631 3300025981 Bacteria 2335
149 Ga0207640_10110868 3300025981 Bacteria 1945
150 Ga0207639_10182196 3300026041 Bacteria 1787
151 Ga0207639_10322347 3300026041 Bacteria 1372
152 Ga0207678_10002816 3300026067 Bacteria 15773
153 Ga0207678_10020251 3300026067 Bacteria 5838
154 Ga0207678_10021079 3300026067 Bacteria 5713
155 Ga0207678_10293173 3300026067 Bacteria 1397
156 Ga0207702_10001153 3300026078 Bacteria 27012
157 Ga0207702_10150179 3300026078 Bacteria 2118
158 Ga0207641_10051301 3300026088 Bacteria 3493
159 Ga0207641_10108242 3300026088 Bacteria 2460
160 Ga0207648_10036823 3300026089 Bacteria 4310
161 Ga0207648_10061680 3300026089 Bacteria 3269
162 Ga0207676_10010750 3300026095 Bacteria 6525
163 Ga0207674_10328482 3300026116 Bacteria 1479
164 Ga0207675_100008969 3300026118 Bacteria 9384
165 Ga0207683_10004703 3300026121 Bacteria 11769
166 Ga0207683_10065725 3300026121 Bacteria 3198
167 Ga0207698_10058216 3300026142 Bacteria 2994
168 Ga0207698_10483228 3300026142 Unclassified 1202
169 Ga0268265_10184199 3300028380 Bacteria 1797
170 Ga0268264_10306344 3300028381 Bacteria 1497
171 Ga0307408_100165545 3300031548 Bacteria 1760
172 Ga0307413_10012008 3300031824 Bacteria 4290
173 Ga0307413_10051060 3300031824 Bacteria 2489
174 Ga0307413_10124809 3300031824 Bacteria 1751
175 Ga0307410_10079353 3300031852 Bacteria 2299
176 Ga0307410_10353812 3300031852 Bacteria 1174
177 Ga0307407_10205504 3300031903 Bacteria 1322
178 Ga0307412_10066668 3300031911 Bacteria 2441
179 Ga0307412_10415261 3300031911 Unclassified 1099
180 Ga0307409_100008719 3300031995 Bacteria 6179
181 Ga0307409_100420963 3300031995 Bacteria 1281
182 Ga0307409_100455388 3300031995 Bacteria 1236
183 Ga0307416_100088120 3300032002 Bacteria 2653
184 Ga0307416_100266878 3300032002 Bacteria 1677
185 Ga0307414_10004982 3300032004 Bacteria 7263
186 Ga0307414_10018385 3300032004 Bacteria 4302
187 Ga0307414_10022979 3300032004 Bacteria 3945
188 Ga0307414_10114629 3300032004 Bacteria 2059
189 Ga0307414_10146749 3300032004 Bacteria 1855
190 Ga0307414_10176081 3300032004 Bacteria 1715
191 Ga0307414_10206675 3300032004 Bacteria 1601
192 Ga0307411_10011766 3300032005 Bacteria 4740
193 Ga0307411_10040491 3300032005 Bacteria 2956
194 Ga0307411_10059715 3300032005 Bacteria 2529
195 Ga0307411_10138757 3300032005 Bacteria 1789
196 Ga0307415_100080767 3300032126 Bacteria 2321
197 Ga0307415_100218739 3300032126 Bacteria 1525
198 Ga0373941_0113443 3300035115 Bacteria 958
199 Ga0395899_0008223 3300037312 Bacteria 8036
200 Ga0395899_0025675 3300037312 Bacteria 4447
201 Ga0395899_0043242 3300037312 Bacteria 3361
202 Ga0395899_0046217 3300037312 Bacteria 3243
203 Ga0395899_0080280 3300037312 Bacteria 2374
204 Ga0395899_0173849 3300037312 Bacteria 1515
205 Ga0395899_0181589 3300037312 Bacteria 1477
206 Ga0395900_0002103 3300037418 Bacteria 22302
207 Ga0395900_0003952 3300037418 Bacteria 15826
208 Ga0395900_0011120 3300037418 Bacteria 9198
209 Ga0395900_0016290 3300037418 Bacteria 7577
210 Ga0395900_0031577 3300037418 Bacteria 5444
211 Ga0395900_0060046 3300037418 Bacteria 3914
212 Ga0395900_0089276 3300037418 Bacteria 3168
213 Ga0395900_0653775 3300037418 Bacteria 987
214 Ga0395898_0101767 3300037466 Bacteria 2758
215 Ga0395905_0001572 3300037471 Bacteria 27278
216 Ga0395905_0010599 3300037471 Bacteria 8948
217 Ga0395905_0023354 3300037471 Bacteria 5845
218 Ga0395905_0039152 3300037471 Bacteria 4447
219 Ga0395905_0070942 3300037471 Bacteria 3265
220 Ga0395905_0273358 3300037471 Unclassified 1575
221 Ga0395905_0472755 3300037471 Bacteria 1152
222 Ga0395901_0006236 3300038443 Bacteria 12089
223 Ga0395901_0011353 3300038443 Bacteria 9026
224 Ga0395901_0015289 3300038443 Bacteria 7809
225 Ga0395901_0061072 3300038443 Bacteria 3922
226 Ga0395901_0081578 3300038443 Bacteria 3378
227 Ga0395901_0108603 3300038443 Bacteria 2912
228 Ga0395901_0128611 3300038443 Bacteria 2662
229 Ga0395901_0133127 3300038443 Bacteria 2612
230 Ga0395901_0272229 3300038443 Bacteria 1761
231 Ga0436365_0899740 3300039437 Bacteria 3358
232 Ga0439445_0004007 3300042004 Bacteria 3324
233 Ga0450905_000113 3300042142 Bacteria 8096
234 Ga0450889_000213 3300042144 Bacteria 6335
235 Ga0466967_0040653 3300045976 Bacteria 4005
236 Ga0495663_0000955 3300046525 Bacteria 9626
237 Ga0495663_0036686 3300046525 Bacteria 1476
238 Ga0495663_0045449 3300046525 Bacteria 1346
239 Ga0495663_0064946 3300046525 Bacteria 1153
240 Ga0495598_0013977 3300046537 Bacteria 2000
241 Ga0495598_0030011 3300046537 Bacteria 1520
242 Ga0495598_0102876 3300046537 Bacteria 947
243 Ga0495621_0008584 3300046539 Bacteria 3071
244 Ga0495621_0226919 3300046539 Bacteria 757
245 Ga0495633_0013578 3300046558 Bacteria 4286
246 Ga0495633_0019241 3300046558 Bacteria 3454
247 Ga0495659_0002834 3300046664 Bacteria 5569
248 Ga0495670_0006037 3300046691 Bacteria 5934
249 Ga0495670_0021371 3300046691 Bacteria 3191
250 Ga0495670_0043165 3300046691 Bacteria 2250
251 Ga0495677_0019890 3300047445 Bacteria 2434
252 Ga0496101_0043850 3300048904 Bacteria 3198
253 Ga0496106_0134454 3300048909 Bacteria 1941
254 Ga0496107_0063820 3300048910 Bacteria 2669
255 Ga0496108_0525966 3300048911 Bacteria 1032
256 Ga0496109_0002117 3300048912 Bacteria 16511
257 Ga0496112_0001994 3300048915 Bacteria 16154
258 Ga0496114_0007186 3300048917 Bacteria 8788
259 Ga0496115_0041532 3300048918 Bacteria 3661
260 Ga0501068_0090879 3300049584 Bacteria 1884
261 nmdc:mga00v17_233450_c1 3300050491 Bacteria 1192
262 nmdc:mga09592_184655_c1 3300050508 Bacteria 1804
263 nmdc:mga06r32_63335_c1 3300050510 Bacteria 3564
264 nmdc:mga08y16_155987_c1 3300050511 Bacteria 2372
265 Ga0466962_0115257 3300061719 Unclassified 1295

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046539 Ga0495621_0226919 Ga0495621_0226919_16_636 188
2 3300006931 Ga0097620_100016663 Ga0097620_1000166634 217
3 3300025919 Ga0207657_10432511 Ga0207657_104325112 217
4 3300037418 Ga0395900_0653775 Ga0395900_0653775_125_916 217
5 3300037471 Ga0395905_0273358 Ga0395905_0273358_72_863 217
6 3300037471 Ga0395905_0472755 Ga0395905_0472755_290_1081 217
7 3300038443 Ga0395901_0272229 Ga0395901_0272229_82_951 221
8 3300037418 Ga0395900_0016290 Ga0395900_0016290_6768_7547 222
9 3300035115 Ga0373941_0113443 Ga0373941_0113443_202_945 227
10 3300031824 Ga0307413_10012008 Ga0307413_100120084 229
11 3300031995 Ga0307409_100008719 Ga0307409_1000087194 229
12 3300032002 Ga0307416_100266878 Ga0307416_1002668782 229
13 3300032004 Ga0307414_10022979 Ga0307414_100229793 229
14 3300048911 Ga0496108_0525966 Ga0496108_0525966_34_825 232
15 3300032126 Ga0307415_100080767 Ga0307415_1000807673 233
16 3300005339 Ga0070660_100064006 Ga0070660_1000640062 234
17 3300005366 Ga0070659_100052843 Ga0070659_1000528433 234
18 3300006847 Ga0075431_100009478 Ga0075431_1000094787 234
19 3300025919 Ga0207657_10065188 Ga0207657_100651882 234
20 3300050510 nmdc:mga06r32_63335_c1 nmdc:mga06r32_63335_c1_760_1629 234
21 3300013105 Ga0157369_10011511 Ga0157369_100115114 237
22 3300031824 Ga0307413_10124809 Ga0307413_101248091 237
23 3300031995 Ga0307409_100455388 Ga0307409_1004553881 237
24 3300031852 Ga0307410_10353812 Ga0307410_103538122 239
25 3300031911 Ga0307412_10066668 Ga0307412_100666682 239
26 3300032004 Ga0307414_10114629 Ga0307414_101146292 239
27 3300032005 Ga0307411_10059715 Ga0307411_100597152 239
28 3300005327 Ga0070658_10216770 Ga0070658_102167702 242
29 3300005344 Ga0070661_100071027 Ga0070661_1000710272 242
30 3300005614 Ga0068856_100419231 Ga0068856_1004192312 242
31 3300013100 Ga0157373_10112934 Ga0157373_101129342 242
32 3300025913 Ga0207695_10094901 Ga0207695_100949012 242
33 3300025929 Ga0207664_10165161 Ga0207664_101651612 242
34 3300026078 Ga0207702_10150179 Ga0207702_101501793 242
35 3300037312 Ga0395899_0080280 Ga0395899_0080280_500_1369 242
36 3300038443 Ga0395901_0133127 Ga0395901_0133127_1043_1912 242
37 3300025933 Ga0207706_10085028 Ga0207706_100850283 243
38 3300031548 Ga0307408_100165545 Ga0307408_1001655453 243
39 3300005331 Ga0070670_100038733 Ga0070670_1000387333 244
40 3300025925 Ga0207650_10132950 Ga0207650_101329502 244
41 3300032126 Ga0307415_100218739 Ga0307415_1002187392 245
42 3300031911 Ga0307412_10415261 Ga0307412_104152612 247
43 3300032004 Ga0307414_10018385 Ga0307414_100183852 247
44 3300009545 Ga0105237_10355580 Ga0105237_103555801 248
45 3300013104 Ga0157370_10119384 Ga0157370_101193843 248
46 3300005564 Ga0070664_100069220 Ga0070664_1000692203 250
47 3300005841 Ga0068863_100021346 Ga0068863_1000213462 250
48 3300026088 Ga0207641_10051301 Ga0207641_100513014 250
49 3300026116 Ga0207674_10328482 Ga0207674_103284822 250
50 3300049584 Ga0501068_0090879 Ga0501068_0090879_1000_1872 250
51 3300032004 Ga0307414_10176081 Ga0307414_101760813 251
52 3300032005 Ga0307411_10011766 Ga0307411_100117665 251
53 3300037312 Ga0395899_0173849 Ga0395899_0173849_316_1185 251
54 3300038443 Ga0395901_0128611 Ga0395901_0128611_1295_2164 251
55 3300001915 JGI24741J21665_1011965 JGI24741J21665_10119652 252
56 3300001979 JGI24740J21852_10000820 JGI24740J21852_1000082010 252
57 3300005327 Ga0070658_10000256 Ga0070658_1000025648 252
58 3300005329 Ga0070683_100002147 Ga0070683_1000021474 252
59 3300005335 Ga0070666_10119166 Ga0070666_101191662 252
60 3300005336 Ga0070680_100000105 Ga0070680_10000010511 252
61 3300005338 Ga0068868_100034443 Ga0068868_1000344435 252
62 3300005339 Ga0070660_100000064 Ga0070660_1000000645 252
63 3300005339 Ga0070660_100314759 Ga0070660_1003147592 252
64 3300005344 Ga0070661_100031564 Ga0070661_1000315643 252
65 3300005344 Ga0070661_100066236 Ga0070661_1000662363 252
66 3300005345 Ga0070692_10017485 Ga0070692_100174854 252
67 3300005355 Ga0070671_100103844 Ga0070671_1001038442 252
68 3300005366 Ga0070659_100103763 Ga0070659_1001037632 252
69 3300005435 Ga0070714_100044099 Ga0070714_1000440992 252
70 3300005435 Ga0070714_100119907 Ga0070714_1001199073 252
71 3300005436 Ga0070713_100016291 Ga0070713_1000162913 252
72 3300005436 Ga0070713_100050382 Ga0070713_1000503823 252
73 3300005455 Ga0070663_100036551 Ga0070663_1000365513 252
74 3300005457 Ga0070662_100098645 Ga0070662_1000986452 252
75 3300005458 Ga0070681_10050209 Ga0070681_100502093 252
76 3300005459 Ga0068867_100046865 Ga0068867_1000468652 252
77 3300005530 Ga0070679_100000125 Ga0070679_10000012552 252
78 3300005539 Ga0068853_100360465 Ga0068853_1003604652 252
79 3300005563 Ga0068855_100016190 Ga0068855_1000161905 252
80 3300005564 Ga0070664_100002063 Ga0070664_10000206320 252
81 3300005564 Ga0070664_100244948 Ga0070664_1002449482 252
82 3300005577 Ga0068857_100520618 Ga0068857_1005206182 252
83 3300005578 Ga0068854_100004966 Ga0068854_1000049665 252
84 3300005578 Ga0068854_100021812 Ga0068854_1000218126 252
85 3300005614 Ga0068856_100001220 Ga0068856_10000122026 252
86 3300005616 Ga0068852_100123101 Ga0068852_1001231012 252
87 3300005841 Ga0068863_100166154 Ga0068863_1001661543 252
88 3300006028 Ga0070717_10055953 Ga0070717_100559533 252
89 3300009174 Ga0105241_10342710 Ga0105241_103427102 252
90 3300013104 Ga0157370_10010104 Ga0157370_100101047 252
91 3300013307 Ga0157372_10367673 Ga0157372_103676732 252
92 3300025904 Ga0207647_10033341 Ga0207647_100333415 252
93 3300025909 Ga0207705_10000067 Ga0207705_1000006717 252
94 3300025912 Ga0207707_10014856 Ga0207707_100148565 252
95 3300025917 Ga0207660_10000379 Ga0207660_1000037926 252
96 3300025919 Ga0207657_10019943 Ga0207657_100199435 252
97 3300025919 Ga0207657_10041930 Ga0207657_100419304 252
98 3300025920 Ga0207649_10045369 Ga0207649_100453693 252
99 3300025921 Ga0207652_10000058 Ga0207652_1000005851 252
100 3300025939 Ga0207665_10049051 Ga0207665_100490513 252
101 3300025944 Ga0207661_10024457 Ga0207661_100244572 252
102 3300025945 Ga0207679_10027981 Ga0207679_100279815 252
103 3300025945 Ga0207679_10321985 Ga0207679_103219852 252
104 3300025949 Ga0207667_10000828 Ga0207667_1000082817 252
105 3300025981 Ga0207640_10036970 Ga0207640_100369703 252
106 3300025981 Ga0207640_10071631 Ga0207640_100716314 252
107 3300026041 Ga0207639_10322347 Ga0207639_103223472 252
108 3300026067 Ga0207678_10002816 Ga0207678_100028165 252
109 3300026067 Ga0207678_10021079 Ga0207678_100210794 252
110 3300026067 Ga0207678_10293173 Ga0207678_102931732 252
111 3300026078 Ga0207702_10001153 Ga0207702_100011537 252
112 3300026088 Ga0207641_10108242 Ga0207641_101082422 252
113 3300026089 Ga0207648_10061680 Ga0207648_100616802 252
114 3300026142 Ga0207698_10058216 Ga0207698_100582163 252
115 3300031995 Ga0307409_100420963 Ga0307409_1004209632 252
116 3300032004 Ga0307414_10206675 Ga0307414_102066752 252
117 3300037312 Ga0395899_0025675 Ga0395899_0025675_380_1249 252
118 3300037312 Ga0395899_0043242 Ga0395899_0043242_1166_2038 252
119 3300037418 Ga0395900_0002103 Ga0395900_0002103_19246_20118 252
120 3300037418 Ga0395900_0089276 Ga0395900_0089276_861_1730 252
121 3300037466 Ga0395898_0101767 Ga0395898_0101767_955_1827 252
122 3300037471 Ga0395905_0010599 Ga0395905_0010599_4861_5730 252
123 3300037471 Ga0395905_0070942 Ga0395905_0070942_1228_2100 252
124 3300038443 Ga0395901_0011353 Ga0395901_0011353_6072_6944 252
125 3300038443 Ga0395901_0061072 Ga0395901_0061072_525_1394 252
126 3300039437 Ga0436365_0899740 Ga0436365_0899740_1539_2408 252
127 3300005366 Ga0070659_100031240 Ga0070659_1000312402 253
128 3300005458 Ga0070681_10156813 Ga0070681_101568132 253
129 3300005545 Ga0070695_100006471 Ga0070695_1000064714 253
130 3300005546 Ga0070696_100111422 Ga0070696_1001114222 253
131 3300005549 Ga0070704_100127983 Ga0070704_1001279833 253
132 3300006880 Ga0075429_100183298 Ga0075429_1001832982 253
133 3300013297 Ga0157378_10471553 Ga0157378_104715532 253
134 3300025932 Ga0207690_10044073 Ga0207690_100440733 253
135 3300025933 Ga0207706_10267100 Ga0207706_102671002 253
136 3300032004 Ga0307414_10004982 Ga0307414_100049826 253
137 3300037312 Ga0395899_0008223 Ga0395899_0008223_2266_3117 253
138 3300037418 Ga0395900_0011120 Ga0395900_0011120_3735_4604 253
139 3300037471 Ga0395905_0001572 Ga0395905_0001572_2920_3789 253
140 3300038443 Ga0395901_0108603 Ga0395901_0108603_118_987 253
141 3300042142 Ga0450905_000113 Ga0450905_000113_3263_4132 253
142 3300042144 Ga0450889_000213 Ga0450889_000213_3521_4390 253
143 3300045976 Ga0466967_0040653 Ga0466967_0040653_1152_2021 253
144 3300050508 nmdc:mga09592_184655_c1 nmdc:mga09592_184655_c1_631_1500 253
145 3300005546 Ga0070696_100063471 Ga0070696_1000634713 254
146 3300037312 Ga0395899_0181589 Ga0395899_0181589_211_1080 254
147 3300037418 Ga0395900_0003952 Ga0395900_0003952_9594_10463 254
148 3300037418 Ga0395900_0031577 Ga0395900_0031577_4007_4876 254
149 3300037471 Ga0395905_0039152 Ga0395905_0039152_1228_2097 254
150 3300038443 Ga0395901_0006236 Ga0395901_0006236_10632_11501 254
151 3300038443 Ga0395901_0081578 Ga0395901_0081578_836_1705 254
152 3300005331 Ga0070670_100270661 Ga0070670_1002706612 255
153 3300005539 Ga0068853_100168269 Ga0068853_1001682693 255
154 3300025925 Ga0207650_10353095 Ga0207650_103530952 255
155 3300025937 Ga0207669_10324367 Ga0207669_103243671 255
156 3300025972 Ga0207668_10057467 Ga0207668_100574672 255
157 3300026041 Ga0207639_10182196 Ga0207639_101821962 255
158 3300026142 Ga0207698_10483228 Ga0207698_104832282 256
159 3300037312 Ga0395899_0046217 Ga0395899_0046217_353_1228 256
160 3300037418 Ga0395900_0060046 Ga0395900_0060046_1720_2595 256
161 3300037471 Ga0395905_0023354 Ga0395905_0023354_2067_2942 256
162 3300038443 Ga0395901_0015289 Ga0395901_0015289_3031_3906 256
163 3300005331 Ga0070670_100020181 Ga0070670_1000201815 257
164 3300005355 Ga0070671_100011834 Ga0070671_1000118346 257
165 3300005841 Ga0068863_100011392 Ga0068863_1000113928 257
166 3300009177 Ga0105248_10031122 Ga0105248_100311224 257
167 3300025925 Ga0207650_10256459 Ga0207650_102564592 257
168 3300025931 Ga0207644_10000138 Ga0207644_1000013850 257
169 3300025941 Ga0207711_10001163 Ga0207711_1000116320 257
170 3300026095 Ga0207676_10010750 Ga0207676_100107504 257
171 3300048912 Ga0496109_0002117 Ga0496109_0002117_228_1097 257
172 3300048915 Ga0496112_0001994 Ga0496112_0001994_5852_6721 257
173 3300005347 Ga0070668_100183768 Ga0070668_1001837682 258
174 3300005355 Ga0070671_100021220 Ga0070671_1000212205 258
175 3300009177 Ga0105248_10006386 Ga0105248_1000638611 258
176 3300009553 Ga0105249_10451293 Ga0105249_104512932 258
177 3300025941 Ga0207711_10129799 Ga0207711_101297992 258
178 3300031824 Ga0307413_10051060 Ga0307413_100510603 258
179 3300031852 Ga0307410_10079353 Ga0307410_100793532 258
180 3300031903 Ga0307407_10205504 Ga0307407_102055042 258
181 3300032005 Ga0307411_10138757 Ga0307411_101387572 258
182 3300048904 Ga0496101_0043850 Ga0496101_0043850_1015_1884 258
183 3300048909 Ga0496106_0134454 Ga0496106_0134454_866_1735 258
184 3300048910 Ga0496107_0063820 Ga0496107_0063820_260_1129 258
185 3300048917 Ga0496114_0007186 Ga0496114_0007186_6984_7853 258
186 3300048918 Ga0496115_0041532 Ga0496115_0041532_1424_2293 258
187 3300032005 Ga0307411_10040491 Ga0307411_100404913 259
188 3300005331 Ga0070670_100005097 Ga0070670_10000509710 262
189 3300025925 Ga0207650_10017606 Ga0207650_100176064 262
190 3300005618 Ga0068864_100102264 Ga0068864_1001022642 264
191 3300009094 Ga0111539_10157647 Ga0111539_101576472 264
192 3300032004 Ga0307414_10146749 Ga0307414_101467492 266
193 iso_pu_bacteria 2896429255 2896431834 267
194 3300005331 Ga0070670_100001335 Ga0070670_10000133514 268
195 3300005344 Ga0070661_100013723 Ga0070661_1000137234 268
196 3300005356 Ga0070674_100041707 Ga0070674_1000417074 268
197 3300005457 Ga0070662_100155710 Ga0070662_1001557101 268
198 3300005564 Ga0070664_100000849 Ga0070664_10000084925 268
199 3300005618 Ga0068864_100026361 Ga0068864_1000263614 268
200 3300006051 Ga0075364_10186612 Ga0075364_101866122 268
201 3300025920 Ga0207649_10011307 Ga0207649_100113074 268
202 3300025925 Ga0207650_10029028 Ga0207650_100290284 268
203 3300025933 Ga0207706_10156825 Ga0207706_101568252 268
204 3300025945 Ga0207679_10025785 Ga0207679_100257854 268
205 3300026121 Ga0207683_10065725 Ga0207683_100657254 268
206 3300046525 Ga0495663_0036686 Ga0495663_0036686_491_1357 268
207 3300050491 nmdc:mga00v17_233450_c1 nmdc:mga00v17_233450_c1_184_1056 268
208 3300061719 Ga0466962_0115257 Ga0466962_0115257_252_1121 268
209 3300046537 Ga0495598_0030011 Ga0495598_0030011_345_1211 269
210 3300046558 Ga0495633_0019241 Ga0495633_0019241_513_1379 269
211 2162886012 MBSR1b_contig_6947300 MBSR1b_0721.00000900 270
212 3300005293 Ga0065715_10004520 Ga0065715_100045203 270
213 3300005328 Ga0070676_10014438 Ga0070676_100144384 270
214 3300005330 Ga0070690_100138715 Ga0070690_1001387152 270
215 3300005331 Ga0070670_100012617 Ga0070670_1000126174 270
216 3300005347 Ga0070668_100013179 Ga0070668_1000131796 270
217 3300005347 Ga0070668_100149996 Ga0070668_1001499962 270
218 3300005353 Ga0070669_100017560 Ga0070669_1000175604 270
219 3300005354 Ga0070675_100003250 Ga0070675_1000032504 270
220 3300005356 Ga0070674_100021255 Ga0070674_1000212553 270
221 3300005364 Ga0070673_100007664 Ga0070673_1000076646 270
222 3300005455 Ga0070663_100038411 Ga0070663_1000384113 270
223 3300005456 Ga0070678_100002909 Ga0070678_1000029096 270
224 3300005457 Ga0070662_100010487 Ga0070662_1000104874 270
225 3300005459 Ga0068867_100013826 Ga0068867_1000138266 270
226 3300005543 Ga0070672_100005595 Ga0070672_1000055954 270
227 3300005578 Ga0068854_100033020 Ga0068854_1000330204 270
228 3300005617 Ga0068859_100069278 Ga0068859_1000692784 270
229 3300005719 Ga0068861_100053121 Ga0068861_1000531212 270
230 3300005844 Ga0068862_100097285 Ga0068862_1000972853 270
231 3300006931 Ga0097620_100069275 Ga0097620_1000692753 270
232 3300009553 Ga0105249_10390873 Ga0105249_103908732 270
233 3300014326 Ga0157380_10140191 Ga0157380_101401913 270
234 3300017792 Ga0163161_10013343 Ga0163161_100133435 270
235 3300025315 Ga0207697_10000969 Ga0207697_1000096917 270
236 3300025893 Ga0207682_10000494 Ga0207682_1000049410 270
237 3300025901 Ga0207688_10149726 Ga0207688_101497262 270
238 3300025923 Ga0207681_10008796 Ga0207681_100087965 270
239 3300025926 Ga0207659_10013644 Ga0207659_100136444 270
240 3300025933 Ga0207706_10000276 Ga0207706_100002765 270
241 3300025937 Ga0207669_10021869 Ga0207669_100218692 270
242 3300025940 Ga0207691_10035726 Ga0207691_100357263 270
243 3300025945 Ga0207679_10095305 Ga0207679_100953053 270
244 3300025972 Ga0207668_10004430 Ga0207668_100044305 270
245 3300025981 Ga0207640_10110868 Ga0207640_101108683 270
246 3300026067 Ga0207678_10020251 Ga0207678_100202514 270
247 3300026089 Ga0207648_10036823 Ga0207648_100368234 270
248 3300026118 Ga0207675_100008969 Ga0207675_1000089698 270
249 3300026121 Ga0207683_10004703 Ga0207683_100047039 270
250 3300028380 Ga0268265_10184199 Ga0268265_101841991 270
251 3300028381 Ga0268264_10306344 Ga0268264_103063442 270
252 3300032002 Ga0307416_100088120 Ga0307416_1000881203 270
253 3300042004 Ga0439445_0004007 Ga0439445_0004007_2446_3312 270
254 3300046525 Ga0495663_0000955 Ga0495663_0000955_6513_7379 270
255 3300046525 Ga0495663_0045449 Ga0495663_0045449_261_1127 270
256 3300046525 Ga0495663_0064946 Ga0495663_0064946_163_1029 270
257 3300046537 Ga0495598_0013977 Ga0495598_0013977_542_1408 270
258 3300046537 Ga0495598_0102876 Ga0495598_0102876_65_931 270
259 3300046539 Ga0495621_0008584 Ga0495621_0008584_677_1543 270
260 3300046558 Ga0495633_0013578 Ga0495633_0013578_1832_2698 270
261 3300046664 Ga0495659_0002834 Ga0495659_0002834_4066_4932 270
262 3300046691 Ga0495670_0006037 Ga0495670_0006037_5019_5885 270
263 3300046691 Ga0495670_0021371 Ga0495670_0021371_1513_2379 270
264 3300046691 Ga0495670_0043165 Ga0495670_0043165_962_1828 270
265 3300047445 Ga0495677_0019890 Ga0495677_0019890_978_1844 270
266 3300050511 nmdc:mga08y16_155987_c1 nmdc:mga08y16_155987_c1_836_1702 270

Feature Viewer

pLDDT pTM Quality
65.45 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map