F373790
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 145 | 265 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300005293|Ga0065715_10004520|Ga0065715_100045203 |
| Length | 288 |
| Sequence | MNSFAISDADRRLIPSSGLRGPVPLLIAIMTFVMVVVAAAGLALANTGAVIRAGVEHRYSIQIADGAAKAPAAIAAARAQPGVGRVNQVDPAELRRTLERWLGPASAEADLPLPAVIDVDLKPGADPAAVASAIRKAVPSARFVGHRTSLAPLLKALRGLTLLAMGLVLMIALAXXXXIVLAARGALDTHRGTIEVMHGIGATDEQVVRLFVRQIAVDALLGGMAGAAAAGLTIALIIGGAGTATMLAGAPPLGWNDAIWLLMLPLAIALLATQVARIALVRALRERL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 114 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 122 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 123 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 124 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 125 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 134 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 135 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 138 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 139 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 140 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 142 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0 |
| Isolates | 0.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 3.01 |
| Rhizosphere | 95.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_6947300 | 2162886012 | Bacteria | 1277 |
| 2 | JGI24741J21665_1011965 | 3300001915 | Bacteria | 1504 |
| 3 | JGI24740J21852_10000820 | 3300001979 | Bacteria | 13657 |
| 4 | Ga0065715_10004520 | 3300005293 | Bacteria | 3515 |
| 5 | Ga0070658_10000256 | 3300005327 | Bacteria | 46854 |
| 6 | Ga0070658_10216770 | 3300005327 | Bacteria | 1618 |
| 7 | Ga0070676_10014438 | 3300005328 | Bacteria | 4340 |
| 8 | Ga0070683_100002147 | 3300005329 | Bacteria | 15585 |
| 9 | Ga0070690_100138715 | 3300005330 | Bacteria | 1649 |
| 10 | Ga0070670_100001335 | 3300005331 | Bacteria | 19717 |
| 11 | Ga0070670_100005097 | 3300005331 | Bacteria | 11057 |
| 12 | Ga0070670_100012617 | 3300005331 | Bacteria | 7234 |
| 13 | Ga0070670_100020181 | 3300005331 | Bacteria | 5725 |
| 14 | Ga0070670_100038733 | 3300005331 | Bacteria | 4099 |
| 15 | Ga0070670_100270661 | 3300005331 | Bacteria | 1482 |
| 16 | Ga0070666_10119166 | 3300005335 | Bacteria | 1829 |
| 17 | Ga0070680_100000105 | 3300005336 | Bacteria | 48515 |
| 18 | Ga0068868_100034443 | 3300005338 | Bacteria | 3909 |
| 19 | Ga0070660_100000064 | 3300005339 | Bacteria | 62554 |
| 20 | Ga0070660_100064006 | 3300005339 | Bacteria | 2860 |
| 21 | Ga0070660_100314759 | 3300005339 | Bacteria | 1285 |
| 22 | Ga0070661_100013723 | 3300005344 | Bacteria | 5691 |
| 23 | Ga0070661_100031564 | 3300005344 | Bacteria | 3832 |
| 24 | Ga0070661_100066236 | 3300005344 | Bacteria | 2654 |
| 25 | Ga0070661_100071027 | 3300005344 | Bacteria | 2561 |
| 26 | Ga0070692_10017485 | 3300005345 | Bacteria | 3429 |
| 27 | Ga0070668_100013179 | 3300005347 | Bacteria | 6164 |
| 28 | Ga0070668_100149996 | 3300005347 | Bacteria | 1884 |
| 29 | Ga0070668_100183768 | 3300005347 | Bacteria | 1709 |
| 30 | Ga0070669_100017560 | 3300005353 | Bacteria | 5104 |
| 31 | Ga0070675_100003250 | 3300005354 | Bacteria | 12310 |
| 32 | Ga0070671_100011834 | 3300005355 | Bacteria | 7019 |
| 33 | Ga0070671_100021220 | 3300005355 | Bacteria | 5304 |
| 34 | Ga0070671_100103844 | 3300005355 | Bacteria | 2385 |
| 35 | Ga0070674_100021255 | 3300005356 | Bacteria | 4162 |
| 36 | Ga0070674_100041707 | 3300005356 | Bacteria | 3113 |
| 37 | Ga0070673_100007664 | 3300005364 | Bacteria | 7140 |
| 38 | Ga0070659_100031240 | 3300005366 | Bacteria | 4124 |
| 39 | Ga0070659_100052843 | 3300005366 | Bacteria | 3196 |
| 40 | Ga0070659_100103763 | 3300005366 | Bacteria | 2290 |
| 41 | Ga0070714_100044099 | 3300005435 | Bacteria | 3775 |
| 42 | Ga0070714_100119907 | 3300005435 | Bacteria | 2339 |
| 43 | Ga0070713_100016291 | 3300005436 | Bacteria | 5587 |
| 44 | Ga0070713_100050382 | 3300005436 | Bacteria | 3440 |
| 45 | Ga0070663_100036551 | 3300005455 | Bacteria | 3412 |
| 46 | Ga0070663_100038411 | 3300005455 | Bacteria | 3340 |
| 47 | Ga0070678_100002909 | 3300005456 | Bacteria | 9486 |
| 48 | Ga0070662_100010487 | 3300005457 | Bacteria | 6084 |
| 49 | Ga0070662_100098645 | 3300005457 | Bacteria | 2207 |
| 50 | Ga0070662_100155710 | 3300005457 | Bacteria | 1784 |
| 51 | Ga0070681_10050209 | 3300005458 | Bacteria | 4163 |
| 52 | Ga0070681_10156813 | 3300005458 | Bacteria | 2201 |
| 53 | Ga0068867_100013826 | 3300005459 | Bacteria | 5713 |
| 54 | Ga0068867_100046865 | 3300005459 | Bacteria | 3176 |
| 55 | Ga0070679_100000125 | 3300005530 | Bacteria | 61348 |
| 56 | Ga0068853_100168269 | 3300005539 | Bacteria | 1982 |
| 57 | Ga0068853_100360465 | 3300005539 | Bacteria | 1354 |
| 58 | Ga0070672_100005595 | 3300005543 | Bacteria | 8355 |
| 59 | Ga0070695_100006471 | 3300005545 | Bacteria | 6925 |
| 60 | Ga0070696_100063471 | 3300005546 | Bacteria | 2587 |
| 61 | Ga0070696_100111422 | 3300005546 | Bacteria | 1971 |
| 62 | Ga0070704_100127983 | 3300005549 | Bacteria | 1963 |
| 63 | Ga0068855_100016190 | 3300005563 | Bacteria | 8966 |
| 64 | Ga0070664_100000849 | 3300005564 | Bacteria | 23590 |
| 65 | Ga0070664_100002063 | 3300005564 | Bacteria | 16046 |
| 66 | Ga0070664_100069220 | 3300005564 | Bacteria | 3019 |
| 67 | Ga0070664_100244948 | 3300005564 | Bacteria | 1610 |
| 68 | Ga0068857_100520618 | 3300005577 | Bacteria | 1118 |
| 69 | Ga0068854_100004966 | 3300005578 | Bacteria | 8385 |
| 70 | Ga0068854_100021812 | 3300005578 | Bacteria | 4352 |
| 71 | Ga0068854_100033020 | 3300005578 | Bacteria | 3605 |
| 72 | Ga0068856_100001220 | 3300005614 | Bacteria | 26928 |
| 73 | Ga0068856_100419231 | 3300005614 | Bacteria | 1359 |
| 74 | Ga0068852_100123101 | 3300005616 | Bacteria | 2378 |
| 75 | Ga0068859_100069278 | 3300005617 | Bacteria | 3562 |
| 76 | Ga0068864_100026361 | 3300005618 | Bacteria | 4903 |
| 77 | Ga0068864_100102264 | 3300005618 | Bacteria | 2543 |
| 78 | Ga0068861_100053121 | 3300005719 | Bacteria | 3082 |
| 79 | Ga0068863_100011392 | 3300005841 | Bacteria | 8604 |
| 80 | Ga0068863_100021346 | 3300005841 | Bacteria | 6180 |
| 81 | Ga0068863_100166154 | 3300005841 | Bacteria | 2116 |
| 82 | Ga0068862_100097285 | 3300005844 | Bacteria | 2570 |
| 83 | Ga0070717_10055953 | 3300006028 | Bacteria | 3257 |
| 84 | Ga0075364_10186612 | 3300006051 | Bacteria | 1404 |
| 85 | Ga0075431_100009478 | 3300006847 | Bacteria | 9776 |
| 86 | Ga0075429_100183298 | 3300006880 | Bacteria | 1835 |
| 87 | Ga0097620_100016663 | 3300006931 | Bacteria | 7378 |
| 88 | Ga0097620_100069275 | 3300006931 | Bacteria | 3562 |
| 89 | Ga0111539_10157647 | 3300009094 | Bacteria | 2656 |
| 90 | Ga0105241_10342710 | 3300009174 | Bacteria | 1295 |
| 91 | Ga0105248_10006386 | 3300009177 | Bacteria | 12938 |
| 92 | Ga0105248_10031122 | 3300009177 | Bacteria | 5963 |
| 93 | Ga0105237_10355580 | 3300009545 | Bacteria | 1469 |
| 94 | Ga0105249_10390873 | 3300009553 | Bacteria | 1419 |
| 95 | Ga0105249_10451293 | 3300009553 | Bacteria | 1325 |
| 96 | Ga0157373_10112934 | 3300013100 | Bacteria | 1909 |
| 97 | Ga0157370_10010104 | 3300013104 | Bacteria | 9968 |
| 98 | Ga0157370_10119384 | 3300013104 | Bacteria | 2462 |
| 99 | Ga0157369_10011511 | 3300013105 | Bacteria | 10049 |
| 100 | Ga0157378_10471553 | 3300013297 | Bacteria | 1249 |
| 101 | Ga0157372_10367673 | 3300013307 | Bacteria | 1676 |
| 102 | Ga0157380_10140191 | 3300014326 | Bacteria | 2076 |
| 103 | Ga0163161_10013343 | 3300017792 | Bacteria | 5715 |
| 104 | Ga0207697_10000969 | 3300025315 | Bacteria | 16134 |
| 105 | Ga0207682_10000494 | 3300025893 | Bacteria | 18198 |
| 106 | Ga0207688_10149726 | 3300025901 | Bacteria | 1378 |
| 107 | Ga0207647_10033341 | 3300025904 | Bacteria | 3298 |
| 108 | Ga0207705_10000067 | 3300025909 | Bacteria | 136004 |
| 109 | Ga0207707_10014856 | 3300025912 | Bacteria | 6780 |
| 110 | Ga0207695_10094901 | 3300025913 | Bacteria | 2989 |
| 111 | Ga0207660_10000379 | 3300025917 | Bacteria | 29073 |
| 112 | Ga0207657_10019943 | 3300025919 | Bacteria | 6352 |
| 113 | Ga0207657_10041930 | 3300025919 | Bacteria | 4042 |
| 114 | Ga0207657_10065188 | 3300025919 | Bacteria | 3106 |
| 115 | Ga0207657_10432511 | 3300025919 | Unclassified | 1034 |
| 116 | Ga0207649_10011307 | 3300025920 | Bacteria | 4919 |
| 117 | Ga0207649_10045369 | 3300025920 | Bacteria | 2694 |
| 118 | Ga0207652_10000058 | 3300025921 | Bacteria | 113620 |
| 119 | Ga0207681_10008796 | 3300025923 | Bacteria | 6168 |
| 120 | Ga0207650_10017606 | 3300025925 | Bacteria | 5005 |
| 121 | Ga0207650_10029028 | 3300025925 | Bacteria | 3972 |
| 122 | Ga0207650_10132950 | 3300025925 | Bacteria | 1949 |
| 123 | Ga0207650_10256459 | 3300025925 | Bacteria | 1417 |
| 124 | Ga0207650_10353095 | 3300025925 | Bacteria | 1210 |
| 125 | Ga0207659_10013644 | 3300025926 | Bacteria | 5212 |
| 126 | Ga0207664_10165161 | 3300025929 | Bacteria | 1891 |
| 127 | Ga0207644_10000138 | 3300025931 | Bacteria | 52145 |
| 128 | Ga0207690_10044073 | 3300025932 | Bacteria | 2939 |
| 129 | Ga0207706_10000276 | 3300025933 | Bacteria | 55889 |
| 130 | Ga0207706_10085028 | 3300025933 | Bacteria | 2781 |
| 131 | Ga0207706_10156825 | 3300025933 | Bacteria | 2001 |
| 132 | Ga0207706_10267100 | 3300025933 | Bacteria | 1493 |
| 133 | Ga0207669_10021869 | 3300025937 | Bacteria | 3386 |
| 134 | Ga0207669_10324367 | 3300025937 | Bacteria | 1180 |
| 135 | Ga0207665_10049051 | 3300025939 | Bacteria | 2836 |
| 136 | Ga0207691_10035726 | 3300025940 | Bacteria | 4609 |
| 137 | Ga0207711_10001163 | 3300025941 | Bacteria | 25054 |
| 138 | Ga0207711_10129799 | 3300025941 | Bacteria | 2259 |
| 139 | Ga0207661_10024457 | 3300025944 | Bacteria | 4579 |
| 140 | Ga0207679_10025785 | 3300025945 | Bacteria | 4047 |
| 141 | Ga0207679_10027981 | 3300025945 | Bacteria | 3906 |
| 142 | Ga0207679_10095305 | 3300025945 | Bacteria | 2313 |
| 143 | Ga0207679_10321985 | 3300025945 | Bacteria | 1339 |
| 144 | Ga0207667_10000828 | 3300025949 | Bacteria | 39983 |
| 145 | Ga0207668_10004430 | 3300025972 | Bacteria | 8246 |
| 146 | Ga0207668_10057467 | 3300025972 | Bacteria | 2714 |
| 147 | Ga0207640_10036970 | 3300025981 | Bacteria | 3069 |
| 148 | Ga0207640_10071631 | 3300025981 | Bacteria | 2335 |
| 149 | Ga0207640_10110868 | 3300025981 | Bacteria | 1945 |
| 150 | Ga0207639_10182196 | 3300026041 | Bacteria | 1787 |
| 151 | Ga0207639_10322347 | 3300026041 | Bacteria | 1372 |
| 152 | Ga0207678_10002816 | 3300026067 | Bacteria | 15773 |
| 153 | Ga0207678_10020251 | 3300026067 | Bacteria | 5838 |
| 154 | Ga0207678_10021079 | 3300026067 | Bacteria | 5713 |
| 155 | Ga0207678_10293173 | 3300026067 | Bacteria | 1397 |
| 156 | Ga0207702_10001153 | 3300026078 | Bacteria | 27012 |
| 157 | Ga0207702_10150179 | 3300026078 | Bacteria | 2118 |
| 158 | Ga0207641_10051301 | 3300026088 | Bacteria | 3493 |
| 159 | Ga0207641_10108242 | 3300026088 | Bacteria | 2460 |
| 160 | Ga0207648_10036823 | 3300026089 | Bacteria | 4310 |
| 161 | Ga0207648_10061680 | 3300026089 | Bacteria | 3269 |
| 162 | Ga0207676_10010750 | 3300026095 | Bacteria | 6525 |
| 163 | Ga0207674_10328482 | 3300026116 | Bacteria | 1479 |
| 164 | Ga0207675_100008969 | 3300026118 | Bacteria | 9384 |
| 165 | Ga0207683_10004703 | 3300026121 | Bacteria | 11769 |
| 166 | Ga0207683_10065725 | 3300026121 | Bacteria | 3198 |
| 167 | Ga0207698_10058216 | 3300026142 | Bacteria | 2994 |
| 168 | Ga0207698_10483228 | 3300026142 | Unclassified | 1202 |
| 169 | Ga0268265_10184199 | 3300028380 | Bacteria | 1797 |
| 170 | Ga0268264_10306344 | 3300028381 | Bacteria | 1497 |
| 171 | Ga0307408_100165545 | 3300031548 | Bacteria | 1760 |
| 172 | Ga0307413_10012008 | 3300031824 | Bacteria | 4290 |
| 173 | Ga0307413_10051060 | 3300031824 | Bacteria | 2489 |
| 174 | Ga0307413_10124809 | 3300031824 | Bacteria | 1751 |
| 175 | Ga0307410_10079353 | 3300031852 | Bacteria | 2299 |
| 176 | Ga0307410_10353812 | 3300031852 | Bacteria | 1174 |
| 177 | Ga0307407_10205504 | 3300031903 | Bacteria | 1322 |
| 178 | Ga0307412_10066668 | 3300031911 | Bacteria | 2441 |
| 179 | Ga0307412_10415261 | 3300031911 | Unclassified | 1099 |
| 180 | Ga0307409_100008719 | 3300031995 | Bacteria | 6179 |
| 181 | Ga0307409_100420963 | 3300031995 | Bacteria | 1281 |
| 182 | Ga0307409_100455388 | 3300031995 | Bacteria | 1236 |
| 183 | Ga0307416_100088120 | 3300032002 | Bacteria | 2653 |
| 184 | Ga0307416_100266878 | 3300032002 | Bacteria | 1677 |
| 185 | Ga0307414_10004982 | 3300032004 | Bacteria | 7263 |
| 186 | Ga0307414_10018385 | 3300032004 | Bacteria | 4302 |
| 187 | Ga0307414_10022979 | 3300032004 | Bacteria | 3945 |
| 188 | Ga0307414_10114629 | 3300032004 | Bacteria | 2059 |
| 189 | Ga0307414_10146749 | 3300032004 | Bacteria | 1855 |
| 190 | Ga0307414_10176081 | 3300032004 | Bacteria | 1715 |
| 191 | Ga0307414_10206675 | 3300032004 | Bacteria | 1601 |
| 192 | Ga0307411_10011766 | 3300032005 | Bacteria | 4740 |
| 193 | Ga0307411_10040491 | 3300032005 | Bacteria | 2956 |
| 194 | Ga0307411_10059715 | 3300032005 | Bacteria | 2529 |
| 195 | Ga0307411_10138757 | 3300032005 | Bacteria | 1789 |
| 196 | Ga0307415_100080767 | 3300032126 | Bacteria | 2321 |
| 197 | Ga0307415_100218739 | 3300032126 | Bacteria | 1525 |
| 198 | Ga0373941_0113443 | 3300035115 | Bacteria | 958 |
| 199 | Ga0395899_0008223 | 3300037312 | Bacteria | 8036 |
| 200 | Ga0395899_0025675 | 3300037312 | Bacteria | 4447 |
| 201 | Ga0395899_0043242 | 3300037312 | Bacteria | 3361 |
| 202 | Ga0395899_0046217 | 3300037312 | Bacteria | 3243 |
| 203 | Ga0395899_0080280 | 3300037312 | Bacteria | 2374 |
| 204 | Ga0395899_0173849 | 3300037312 | Bacteria | 1515 |
| 205 | Ga0395899_0181589 | 3300037312 | Bacteria | 1477 |
| 206 | Ga0395900_0002103 | 3300037418 | Bacteria | 22302 |
| 207 | Ga0395900_0003952 | 3300037418 | Bacteria | 15826 |
| 208 | Ga0395900_0011120 | 3300037418 | Bacteria | 9198 |
| 209 | Ga0395900_0016290 | 3300037418 | Bacteria | 7577 |
| 210 | Ga0395900_0031577 | 3300037418 | Bacteria | 5444 |
| 211 | Ga0395900_0060046 | 3300037418 | Bacteria | 3914 |
| 212 | Ga0395900_0089276 | 3300037418 | Bacteria | 3168 |
| 213 | Ga0395900_0653775 | 3300037418 | Bacteria | 987 |
| 214 | Ga0395898_0101767 | 3300037466 | Bacteria | 2758 |
| 215 | Ga0395905_0001572 | 3300037471 | Bacteria | 27278 |
| 216 | Ga0395905_0010599 | 3300037471 | Bacteria | 8948 |
| 217 | Ga0395905_0023354 | 3300037471 | Bacteria | 5845 |
| 218 | Ga0395905_0039152 | 3300037471 | Bacteria | 4447 |
| 219 | Ga0395905_0070942 | 3300037471 | Bacteria | 3265 |
| 220 | Ga0395905_0273358 | 3300037471 | Unclassified | 1575 |
| 221 | Ga0395905_0472755 | 3300037471 | Bacteria | 1152 |
| 222 | Ga0395901_0006236 | 3300038443 | Bacteria | 12089 |
| 223 | Ga0395901_0011353 | 3300038443 | Bacteria | 9026 |
| 224 | Ga0395901_0015289 | 3300038443 | Bacteria | 7809 |
| 225 | Ga0395901_0061072 | 3300038443 | Bacteria | 3922 |
| 226 | Ga0395901_0081578 | 3300038443 | Bacteria | 3378 |
| 227 | Ga0395901_0108603 | 3300038443 | Bacteria | 2912 |
| 228 | Ga0395901_0128611 | 3300038443 | Bacteria | 2662 |
| 229 | Ga0395901_0133127 | 3300038443 | Bacteria | 2612 |
| 230 | Ga0395901_0272229 | 3300038443 | Bacteria | 1761 |
| 231 | Ga0436365_0899740 | 3300039437 | Bacteria | 3358 |
| 232 | Ga0439445_0004007 | 3300042004 | Bacteria | 3324 |
| 233 | Ga0450905_000113 | 3300042142 | Bacteria | 8096 |
| 234 | Ga0450889_000213 | 3300042144 | Bacteria | 6335 |
| 235 | Ga0466967_0040653 | 3300045976 | Bacteria | 4005 |
| 236 | Ga0495663_0000955 | 3300046525 | Bacteria | 9626 |
| 237 | Ga0495663_0036686 | 3300046525 | Bacteria | 1476 |
| 238 | Ga0495663_0045449 | 3300046525 | Bacteria | 1346 |
| 239 | Ga0495663_0064946 | 3300046525 | Bacteria | 1153 |
| 240 | Ga0495598_0013977 | 3300046537 | Bacteria | 2000 |
| 241 | Ga0495598_0030011 | 3300046537 | Bacteria | 1520 |
| 242 | Ga0495598_0102876 | 3300046537 | Bacteria | 947 |
| 243 | Ga0495621_0008584 | 3300046539 | Bacteria | 3071 |
| 244 | Ga0495621_0226919 | 3300046539 | Bacteria | 757 |
| 245 | Ga0495633_0013578 | 3300046558 | Bacteria | 4286 |
| 246 | Ga0495633_0019241 | 3300046558 | Bacteria | 3454 |
| 247 | Ga0495659_0002834 | 3300046664 | Bacteria | 5569 |
| 248 | Ga0495670_0006037 | 3300046691 | Bacteria | 5934 |
| 249 | Ga0495670_0021371 | 3300046691 | Bacteria | 3191 |
| 250 | Ga0495670_0043165 | 3300046691 | Bacteria | 2250 |
| 251 | Ga0495677_0019890 | 3300047445 | Bacteria | 2434 |
| 252 | Ga0496101_0043850 | 3300048904 | Bacteria | 3198 |
| 253 | Ga0496106_0134454 | 3300048909 | Bacteria | 1941 |
| 254 | Ga0496107_0063820 | 3300048910 | Bacteria | 2669 |
| 255 | Ga0496108_0525966 | 3300048911 | Bacteria | 1032 |
| 256 | Ga0496109_0002117 | 3300048912 | Bacteria | 16511 |
| 257 | Ga0496112_0001994 | 3300048915 | Bacteria | 16154 |
| 258 | Ga0496114_0007186 | 3300048917 | Bacteria | 8788 |
| 259 | Ga0496115_0041532 | 3300048918 | Bacteria | 3661 |
| 260 | Ga0501068_0090879 | 3300049584 | Bacteria | 1884 |
| 261 | nmdc:mga00v17_233450_c1 | 3300050491 | Bacteria | 1192 |
| 262 | nmdc:mga09592_184655_c1 | 3300050508 | Bacteria | 1804 |
| 263 | nmdc:mga06r32_63335_c1 | 3300050510 | Bacteria | 3564 |
| 264 | nmdc:mga08y16_155987_c1 | 3300050511 | Bacteria | 2372 |
| 265 | Ga0466962_0115257 | 3300061719 | Unclassified | 1295 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046539 | Ga0495621_0226919 | Ga0495621_0226919_16_636 | 188 |
| 2 | 3300006931 | Ga0097620_100016663 | Ga0097620_1000166634 | 217 |
| 3 | 3300025919 | Ga0207657_10432511 | Ga0207657_104325112 | 217 |
| 4 | 3300037418 | Ga0395900_0653775 | Ga0395900_0653775_125_916 | 217 |
| 5 | 3300037471 | Ga0395905_0273358 | Ga0395905_0273358_72_863 | 217 |
| 6 | 3300037471 | Ga0395905_0472755 | Ga0395905_0472755_290_1081 | 217 |
| 7 | 3300038443 | Ga0395901_0272229 | Ga0395901_0272229_82_951 | 221 |
| 8 | 3300037418 | Ga0395900_0016290 | Ga0395900_0016290_6768_7547 | 222 |
| 9 | 3300035115 | Ga0373941_0113443 | Ga0373941_0113443_202_945 | 227 |
| 10 | 3300031824 | Ga0307413_10012008 | Ga0307413_100120084 | 229 |
| 11 | 3300031995 | Ga0307409_100008719 | Ga0307409_1000087194 | 229 |
| 12 | 3300032002 | Ga0307416_100266878 | Ga0307416_1002668782 | 229 |
| 13 | 3300032004 | Ga0307414_10022979 | Ga0307414_100229793 | 229 |
| 14 | 3300048911 | Ga0496108_0525966 | Ga0496108_0525966_34_825 | 232 |
| 15 | 3300032126 | Ga0307415_100080767 | Ga0307415_1000807673 | 233 |
| 16 | 3300005339 | Ga0070660_100064006 | Ga0070660_1000640062 | 234 |
| 17 | 3300005366 | Ga0070659_100052843 | Ga0070659_1000528433 | 234 |
| 18 | 3300006847 | Ga0075431_100009478 | Ga0075431_1000094787 | 234 |
| 19 | 3300025919 | Ga0207657_10065188 | Ga0207657_100651882 | 234 |
| 20 | 3300050510 | nmdc:mga06r32_63335_c1 | nmdc:mga06r32_63335_c1_760_1629 | 234 |
| 21 | 3300013105 | Ga0157369_10011511 | Ga0157369_100115114 | 237 |
| 22 | 3300031824 | Ga0307413_10124809 | Ga0307413_101248091 | 237 |
| 23 | 3300031995 | Ga0307409_100455388 | Ga0307409_1004553881 | 237 |
| 24 | 3300031852 | Ga0307410_10353812 | Ga0307410_103538122 | 239 |
| 25 | 3300031911 | Ga0307412_10066668 | Ga0307412_100666682 | 239 |
| 26 | 3300032004 | Ga0307414_10114629 | Ga0307414_101146292 | 239 |
| 27 | 3300032005 | Ga0307411_10059715 | Ga0307411_100597152 | 239 |
| 28 | 3300005327 | Ga0070658_10216770 | Ga0070658_102167702 | 242 |
| 29 | 3300005344 | Ga0070661_100071027 | Ga0070661_1000710272 | 242 |
| 30 | 3300005614 | Ga0068856_100419231 | Ga0068856_1004192312 | 242 |
| 31 | 3300013100 | Ga0157373_10112934 | Ga0157373_101129342 | 242 |
| 32 | 3300025913 | Ga0207695_10094901 | Ga0207695_100949012 | 242 |
| 33 | 3300025929 | Ga0207664_10165161 | Ga0207664_101651612 | 242 |
| 34 | 3300026078 | Ga0207702_10150179 | Ga0207702_101501793 | 242 |
| 35 | 3300037312 | Ga0395899_0080280 | Ga0395899_0080280_500_1369 | 242 |
| 36 | 3300038443 | Ga0395901_0133127 | Ga0395901_0133127_1043_1912 | 242 |
| 37 | 3300025933 | Ga0207706_10085028 | Ga0207706_100850283 | 243 |
| 38 | 3300031548 | Ga0307408_100165545 | Ga0307408_1001655453 | 243 |
| 39 | 3300005331 | Ga0070670_100038733 | Ga0070670_1000387333 | 244 |
| 40 | 3300025925 | Ga0207650_10132950 | Ga0207650_101329502 | 244 |
| 41 | 3300032126 | Ga0307415_100218739 | Ga0307415_1002187392 | 245 |
| 42 | 3300031911 | Ga0307412_10415261 | Ga0307412_104152612 | 247 |
| 43 | 3300032004 | Ga0307414_10018385 | Ga0307414_100183852 | 247 |
| 44 | 3300009545 | Ga0105237_10355580 | Ga0105237_103555801 | 248 |
| 45 | 3300013104 | Ga0157370_10119384 | Ga0157370_101193843 | 248 |
| 46 | 3300005564 | Ga0070664_100069220 | Ga0070664_1000692203 | 250 |
| 47 | 3300005841 | Ga0068863_100021346 | Ga0068863_1000213462 | 250 |
| 48 | 3300026088 | Ga0207641_10051301 | Ga0207641_100513014 | 250 |
| 49 | 3300026116 | Ga0207674_10328482 | Ga0207674_103284822 | 250 |
| 50 | 3300049584 | Ga0501068_0090879 | Ga0501068_0090879_1000_1872 | 250 |
| 51 | 3300032004 | Ga0307414_10176081 | Ga0307414_101760813 | 251 |
| 52 | 3300032005 | Ga0307411_10011766 | Ga0307411_100117665 | 251 |
| 53 | 3300037312 | Ga0395899_0173849 | Ga0395899_0173849_316_1185 | 251 |
| 54 | 3300038443 | Ga0395901_0128611 | Ga0395901_0128611_1295_2164 | 251 |
| 55 | 3300001915 | JGI24741J21665_1011965 | JGI24741J21665_10119652 | 252 |
| 56 | 3300001979 | JGI24740J21852_10000820 | JGI24740J21852_1000082010 | 252 |
| 57 | 3300005327 | Ga0070658_10000256 | Ga0070658_1000025648 | 252 |
| 58 | 3300005329 | Ga0070683_100002147 | Ga0070683_1000021474 | 252 |
| 59 | 3300005335 | Ga0070666_10119166 | Ga0070666_101191662 | 252 |
| 60 | 3300005336 | Ga0070680_100000105 | Ga0070680_10000010511 | 252 |
| 61 | 3300005338 | Ga0068868_100034443 | Ga0068868_1000344435 | 252 |
| 62 | 3300005339 | Ga0070660_100000064 | Ga0070660_1000000645 | 252 |
| 63 | 3300005339 | Ga0070660_100314759 | Ga0070660_1003147592 | 252 |
| 64 | 3300005344 | Ga0070661_100031564 | Ga0070661_1000315643 | 252 |
| 65 | 3300005344 | Ga0070661_100066236 | Ga0070661_1000662363 | 252 |
| 66 | 3300005345 | Ga0070692_10017485 | Ga0070692_100174854 | 252 |
| 67 | 3300005355 | Ga0070671_100103844 | Ga0070671_1001038442 | 252 |
| 68 | 3300005366 | Ga0070659_100103763 | Ga0070659_1001037632 | 252 |
| 69 | 3300005435 | Ga0070714_100044099 | Ga0070714_1000440992 | 252 |
| 70 | 3300005435 | Ga0070714_100119907 | Ga0070714_1001199073 | 252 |
| 71 | 3300005436 | Ga0070713_100016291 | Ga0070713_1000162913 | 252 |
| 72 | 3300005436 | Ga0070713_100050382 | Ga0070713_1000503823 | 252 |
| 73 | 3300005455 | Ga0070663_100036551 | Ga0070663_1000365513 | 252 |
| 74 | 3300005457 | Ga0070662_100098645 | Ga0070662_1000986452 | 252 |
| 75 | 3300005458 | Ga0070681_10050209 | Ga0070681_100502093 | 252 |
| 76 | 3300005459 | Ga0068867_100046865 | Ga0068867_1000468652 | 252 |
| 77 | 3300005530 | Ga0070679_100000125 | Ga0070679_10000012552 | 252 |
| 78 | 3300005539 | Ga0068853_100360465 | Ga0068853_1003604652 | 252 |
| 79 | 3300005563 | Ga0068855_100016190 | Ga0068855_1000161905 | 252 |
| 80 | 3300005564 | Ga0070664_100002063 | Ga0070664_10000206320 | 252 |
| 81 | 3300005564 | Ga0070664_100244948 | Ga0070664_1002449482 | 252 |
| 82 | 3300005577 | Ga0068857_100520618 | Ga0068857_1005206182 | 252 |
| 83 | 3300005578 | Ga0068854_100004966 | Ga0068854_1000049665 | 252 |
| 84 | 3300005578 | Ga0068854_100021812 | Ga0068854_1000218126 | 252 |
| 85 | 3300005614 | Ga0068856_100001220 | Ga0068856_10000122026 | 252 |
| 86 | 3300005616 | Ga0068852_100123101 | Ga0068852_1001231012 | 252 |
| 87 | 3300005841 | Ga0068863_100166154 | Ga0068863_1001661543 | 252 |
| 88 | 3300006028 | Ga0070717_10055953 | Ga0070717_100559533 | 252 |
| 89 | 3300009174 | Ga0105241_10342710 | Ga0105241_103427102 | 252 |
| 90 | 3300013104 | Ga0157370_10010104 | Ga0157370_100101047 | 252 |
| 91 | 3300013307 | Ga0157372_10367673 | Ga0157372_103676732 | 252 |
| 92 | 3300025904 | Ga0207647_10033341 | Ga0207647_100333415 | 252 |
| 93 | 3300025909 | Ga0207705_10000067 | Ga0207705_1000006717 | 252 |
| 94 | 3300025912 | Ga0207707_10014856 | Ga0207707_100148565 | 252 |
| 95 | 3300025917 | Ga0207660_10000379 | Ga0207660_1000037926 | 252 |
| 96 | 3300025919 | Ga0207657_10019943 | Ga0207657_100199435 | 252 |
| 97 | 3300025919 | Ga0207657_10041930 | Ga0207657_100419304 | 252 |
| 98 | 3300025920 | Ga0207649_10045369 | Ga0207649_100453693 | 252 |
| 99 | 3300025921 | Ga0207652_10000058 | Ga0207652_1000005851 | 252 |
| 100 | 3300025939 | Ga0207665_10049051 | Ga0207665_100490513 | 252 |
| 101 | 3300025944 | Ga0207661_10024457 | Ga0207661_100244572 | 252 |
| 102 | 3300025945 | Ga0207679_10027981 | Ga0207679_100279815 | 252 |
| 103 | 3300025945 | Ga0207679_10321985 | Ga0207679_103219852 | 252 |
| 104 | 3300025949 | Ga0207667_10000828 | Ga0207667_1000082817 | 252 |
| 105 | 3300025981 | Ga0207640_10036970 | Ga0207640_100369703 | 252 |
| 106 | 3300025981 | Ga0207640_10071631 | Ga0207640_100716314 | 252 |
| 107 | 3300026041 | Ga0207639_10322347 | Ga0207639_103223472 | 252 |
| 108 | 3300026067 | Ga0207678_10002816 | Ga0207678_100028165 | 252 |
| 109 | 3300026067 | Ga0207678_10021079 | Ga0207678_100210794 | 252 |
| 110 | 3300026067 | Ga0207678_10293173 | Ga0207678_102931732 | 252 |
| 111 | 3300026078 | Ga0207702_10001153 | Ga0207702_100011537 | 252 |
| 112 | 3300026088 | Ga0207641_10108242 | Ga0207641_101082422 | 252 |
| 113 | 3300026089 | Ga0207648_10061680 | Ga0207648_100616802 | 252 |
| 114 | 3300026142 | Ga0207698_10058216 | Ga0207698_100582163 | 252 |
| 115 | 3300031995 | Ga0307409_100420963 | Ga0307409_1004209632 | 252 |
| 116 | 3300032004 | Ga0307414_10206675 | Ga0307414_102066752 | 252 |
| 117 | 3300037312 | Ga0395899_0025675 | Ga0395899_0025675_380_1249 | 252 |
| 118 | 3300037312 | Ga0395899_0043242 | Ga0395899_0043242_1166_2038 | 252 |
| 119 | 3300037418 | Ga0395900_0002103 | Ga0395900_0002103_19246_20118 | 252 |
| 120 | 3300037418 | Ga0395900_0089276 | Ga0395900_0089276_861_1730 | 252 |
| 121 | 3300037466 | Ga0395898_0101767 | Ga0395898_0101767_955_1827 | 252 |
| 122 | 3300037471 | Ga0395905_0010599 | Ga0395905_0010599_4861_5730 | 252 |
| 123 | 3300037471 | Ga0395905_0070942 | Ga0395905_0070942_1228_2100 | 252 |
| 124 | 3300038443 | Ga0395901_0011353 | Ga0395901_0011353_6072_6944 | 252 |
| 125 | 3300038443 | Ga0395901_0061072 | Ga0395901_0061072_525_1394 | 252 |
| 126 | 3300039437 | Ga0436365_0899740 | Ga0436365_0899740_1539_2408 | 252 |
| 127 | 3300005366 | Ga0070659_100031240 | Ga0070659_1000312402 | 253 |
| 128 | 3300005458 | Ga0070681_10156813 | Ga0070681_101568132 | 253 |
| 129 | 3300005545 | Ga0070695_100006471 | Ga0070695_1000064714 | 253 |
| 130 | 3300005546 | Ga0070696_100111422 | Ga0070696_1001114222 | 253 |
| 131 | 3300005549 | Ga0070704_100127983 | Ga0070704_1001279833 | 253 |
| 132 | 3300006880 | Ga0075429_100183298 | Ga0075429_1001832982 | 253 |
| 133 | 3300013297 | Ga0157378_10471553 | Ga0157378_104715532 | 253 |
| 134 | 3300025932 | Ga0207690_10044073 | Ga0207690_100440733 | 253 |
| 135 | 3300025933 | Ga0207706_10267100 | Ga0207706_102671002 | 253 |
| 136 | 3300032004 | Ga0307414_10004982 | Ga0307414_100049826 | 253 |
| 137 | 3300037312 | Ga0395899_0008223 | Ga0395899_0008223_2266_3117 | 253 |
| 138 | 3300037418 | Ga0395900_0011120 | Ga0395900_0011120_3735_4604 | 253 |
| 139 | 3300037471 | Ga0395905_0001572 | Ga0395905_0001572_2920_3789 | 253 |
| 140 | 3300038443 | Ga0395901_0108603 | Ga0395901_0108603_118_987 | 253 |
| 141 | 3300042142 | Ga0450905_000113 | Ga0450905_000113_3263_4132 | 253 |
| 142 | 3300042144 | Ga0450889_000213 | Ga0450889_000213_3521_4390 | 253 |
| 143 | 3300045976 | Ga0466967_0040653 | Ga0466967_0040653_1152_2021 | 253 |
| 144 | 3300050508 | nmdc:mga09592_184655_c1 | nmdc:mga09592_184655_c1_631_1500 | 253 |
| 145 | 3300005546 | Ga0070696_100063471 | Ga0070696_1000634713 | 254 |
| 146 | 3300037312 | Ga0395899_0181589 | Ga0395899_0181589_211_1080 | 254 |
| 147 | 3300037418 | Ga0395900_0003952 | Ga0395900_0003952_9594_10463 | 254 |
| 148 | 3300037418 | Ga0395900_0031577 | Ga0395900_0031577_4007_4876 | 254 |
| 149 | 3300037471 | Ga0395905_0039152 | Ga0395905_0039152_1228_2097 | 254 |
| 150 | 3300038443 | Ga0395901_0006236 | Ga0395901_0006236_10632_11501 | 254 |
| 151 | 3300038443 | Ga0395901_0081578 | Ga0395901_0081578_836_1705 | 254 |
| 152 | 3300005331 | Ga0070670_100270661 | Ga0070670_1002706612 | 255 |
| 153 | 3300005539 | Ga0068853_100168269 | Ga0068853_1001682693 | 255 |
| 154 | 3300025925 | Ga0207650_10353095 | Ga0207650_103530952 | 255 |
| 155 | 3300025937 | Ga0207669_10324367 | Ga0207669_103243671 | 255 |
| 156 | 3300025972 | Ga0207668_10057467 | Ga0207668_100574672 | 255 |
| 157 | 3300026041 | Ga0207639_10182196 | Ga0207639_101821962 | 255 |
| 158 | 3300026142 | Ga0207698_10483228 | Ga0207698_104832282 | 256 |
| 159 | 3300037312 | Ga0395899_0046217 | Ga0395899_0046217_353_1228 | 256 |
| 160 | 3300037418 | Ga0395900_0060046 | Ga0395900_0060046_1720_2595 | 256 |
| 161 | 3300037471 | Ga0395905_0023354 | Ga0395905_0023354_2067_2942 | 256 |
| 162 | 3300038443 | Ga0395901_0015289 | Ga0395901_0015289_3031_3906 | 256 |
| 163 | 3300005331 | Ga0070670_100020181 | Ga0070670_1000201815 | 257 |
| 164 | 3300005355 | Ga0070671_100011834 | Ga0070671_1000118346 | 257 |
| 165 | 3300005841 | Ga0068863_100011392 | Ga0068863_1000113928 | 257 |
| 166 | 3300009177 | Ga0105248_10031122 | Ga0105248_100311224 | 257 |
| 167 | 3300025925 | Ga0207650_10256459 | Ga0207650_102564592 | 257 |
| 168 | 3300025931 | Ga0207644_10000138 | Ga0207644_1000013850 | 257 |
| 169 | 3300025941 | Ga0207711_10001163 | Ga0207711_1000116320 | 257 |
| 170 | 3300026095 | Ga0207676_10010750 | Ga0207676_100107504 | 257 |
| 171 | 3300048912 | Ga0496109_0002117 | Ga0496109_0002117_228_1097 | 257 |
| 172 | 3300048915 | Ga0496112_0001994 | Ga0496112_0001994_5852_6721 | 257 |
| 173 | 3300005347 | Ga0070668_100183768 | Ga0070668_1001837682 | 258 |
| 174 | 3300005355 | Ga0070671_100021220 | Ga0070671_1000212205 | 258 |
| 175 | 3300009177 | Ga0105248_10006386 | Ga0105248_1000638611 | 258 |
| 176 | 3300009553 | Ga0105249_10451293 | Ga0105249_104512932 | 258 |
| 177 | 3300025941 | Ga0207711_10129799 | Ga0207711_101297992 | 258 |
| 178 | 3300031824 | Ga0307413_10051060 | Ga0307413_100510603 | 258 |
| 179 | 3300031852 | Ga0307410_10079353 | Ga0307410_100793532 | 258 |
| 180 | 3300031903 | Ga0307407_10205504 | Ga0307407_102055042 | 258 |
| 181 | 3300032005 | Ga0307411_10138757 | Ga0307411_101387572 | 258 |
| 182 | 3300048904 | Ga0496101_0043850 | Ga0496101_0043850_1015_1884 | 258 |
| 183 | 3300048909 | Ga0496106_0134454 | Ga0496106_0134454_866_1735 | 258 |
| 184 | 3300048910 | Ga0496107_0063820 | Ga0496107_0063820_260_1129 | 258 |
| 185 | 3300048917 | Ga0496114_0007186 | Ga0496114_0007186_6984_7853 | 258 |
| 186 | 3300048918 | Ga0496115_0041532 | Ga0496115_0041532_1424_2293 | 258 |
| 187 | 3300032005 | Ga0307411_10040491 | Ga0307411_100404913 | 259 |
| 188 | 3300005331 | Ga0070670_100005097 | Ga0070670_10000509710 | 262 |
| 189 | 3300025925 | Ga0207650_10017606 | Ga0207650_100176064 | 262 |
| 190 | 3300005618 | Ga0068864_100102264 | Ga0068864_1001022642 | 264 |
| 191 | 3300009094 | Ga0111539_10157647 | Ga0111539_101576472 | 264 |
| 192 | 3300032004 | Ga0307414_10146749 | Ga0307414_101467492 | 266 |
| 193 | iso_pu_bacteria | 2896429255 | 2896431834 | 267 |
| 194 | 3300005331 | Ga0070670_100001335 | Ga0070670_10000133514 | 268 |
| 195 | 3300005344 | Ga0070661_100013723 | Ga0070661_1000137234 | 268 |
| 196 | 3300005356 | Ga0070674_100041707 | Ga0070674_1000417074 | 268 |
| 197 | 3300005457 | Ga0070662_100155710 | Ga0070662_1001557101 | 268 |
| 198 | 3300005564 | Ga0070664_100000849 | Ga0070664_10000084925 | 268 |
| 199 | 3300005618 | Ga0068864_100026361 | Ga0068864_1000263614 | 268 |
| 200 | 3300006051 | Ga0075364_10186612 | Ga0075364_101866122 | 268 |
| 201 | 3300025920 | Ga0207649_10011307 | Ga0207649_100113074 | 268 |
| 202 | 3300025925 | Ga0207650_10029028 | Ga0207650_100290284 | 268 |
| 203 | 3300025933 | Ga0207706_10156825 | Ga0207706_101568252 | 268 |
| 204 | 3300025945 | Ga0207679_10025785 | Ga0207679_100257854 | 268 |
| 205 | 3300026121 | Ga0207683_10065725 | Ga0207683_100657254 | 268 |
| 206 | 3300046525 | Ga0495663_0036686 | Ga0495663_0036686_491_1357 | 268 |
| 207 | 3300050491 | nmdc:mga00v17_233450_c1 | nmdc:mga00v17_233450_c1_184_1056 | 268 |
| 208 | 3300061719 | Ga0466962_0115257 | Ga0466962_0115257_252_1121 | 268 |
| 209 | 3300046537 | Ga0495598_0030011 | Ga0495598_0030011_345_1211 | 269 |
| 210 | 3300046558 | Ga0495633_0019241 | Ga0495633_0019241_513_1379 | 269 |
| 211 | 2162886012 | MBSR1b_contig_6947300 | MBSR1b_0721.00000900 | 270 |
| 212 | 3300005293 | Ga0065715_10004520 | Ga0065715_100045203 | 270 |
| 213 | 3300005328 | Ga0070676_10014438 | Ga0070676_100144384 | 270 |
| 214 | 3300005330 | Ga0070690_100138715 | Ga0070690_1001387152 | 270 |
| 215 | 3300005331 | Ga0070670_100012617 | Ga0070670_1000126174 | 270 |
| 216 | 3300005347 | Ga0070668_100013179 | Ga0070668_1000131796 | 270 |
| 217 | 3300005347 | Ga0070668_100149996 | Ga0070668_1001499962 | 270 |
| 218 | 3300005353 | Ga0070669_100017560 | Ga0070669_1000175604 | 270 |
| 219 | 3300005354 | Ga0070675_100003250 | Ga0070675_1000032504 | 270 |
| 220 | 3300005356 | Ga0070674_100021255 | Ga0070674_1000212553 | 270 |
| 221 | 3300005364 | Ga0070673_100007664 | Ga0070673_1000076646 | 270 |
| 222 | 3300005455 | Ga0070663_100038411 | Ga0070663_1000384113 | 270 |
| 223 | 3300005456 | Ga0070678_100002909 | Ga0070678_1000029096 | 270 |
| 224 | 3300005457 | Ga0070662_100010487 | Ga0070662_1000104874 | 270 |
| 225 | 3300005459 | Ga0068867_100013826 | Ga0068867_1000138266 | 270 |
| 226 | 3300005543 | Ga0070672_100005595 | Ga0070672_1000055954 | 270 |
| 227 | 3300005578 | Ga0068854_100033020 | Ga0068854_1000330204 | 270 |
| 228 | 3300005617 | Ga0068859_100069278 | Ga0068859_1000692784 | 270 |
| 229 | 3300005719 | Ga0068861_100053121 | Ga0068861_1000531212 | 270 |
| 230 | 3300005844 | Ga0068862_100097285 | Ga0068862_1000972853 | 270 |
| 231 | 3300006931 | Ga0097620_100069275 | Ga0097620_1000692753 | 270 |
| 232 | 3300009553 | Ga0105249_10390873 | Ga0105249_103908732 | 270 |
| 233 | 3300014326 | Ga0157380_10140191 | Ga0157380_101401913 | 270 |
| 234 | 3300017792 | Ga0163161_10013343 | Ga0163161_100133435 | 270 |
| 235 | 3300025315 | Ga0207697_10000969 | Ga0207697_1000096917 | 270 |
| 236 | 3300025893 | Ga0207682_10000494 | Ga0207682_1000049410 | 270 |
| 237 | 3300025901 | Ga0207688_10149726 | Ga0207688_101497262 | 270 |
| 238 | 3300025923 | Ga0207681_10008796 | Ga0207681_100087965 | 270 |
| 239 | 3300025926 | Ga0207659_10013644 | Ga0207659_100136444 | 270 |
| 240 | 3300025933 | Ga0207706_10000276 | Ga0207706_100002765 | 270 |
| 241 | 3300025937 | Ga0207669_10021869 | Ga0207669_100218692 | 270 |
| 242 | 3300025940 | Ga0207691_10035726 | Ga0207691_100357263 | 270 |
| 243 | 3300025945 | Ga0207679_10095305 | Ga0207679_100953053 | 270 |
| 244 | 3300025972 | Ga0207668_10004430 | Ga0207668_100044305 | 270 |
| 245 | 3300025981 | Ga0207640_10110868 | Ga0207640_101108683 | 270 |
| 246 | 3300026067 | Ga0207678_10020251 | Ga0207678_100202514 | 270 |
| 247 | 3300026089 | Ga0207648_10036823 | Ga0207648_100368234 | 270 |
| 248 | 3300026118 | Ga0207675_100008969 | Ga0207675_1000089698 | 270 |
| 249 | 3300026121 | Ga0207683_10004703 | Ga0207683_100047039 | 270 |
| 250 | 3300028380 | Ga0268265_10184199 | Ga0268265_101841991 | 270 |
| 251 | 3300028381 | Ga0268264_10306344 | Ga0268264_103063442 | 270 |
| 252 | 3300032002 | Ga0307416_100088120 | Ga0307416_1000881203 | 270 |
| 253 | 3300042004 | Ga0439445_0004007 | Ga0439445_0004007_2446_3312 | 270 |
| 254 | 3300046525 | Ga0495663_0000955 | Ga0495663_0000955_6513_7379 | 270 |
| 255 | 3300046525 | Ga0495663_0045449 | Ga0495663_0045449_261_1127 | 270 |
| 256 | 3300046525 | Ga0495663_0064946 | Ga0495663_0064946_163_1029 | 270 |
| 257 | 3300046537 | Ga0495598_0013977 | Ga0495598_0013977_542_1408 | 270 |
| 258 | 3300046537 | Ga0495598_0102876 | Ga0495598_0102876_65_931 | 270 |
| 259 | 3300046539 | Ga0495621_0008584 | Ga0495621_0008584_677_1543 | 270 |
| 260 | 3300046558 | Ga0495633_0013578 | Ga0495633_0013578_1832_2698 | 270 |
| 261 | 3300046664 | Ga0495659_0002834 | Ga0495659_0002834_4066_4932 | 270 |
| 262 | 3300046691 | Ga0495670_0006037 | Ga0495670_0006037_5019_5885 | 270 |
| 263 | 3300046691 | Ga0495670_0021371 | Ga0495670_0021371_1513_2379 | 270 |
| 264 | 3300046691 | Ga0495670_0043165 | Ga0495670_0043165_962_1828 | 270 |
| 265 | 3300047445 | Ga0495677_0019890 | Ga0495677_0019890_978_1844 | 270 |
| 266 | 3300050511 | nmdc:mga08y16_155987_c1 | nmdc:mga08y16_155987_c1_836_1702 | 270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar