F373908

General Info

Members Datasets Scaffolds Average Seq Length
266 160 259 303

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100338415|Ga0068867_1003384151
Length 331
Sequence VRRNNVHSSRYSRVQNIVIFKNPCDSLYNYYMSKYQNTVIVIAGPTASGKTALAIKLAQHLNTVIISADSRQCFRELNIGVAKPSVEELNTVKHYFISSHSIHDKVTAQVFEEYAVNITNEIFKQNRFIVMAGGTGLYIKAFCEGLDLIPEVDASIRKKVSNEYAAYGMQWLQEQVQQHDYKFWQIAEQQNPRRLMRALEVKLSTGRSILQFRKGTQKVRSFNIIKFGIDISKDELYNNIDTRTNNMINAGLVEEVSSLFSYRNINALQTVGYKEIFEYMGGHDSLNLTIEKIKRNTRQYAKRQLTWFKKDQHIKWVNPDKFSLNFDEHLR

Samples

Sample ID Description Type Environment
1 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
2 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
5 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
6 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
7 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
151 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
152 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
153 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
158 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
159 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 0
Isolates 2.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.01
Nodule 0
Rhizoplane 0
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10032089 3300003203 Bacteria 1956
2 rootH2_10003831 3300003320 Bacteria 43674
3 rootH2_10019063 3300003320 Bacteria 8406
4 rootH2_10071298 3300003320 Bacteria 1593
5 rootH2_10136644 3300003320 Bacteria 2572
6 rootH1_10131023 3300003323 Bacteria 5823
7 Ga0065712_10004487 3300005290 Bacteria 4074
8 Ga0070658_10163141 3300005327 Unclassified 1870
9 Ga0070658_10205395 3300005327 Bacteria 1663
10 Ga0070683_100000369 3300005329 Bacteria 31172
11 Ga0070683_100005913 3300005329 Bacteria 10239
12 Ga0070683_100067693 3300005329 Bacteria 3326
13 Ga0070690_100232980 3300005330 Bacteria 1296
14 Ga0070670_100072920 3300005331 Bacteria 2949
15 Ga0068869_100048337 3300005334 Bacteria 3075
16 Ga0068869_100064099 3300005334 Unclassified 2702
17 Ga0068869_100091335 3300005334 Bacteria 2290
18 Ga0070680_100034293 3300005336 Bacteria 4092
19 Ga0070682_100002086 3300005337 Bacteria 11122
20 Ga0070682_100006929 3300005337 Bacteria 6370
21 Ga0070682_100011786 3300005337 Bacteria 5001
22 Ga0070682_100046082 3300005337 Bacteria 2705
23 Ga0068868_100006675 3300005338 Bacteria 8189
24 Ga0068868_100043006 3300005338 Bacteria 3528
25 Ga0068868_100054845 3300005338 Bacteria 3143
26 Ga0070660_100010504 3300005339 Bacteria 6541
27 Ga0070660_100054473 3300005339 Unclassified 3089
28 Ga0070689_100166634 3300005340 Bacteria 1783
29 Ga0070691_10004496 3300005341 Bacteria 6328
30 Ga0070691_10010493 3300005341 Bacteria 4227
31 Ga0070687_100091315 3300005343 Bacteria 1685
32 Ga0070661_100002729 3300005344 Bacteria 12103
33 Ga0070661_100104860 3300005344 Bacteria 2106
34 Ga0070668_100022048 3300005347 Bacteria 4814
35 Ga0070669_100003999 3300005353 Bacteria 10653
36 Ga0070675_100014040 3300005354 Bacteria 6308
37 Ga0070675_100019224 3300005354 Bacteria 5442
38 Ga0070675_100042611 3300005354 Bacteria 3709
39 Ga0070674_100043035 3300005356 Bacteria 3070
40 Ga0070673_100010083 3300005364 Bacteria 6377
41 Ga0070673_100077659 3300005364 Bacteria 2684
42 Ga0070688_100006097 3300005365 Bacteria 6406
43 Ga0070659_100005516 3300005366 Bacteria 9086
44 Ga0070659_100006421 3300005366 Bacteria 8490
45 Ga0070667_100205731 3300005367 Bacteria 1748
46 Ga0070667_100376821 3300005367 Bacteria 1288
47 Ga0070663_100078856 3300005455 Bacteria 2415
48 Ga0070678_100101386 3300005456 Bacteria 2232
49 Ga0070662_100019988 3300005457 Bacteria 4558
50 Ga0070681_10004039 3300005458 Bacteria 13846
51 Ga0068867_100338415 3300005459 Unclassified 1252
52 Ga0070685_10031507 3300005466 Bacteria 2963
53 Ga0070698_100268973 3300005471 Bacteria 1636
54 Ga0070679_100002167 3300005530 Bacteria 17712
55 Ga0070679_100095007 3300005530 Bacteria 2969
56 Ga0070684_100009153 3300005535 Bacteria 7787
57 Ga0070684_100010447 3300005535 Bacteria 7356
58 Ga0068853_100008084 3300005539 Bacteria 8440
59 Ga0068853_100009576 3300005539 Bacteria 7808
60 Ga0068853_100013550 3300005539 Bacteria 6663
61 Ga0068853_100013723 3300005539 Bacteria 6618
62 Ga0068853_100058020 3300005539 Bacteria 3342
63 Ga0070672_100089934 3300005543 Bacteria 2475
64 Ga0070693_100015415 3300005547 Bacteria 3934
65 Ga0070665_100005715 3300005548 Bacteria 12766
66 Ga0068855_100012719 3300005563 Bacteria 10149
67 Ga0068855_100021586 3300005563 Bacteria 7722
68 Ga0068855_100062715 3300005563 Bacteria 4339
69 Ga0070664_100010950 3300005564 Bacteria 7356
70 Ga0070664_100013962 3300005564 Bacteria 6549
71 Ga0070664_100155354 3300005564 Bacteria 2022
72 Ga0068857_100001073 3300005577 Bacteria 21162
73 Ga0068857_100048276 3300005577 Bacteria 3780
74 Ga0068857_100050161 3300005577 Bacteria 3703
75 Ga0068857_100168863 3300005577 Bacteria 1988
76 Ga0068854_100035233 3300005578 Unclassified 3502
77 Ga0068856_100073515 3300005614 Bacteria 3385
78 Ga0068852_100064605 3300005616 Bacteria 3191
79 Ga0068852_100096553 3300005616 Bacteria 2657
80 Ga0068852_100151463 3300005616 Unclassified 2157
81 Ga0068864_100056669 3300005618 Bacteria 3386
82 Ga0068864_100295539 3300005618 Bacteria 1515
83 Ga0068866_10191938 3300005718 Bacteria 1214
84 Ga0068861_100014462 3300005719 Bacteria 5540
85 Ga0068861_100015292 3300005719 Bacteria 5405
86 Ga0068851_10089793 3300005834 Bacteria 1616
87 Ga0068870_10031399 3300005840 Bacteria 2692
88 Ga0068863_100014788 3300005841 Bacteria 7504
89 Ga0068863_100408151 3300005841 Bacteria 1329
90 Ga0068860_100001144 3300005843 Bacteria 29103
91 Ga0081539_10000284 3300005985 Bacteria 114545
92 Ga0075366_10036958 3300006195 Bacteria 2880
93 Ga0075366_10059262 3300006195 Bacteria 2274
94 Ga0097621_100065368 3300006237 Bacteria 2993
95 Ga0097621_100078264 3300006237 Bacteria 2747
96 Ga0068871_100004890 3300006358 Bacteria 9357
97 Ga0068871_100055504 3300006358 Bacteria 3216
98 Ga0068871_100412364 3300006358 Bacteria 1205
99 Ga0105240_10000059 3300009093 Bacteria 219860
100 Ga0105240_10001595 3300009093 Bacteria 38516
101 Ga0105240_10044347 3300009093 Bacteria 5651
102 Ga0105240_10521780 3300009093 Bacteria 1318
103 Ga0111539_10006460 3300009094 Bacteria 15103
104 Ga0111539_10404620 3300009094 Unclassified 1590
105 Ga0105241_10000537 3300009174 Bacteria 28565
106 Ga0105237_10075930 3300009545 Bacteria 3351
107 Ga0105249_10018954 3300009553 Bacteria 6133
108 Ga0105239_10067435 3300010375 Bacteria 3930
109 Ga0105239_10083774 3300010375 Bacteria 3512
110 Ga0105246_10006371 3300011119 Bacteria 7202
111 Ga0157373_10015575 3300013100 Bacteria 5557
112 Ga0157373_10060552 3300013100 Bacteria 2682
113 Ga0157373_10273568 3300013100 Bacteria 1196
114 Ga0157371_10040080 3300013102 Bacteria 3347
115 Ga0157370_10002300 3300013104 Bacteria 23142
116 Ga0157370_10070449 3300013104 Bacteria 3300
117 Ga0157369_10006225 3300013105 Bacteria 13848
118 Ga0157369_10150144 3300013105 Bacteria 2463
119 Ga0157369_10243708 3300013105 Bacteria 1877
120 Ga0157374_10105570 3300013296 Bacteria 2705
121 Ga0157374_10116436 3300013296 Bacteria 2575
122 Ga0157378_10004603 3300013297 Bacteria 12099
123 Ga0163162_10001991 3300013306 Bacteria 19207
124 Ga0163162_10033927 3300013306 Bacteria 5075
125 Ga0163162_10036616 3300013306 Bacteria 4892
126 Ga0163162_10439105 3300013306 Bacteria 1437
127 Ga0163162_10533069 3300013306 Unclassified 1303
128 Ga0157372_10017547 3300013307 Bacteria 7679
129 Ga0157372_10046713 3300013307 Bacteria 4807
130 Ga0157372_10151821 3300013307 Bacteria 2674
131 Ga0157372_10554802 3300013307 Unclassified 1339
132 Ga0157375_10015758 3300013308 Bacteria 6772
133 Ga0157375_10038190 3300013308 Bacteria 4608
134 Ga0157375_10208486 3300013308 Bacteria 2111
135 Ga0163163_10237288 3300014325 Bacteria 1873
136 Ga0163163_10419223 3300014325 Bacteria 1397
137 Ga0157380_10000293 3300014326 Bacteria 30049
138 Ga0157380_10065403 3300014326 Bacteria 2922
139 Ga0157380_10167575 3300014326 Unclassified 1916
140 Ga0157377_10018817 3300014745 Bacteria 3596
141 Ga0157376_10061558 3300014969 Bacteria 3156
142 Ga0157376_10072378 3300014969 Bacteria 2932
143 Ga0157376_10109402 3300014969 Bacteria 2429
144 Ga0209646_1000045 3300025246 Bacteria 333765
145 Ga0209026_1000075 3300025250 Bacteria 202874
146 Ga0209130_1000915 3300025284 Bacteria 23743
147 Ga0207426_1000073 3300025302 Bacteria 323756
148 Ga0207682_10184394 3300025893 Unclassified 954
149 Ga0207642_10093830 3300025899 Bacteria 1489
150 Ga0207688_10033799 3300025901 Bacteria 2829
151 Ga0207647_10011231 3300025904 Bacteria 6289
152 Ga0207647_10022578 3300025904 Bacteria 4176
153 Ga0207647_10124392 3300025904 Bacteria 1519
154 Ga0207645_10002879 3300025907 Bacteria 13311
155 Ga0207643_10004330 3300025908 Bacteria 7632
156 Ga0207654_10002512 3300025911 Bacteria 9323
157 Ga0207707_10000051 3300025912 Bacteria 117204
158 Ga0207695_10000073 3300025913 Bacteria 312565
159 Ga0207695_10025675 3300025913 Bacteria 6590
160 Ga0207660_10002571 3300025917 Bacteria 11922
161 Ga0207660_10075247 3300025917 Bacteria 2466
162 Ga0207657_10014992 3300025919 Bacteria 7528
163 Ga0207649_10005554 3300025920 Bacteria 6821
164 Ga0207652_10000384 3300025921 Bacteria 46082
165 Ga0207652_10000831 3300025921 Bacteria 29402
166 Ga0207681_10036739 3300025923 Bacteria 3233
167 Ga0207681_10107286 3300025923 Bacteria 2025
168 Ga0207659_10071806 3300025926 Bacteria 2528
169 Ga0207659_10091426 3300025926 Bacteria 2273
170 Ga0207690_10005267 3300025932 Bacteria 7622
171 Ga0207706_10014523 3300025933 Bacteria 7138
172 Ga0207706_10353954 3300025933 Bacteria 1276
173 Ga0207691_10007459 3300025940 Bacteria 10530
174 Ga0207691_10010295 3300025940 Bacteria 8970
175 Ga0207691_10096425 3300025940 Bacteria 2644
176 Ga0207689_10003798 3300025942 Bacteria 13769
177 Ga0207689_10253658 3300025942 Bacteria 1455
178 Ga0207661_10001165 3300025944 Bacteria 17552
179 Ga0207661_10071553 3300025944 Bacteria 2834
180 Ga0207661_10079527 3300025944 Bacteria 2702
181 Ga0207679_10000182 3300025945 Bacteria 51887
182 Ga0207679_10052643 3300025945 Bacteria 2986
183 Ga0207679_10169717 3300025945 Bacteria 1795
184 Ga0207667_10004126 3300025949 Bacteria 17853
185 Ga0207667_10042538 3300025949 Bacteria 4828
186 Ga0207667_10126221 3300025949 Bacteria 2635
187 Ga0207651_10141308 3300025960 Unclassified 1860
188 Ga0207651_10218853 3300025960 Bacteria 1538
189 Ga0207712_10130436 3300025961 Bacteria 1915
190 Ga0207658_10144134 3300025986 Unclassified 1932
191 Ga0207658_10453778 3300025986 Bacteria 1135
192 Ga0207677_10032666 3300026023 Bacteria 3348
193 Ga0207677_10072563 3300026023 Unclassified 2434
194 Ga0207639_10001509 3300026041 Bacteria 15642
195 Ga0207639_10007164 3300026041 Bacteria 7597
196 Ga0207639_10012851 3300026041 Bacteria 5841
197 Ga0207639_10094719 3300026041 Bacteria 2398
198 Ga0207678_10120069 3300026067 Unclassified 2243
199 Ga0207641_10102541 3300026088 Bacteria 2523
200 Ga0207648_10039657 3300026089 Bacteria 4140
201 Ga0207648_10092667 3300026089 Bacteria 2642
202 Ga0207648_10137493 3300026089 Viruses 2152
203 Ga0207648_10155724 3300026089 Unclassified 2017
204 Ga0207676_10050877 3300026095 Bacteria 3233
205 Ga0207674_10003912 3300026116 Bacteria 18125
206 Ga0207674_10018544 3300026116 Bacteria 7560
207 Ga0207674_10028521 3300026116 Bacteria 5890
208 Ga0207675_100007524 3300026118 Bacteria 10291
209 Ga0207675_100012344 3300026118 Bacteria 7980
210 Ga0207675_100616493 3300026118 Bacteria 1089
211 Ga0207683_10003728 3300026121 Bacteria 13219
212 Ga0207698_10057057 3300026142 Bacteria 3018
213 Ga0207698_10060795 3300026142 Bacteria 2940
214 Ga0207698_10064305 3300026142 Bacteria 2875
215 Ga0207698_10558424 3300026142 Bacteria 1123
216 Ga0268266_10005697 3300028379 Bacteria 11550
217 Ga0268265_10196248 3300028380 Bacteria 1747
218 Ga0268264_10001914 3300028381 Bacteria 18811
219 Ga0268264_10203579 3300028381 Bacteria 1812
220 Ga0307516_10001143 3300031730 Bacteria 37055
221 Ga0307414_10024097 3300032004 Bacteria 3874
222 Ga0307411_10059310 3300032005 Bacteria 2537
223 Ga0316574_0052576 3300035398 Bacteria 2541
224 Ga0395900_0265056 3300037418 Unclassified 1714
225 Ga0395898_0099293 3300037466 Bacteria 2796
226 Ga0395905_0000003 3300037471 Bacteria 1347396
227 Ga0395901_0273670 3300038443 Bacteria 1756
228 Ga0436365_1684950 3300039437 Bacteria 9224
229 Ga0466972_0023474 3300044658 Bacteria 3067
230 Ga0453683_0111466 3300044673 Bacteria 1720
231 Ga0466965_0024902 3300044683 Bacteria 2896
232 Ga0466964_0159795 3300044706 Unclassified 1052
233 Ga0453684_0030904 3300044712 Bacteria 7551
234 Ga0453684_0902133 3300044712 Bacteria 946
235 Ga0466971_0032740 3300044719 Bacteria 2329
236 Ga0466970_0252291 3300044765 Bacteria 989
237 Ga0495638_0073243 3300046460 Bacteria 2091
238 Ga0495665_0175862 3300046531 Unclassified 1113
239 Ga0495668_0000449 3300046616 Bacteria 52562
240 Ga0495668_0003890 3300046616 Bacteria 10901
241 Ga0495635_0270755 3300046663 Bacteria 1142
242 Ga0495647_0004160 3300046681 Bacteria 4688
243 Ga0495613_0115072 3300046689 Unclassified 1936
244 Ga0495674_0006964 3300047319 Bacteria 10816
245 Ga0495686_0000046 3300047472 Bacteria 281963
246 Ga0495686_0090814 3300047472 Bacteria 1854
247 Ga0501034_0012182 3300049571 Bacteria 8894
248 Ga0501227_015293 3300049665 Unclassified 1713
249 Ga0501239_005321 3300049672 Bacteria 1294
250 Ga0501241_002792 3300049758 Bacteria 3355
251 Ga0501269_003229 3300049766 Unclassified 1974
252 Ga0501044_0498519 3300049823 Bacteria 1119
253 nmdc:mga0k408_51763_c1 3300050493 Bacteria 2379
254 nmdc:mga08y16_11589_c1 3300050511 Bacteria 9265
255 nmdc:mga08y16_304070_c1 3300050511 Unclassified 1643
256 Ga0500578_0000462 3300053086 Bacteria 49481
257 Ga0500556_0079721 3300053104 Bacteria 1236
258 Ga0500642_0001786 3300053130 Bacteria 6209
259 Ga0466962_0004158 3300061719 Bacteria 6939

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0902133 Ga0453684_0902133_139_918 246
2 3300005616 Ga0068852_100096553 Ga0068852_1000965533 262
3 3300010375 Ga0105239_10083774 Ga0105239_100837742 262
4 3300026142 Ga0207698_10064305 Ga0207698_100643053 262
5 iso_pu_bacteria 2884791551 2884791739 270
6 3300013100 Ga0157373_10060552 Ga0157373_100605523 273
7 3300013308 Ga0157375_10038190 Ga0157375_100381904 276
8 3300005327 Ga0070658_10163141 Ga0070658_101631412 278
9 3300025921 Ga0207652_10000831 Ga0207652_1000083126 278
10 3300037418 Ga0395900_0265056 Ga0395900_0265056_659_1513 278
11 3300037466 Ga0395898_0099293 Ga0395898_0099293_608_1462 278
12 3300049571 Ga0501034_0012182 Ga0501034_0012182_7997_8857 278
13 3300031730 Ga0307516_10001143 Ga0307516_100011439 280
14 3300046460 Ga0495638_0073243 Ga0495638_0073243_179_1030 281
15 3300049672 Ga0501239_005321 Ga0501239_005321_11_898 283
16 3300049758 Ga0501241_002792 Ga0501241_002792_2093_3004 283
17 3300025899 Ga0207642_10093830 Ga0207642_100938301 285
18 3300047472 Ga0495686_0090814 Ga0495686_0090814_280_1221 287
19 3300049823 Ga0501044_0498519 Ga0501044_0498519_70_933 287
20 3300009545 Ga0105237_10075930 Ga0105237_100759302 291
21 3300014325 Ga0163163_10237288 Ga0163163_102372883 291
22 3300053086 Ga0500578_0000462 Ga0500578_0000462_35085_35975 291
23 3300009093 Ga0105240_10521780 Ga0105240_105217802 292
24 3300026089 Ga0207648_10137493 Ga0207648_101374932 292
25 3300044719 Ga0466971_0032740 Ga0466971_0032740_1277_2158 292
26 3300061719 Ga0466962_0004158 Ga0466962_0004158_5567_6448 292
27 iso_pu_bacteria 2818991460 2819678664 292
28 iso_pu_bacteria 2833640130 2833644150 292
29 iso_pu_bacteria 2929177148 2929182437 292
30 iso_pu_bacteria 2945977869 2945978362 292
31 iso_pu_bacteria 2946013367 2946015784 292
32 3300003320 rootH2_10003831 rootH2_1000383131 293
33 3300003323 rootH1_10131023 rootH1_101310233 293
34 3300005329 Ga0070683_100005913 Ga0070683_1000059134 293
35 3300005341 Ga0070691_10004496 Ga0070691_100044966 293
36 3300005341 Ga0070691_10010493 Ga0070691_100104932 293
37 3300005535 Ga0070684_100010447 Ga0070684_1000104473 293
38 3300005563 Ga0068855_100012719 Ga0068855_1000127194 293
39 3300005616 Ga0068852_100151463 Ga0068852_1001514632 293
40 3300009093 Ga0105240_10044347 Ga0105240_100443473 293
41 3300010375 Ga0105239_10067435 Ga0105239_100674351 293
42 3300013105 Ga0157369_10243708 Ga0157369_102437081 293
43 3300013307 Ga0157372_10151821 Ga0157372_101518212 293
44 3300025913 Ga0207695_10000073 Ga0207695_10000073142 293
45 3300025944 Ga0207661_10079527 Ga0207661_100795272 293
46 3300025949 Ga0207667_10004126 Ga0207667_100041267 293
47 3300026142 Ga0207698_10558424 Ga0207698_105584242 293
48 3300009093 Ga0105240_10000059 Ga0105240_10000059177 294
49 3300026089 Ga0207648_10039657 Ga0207648_100396572 294
50 3300037471 Ga0395905_0000003 Ga0395905_0000003_122927_123835 294
51 3300044658 Ga0466972_0023474 Ga0466972_0023474_767_1708 294
52 3300044683 Ga0466965_0024902 Ga0466965_0024902_1880_2782 294
53 3300044706 Ga0466964_0159795 Ga0466964_0159795_21_923 294
54 3300044765 Ga0466970_0252291 Ga0466970_0252291_58_960 294
55 3300047472 Ga0495686_0000046 Ga0495686_0000046_115020_116045 294
56 3300003320 rootH2_10019063 rootH2_100190637 295
57 3300005334 Ga0068869_100091335 Ga0068869_1000913351 295
58 3300005347 Ga0070668_100022048 Ga0070668_1000220485 295
59 3300005539 Ga0068853_100058020 Ga0068853_1000580203 295
60 3300005719 Ga0068861_100014462 Ga0068861_1000144622 295
61 3300013307 Ga0157372_10017547 Ga0157372_100175474 295
62 3300025904 Ga0207647_10022578 Ga0207647_100225783 295
63 3300026041 Ga0207639_10094719 Ga0207639_100947193 295
64 3300026118 Ga0207675_100012344 Ga0207675_1000123447 295
65 3300039437 Ga0436365_1684950 Ga0436365_1684950_6935_7825 295
66 3300046616 Ga0495668_0003890 Ga0495668_0003890_2335_3246 295
67 iso_pu_bacteria 2881955468 2881957939 295
68 3300003320 rootH2_10071298 rootH2_100712982 296
69 3300005456 Ga0070678_100101386 Ga0070678_1001013863 296
70 3300005471 Ga0070698_100268973 Ga0070698_1002689732 296
71 3300006237 Ga0097621_100078264 Ga0097621_1000782643 296
72 3300006358 Ga0068871_100412364 Ga0068871_1004123641 296
73 3300009094 Ga0111539_10404620 Ga0111539_104046202 296
74 3300013307 Ga0157372_10046713 Ga0157372_100467131 296
75 3300014326 Ga0157380_10065403 Ga0157380_100654033 296
76 3300014326 Ga0157380_10167575 Ga0157380_101675752 296
77 3300025246 Ga0209646_1000045 Ga0209646_1000045223 296
78 3300025250 Ga0209026_1000075 Ga0209026_100007510 296
79 3300025284 Ga0209130_1000915 Ga0209130_100091516 296
80 3300025302 Ga0207426_1000073 Ga0207426_1000073272 296
81 3300025940 Ga0207691_10007459 Ga0207691_100074596 296
82 3300026118 Ga0207675_100616493 Ga0207675_1006164932 296
83 3300032004 Ga0307414_10024097 Ga0307414_100240972 296
84 3300035398 Ga0316574_0052576 Ga0316574_0052576_471_1379 296
85 3300046616 Ga0495668_0000449 Ga0495668_0000449_32165_33067 296
86 3300049766 Ga0501269_003229 Ga0501269_003229_842_1747 296
87 3300050511 nmdc:mga08y16_304070_c1 nmdc:mga08y16_304070_c1_496_1407 296
88 3300053104 Ga0500556_0079721 Ga0500556_0079721_254_1156 296
89 3300053130 Ga0500642_0001786 Ga0500642_0001786_4047_4949 296
90 3300005337 Ga0070682_100002086 Ga0070682_1000020862 297
91 3300005337 Ga0070682_100046082 Ga0070682_1000460823 297
92 3300005339 Ga0070660_100054473 Ga0070660_1000544733 297
93 3300005458 Ga0070681_10004039 Ga0070681_100040398 297
94 3300005530 Ga0070679_100002167 Ga0070679_1000021677 297
95 3300005539 Ga0068853_100009576 Ga0068853_1000095763 297
96 3300005547 Ga0070693_100015415 Ga0070693_1000154153 297
97 3300005563 Ga0068855_100021586 Ga0068855_1000215864 297
98 3300005834 Ga0068851_10089793 Ga0068851_100897932 297
99 3300005843 Ga0068860_100001144 Ga0068860_10000114412 297
100 3300006358 Ga0068871_100004890 Ga0068871_1000048902 297
101 3300009093 Ga0105240_10001595 Ga0105240_1000159533 297
102 3300009174 Ga0105241_10000537 Ga0105241_100005378 297
103 3300013104 Ga0157370_10002300 Ga0157370_100023008 297
104 3300013306 Ga0163162_10001991 Ga0163162_1000199112 297
105 3300013306 Ga0163162_10033927 Ga0163162_100339272 297
106 3300013307 Ga0157372_10554802 Ga0157372_105548022 297
107 3300014325 Ga0163163_10419223 Ga0163163_104192232 297
108 3300014969 Ga0157376_10061558 Ga0157376_100615583 297
109 3300014969 Ga0157376_10109402 Ga0157376_101094022 297
110 3300025911 Ga0207654_10002512 Ga0207654_100025123 297
111 3300025912 Ga0207707_10000051 Ga0207707_1000005179 297
112 3300025913 Ga0207695_10025675 Ga0207695_100256757 297
113 3300025917 Ga0207660_10002571 Ga0207660_100025713 297
114 3300025921 Ga0207652_10000384 Ga0207652_100003843 297
115 3300025949 Ga0207667_10042538 Ga0207667_100425384 297
116 3300026041 Ga0207639_10001509 Ga0207639_100015096 297
117 3300028381 Ga0268264_10001914 Ga0268264_1000191411 297
118 3300038443 Ga0395901_0273670 Ga0395901_0273670_364_1272 297
119 3300044673 Ga0453683_0111466 Ga0453683_0111466_11_910 297
120 3300044712 Ga0453684_0030904 Ga0453684_0030904_4430_5329 297
121 3300046531 Ga0495665_0175862 Ga0495665_0175862_17_922 297
122 3300046663 Ga0495635_0270755 Ga0495635_0270755_104_1009 297
123 3300046681 Ga0495647_0004160 Ga0495647_0004160_2823_3728 297
124 3300046689 Ga0495613_0115072 Ga0495613_0115072_455_1360 297
125 3300047319 Ga0495674_0006964 Ga0495674_0006964_6670_7575 297
126 3300005327 Ga0070658_10205395 Ga0070658_102053952 298
127 3300005330 Ga0070690_100232980 Ga0070690_1002329802 298
128 3300005340 Ga0070689_100166634 Ga0070689_1001666342 298
129 3300005367 Ga0070667_100205731 Ga0070667_1002057311 298
130 3300005466 Ga0070685_10031507 Ga0070685_100315073 298
131 3300005577 Ga0068857_100050161 Ga0068857_1000501612 298
132 3300005577 Ga0068857_100168863 Ga0068857_1001688632 298
133 3300005841 Ga0068863_100408151 Ga0068863_1004081512 298
134 3300006195 Ga0075366_10059262 Ga0075366_100592621 298
135 3300013105 Ga0157369_10006225 Ga0157369_1000622513 298
136 3300013105 Ga0157369_10150144 Ga0157369_101501443 298
137 3300013296 Ga0157374_10116436 Ga0157374_101164361 298
138 3300013306 Ga0163162_10439105 Ga0163162_104391052 298
139 3300013306 Ga0163162_10533069 Ga0163162_105330692 298
140 3300014745 Ga0157377_10018817 Ga0157377_100188173 298
141 3300025923 Ga0207681_10107286 Ga0207681_101072863 298
142 3300026116 Ga0207674_10028521 Ga0207674_100285213 298
143 3300049665 Ga0501227_015293 Ga0501227_015293_720_1652 298
144 3300003203 JGI25406J46586_10032089 JGI25406J46586_100320892 299
145 3300003320 rootH2_10136644 rootH2_101366442 299
146 3300005290 Ga0065712_10004487 Ga0065712_100044873 299
147 3300005329 Ga0070683_100000369 Ga0070683_10000036928 299
148 3300005329 Ga0070683_100067693 Ga0070683_1000676933 299
149 3300005331 Ga0070670_100072920 Ga0070670_1000729201 299
150 3300005334 Ga0068869_100048337 Ga0068869_1000483372 299
151 3300005334 Ga0068869_100064099 Ga0068869_1000640992 299
152 3300005336 Ga0070680_100034293 Ga0070680_1000342932 299
153 3300005337 Ga0070682_100006929 Ga0070682_1000069293 299
154 3300005337 Ga0070682_100011786 Ga0070682_1000117862 299
155 3300005338 Ga0068868_100006675 Ga0068868_1000066755 299
156 3300005338 Ga0068868_100043006 Ga0068868_1000430061 299
157 3300005338 Ga0068868_100054845 Ga0068868_1000548452 299
158 3300005339 Ga0070660_100010504 Ga0070660_1000105042 299
159 3300005343 Ga0070687_100091315 Ga0070687_1000913152 299
160 3300005344 Ga0070661_100002729 Ga0070661_1000027294 299
161 3300005344 Ga0070661_100104860 Ga0070661_1001048602 299
162 3300005353 Ga0070669_100003999 Ga0070669_1000039997 299
163 3300005354 Ga0070675_100014040 Ga0070675_1000140407 299
164 3300005354 Ga0070675_100019224 Ga0070675_1000192244 299
165 3300005354 Ga0070675_100042611 Ga0070675_1000426112 299
166 3300005356 Ga0070674_100043035 Ga0070674_1000430352 299
167 3300005364 Ga0070673_100010083 Ga0070673_1000100835 299
168 3300005364 Ga0070673_100077659 Ga0070673_1000776591 299
169 3300005365 Ga0070688_100006097 Ga0070688_1000060977 299
170 3300005366 Ga0070659_100005516 Ga0070659_1000055167 299
171 3300005366 Ga0070659_100006421 Ga0070659_1000064212 299
172 3300005367 Ga0070667_100376821 Ga0070667_1003768211 299
173 3300005455 Ga0070663_100078856 Ga0070663_1000788562 299
174 3300005457 Ga0070662_100019988 Ga0070662_1000199882 299
175 3300005459 Ga0068867_100338415 Ga0068867_1003384151 299
176 3300005530 Ga0070679_100095007 Ga0070679_1000950072 299
177 3300005535 Ga0070684_100009153 Ga0070684_1000091534 299
178 3300005539 Ga0068853_100008084 Ga0068853_1000080844 299
179 3300005539 Ga0068853_100013550 Ga0068853_1000135501 299
180 3300005539 Ga0068853_100013723 Ga0068853_1000137233 299
181 3300005543 Ga0070672_100089934 Ga0070672_1000899343 299
182 3300005548 Ga0070665_100005715 Ga0070665_1000057157 299
183 3300005563 Ga0068855_100062715 Ga0068855_1000627153 299
184 3300005564 Ga0070664_100010950 Ga0070664_1000109504 299
185 3300005564 Ga0070664_100013962 Ga0070664_1000139625 299
186 3300005564 Ga0070664_100155354 Ga0070664_1001553542 299
187 3300005577 Ga0068857_100001073 Ga0068857_10000107321 299
188 3300005577 Ga0068857_100048276 Ga0068857_1000482763 299
189 3300005578 Ga0068854_100035233 Ga0068854_1000352332 299
190 3300005614 Ga0068856_100073515 Ga0068856_1000735153 299
191 3300005616 Ga0068852_100064605 Ga0068852_1000646052 299
192 3300005618 Ga0068864_100056669 Ga0068864_1000566692 299
193 3300005618 Ga0068864_100295539 Ga0068864_1002955391 299
194 3300005718 Ga0068866_10191938 Ga0068866_101919381 299
195 3300005719 Ga0068861_100015292 Ga0068861_1000152925 299
196 3300005840 Ga0068870_10031399 Ga0068870_100313993 299
197 3300005841 Ga0068863_100014788 Ga0068863_1000147883 299
198 3300005985 Ga0081539_10000284 Ga0081539_1000028429 299
199 3300006195 Ga0075366_10036958 Ga0075366_100369583 299
200 3300006237 Ga0097621_100065368 Ga0097621_1000653682 299
201 3300006358 Ga0068871_100055504 Ga0068871_1000555042 299
202 3300009094 Ga0111539_10006460 Ga0111539_1000646011 299
203 3300009553 Ga0105249_10018954 Ga0105249_100189543 299
204 3300011119 Ga0105246_10006371 Ga0105246_100063713 299
205 3300013100 Ga0157373_10015575 Ga0157373_100155752 299
206 3300013100 Ga0157373_10273568 Ga0157373_102735681 299
207 3300013102 Ga0157371_10040080 Ga0157371_100400802 299
208 3300013104 Ga0157370_10070449 Ga0157370_100704492 299
209 3300013296 Ga0157374_10105570 Ga0157374_101055702 299
210 3300013297 Ga0157378_10004603 Ga0157378_100046037 299
211 3300013306 Ga0163162_10036616 Ga0163162_100366162 299
212 3300013308 Ga0157375_10015758 Ga0157375_100157588 299
213 3300013308 Ga0157375_10208486 Ga0157375_102084862 299
214 3300014326 Ga0157380_10000293 Ga0157380_100002934 299
215 3300014969 Ga0157376_10072378 Ga0157376_100723782 299
216 3300025893 Ga0207682_10184394 Ga0207682_101843941 299
217 3300025901 Ga0207688_10033799 Ga0207688_100337992 299
218 3300025904 Ga0207647_10011231 Ga0207647_100112318 299
219 3300025904 Ga0207647_10124392 Ga0207647_101243921 299
220 3300025907 Ga0207645_10002879 Ga0207645_100028794 299
221 3300025908 Ga0207643_10004330 Ga0207643_100043303 299
222 3300025917 Ga0207660_10075247 Ga0207660_100752472 299
223 3300025919 Ga0207657_10014992 Ga0207657_100149922 299
224 3300025920 Ga0207649_10005554 Ga0207649_100055544 299
225 3300025923 Ga0207681_10036739 Ga0207681_100367393 299
226 3300025926 Ga0207659_10071806 Ga0207659_100718062 299
227 3300025926 Ga0207659_10091426 Ga0207659_100914262 299
228 3300025932 Ga0207690_10005267 Ga0207690_100052675 299
229 3300025933 Ga0207706_10014523 Ga0207706_100145233 299
230 3300025933 Ga0207706_10353954 Ga0207706_103539542 299
231 3300025940 Ga0207691_10010295 Ga0207691_100102959 299
232 3300025940 Ga0207691_10096425 Ga0207691_100964253 299
233 3300025942 Ga0207689_10003798 Ga0207689_1000379810 299
234 3300025942 Ga0207689_10253658 Ga0207689_102536582 299
235 3300025944 Ga0207661_10001165 Ga0207661_1000116514 299
236 3300025944 Ga0207661_10071553 Ga0207661_100715532 299
237 3300025945 Ga0207679_10000182 Ga0207679_1000018230 299
238 3300025945 Ga0207679_10052643 Ga0207679_100526432 299
239 3300025945 Ga0207679_10169717 Ga0207679_101697172 299
240 3300025949 Ga0207667_10126221 Ga0207667_101262212 299
241 3300025960 Ga0207651_10141308 Ga0207651_101413082 299
242 3300025960 Ga0207651_10218853 Ga0207651_102188532 299
243 3300025961 Ga0207712_10130436 Ga0207712_101304362 299
244 3300025986 Ga0207658_10144134 Ga0207658_101441342 299
245 3300025986 Ga0207658_10453778 Ga0207658_104537781 299
246 3300026023 Ga0207677_10032666 Ga0207677_100326663 299
247 3300026023 Ga0207677_10072563 Ga0207677_100725632 299
248 3300026041 Ga0207639_10007164 Ga0207639_100071644 299
249 3300026041 Ga0207639_10012851 Ga0207639_100128512 299
250 3300026067 Ga0207678_10120069 Ga0207678_101200691 299
251 3300026088 Ga0207641_10102541 Ga0207641_101025412 299
252 3300026089 Ga0207648_10092667 Ga0207648_100926673 299
253 3300026089 Ga0207648_10155724 Ga0207648_101557242 299
254 3300026095 Ga0207676_10050877 Ga0207676_100508771 299
255 3300026116 Ga0207674_10003912 Ga0207674_1000391214 299
256 3300026116 Ga0207674_10018544 Ga0207674_100185444 299
257 3300026118 Ga0207675_100007524 Ga0207675_1000075247 299
258 3300026121 Ga0207683_10003728 Ga0207683_100037288 299
259 3300026142 Ga0207698_10057057 Ga0207698_100570573 299
260 3300026142 Ga0207698_10060795 Ga0207698_100607952 299
261 3300028379 Ga0268266_10005697 Ga0268266_100056976 299
262 3300028380 Ga0268265_10196248 Ga0268265_101962481 299
263 3300028381 Ga0268264_10203579 Ga0268264_102035792 299
264 3300032005 Ga0307411_10059310 Ga0307411_100593102 299
265 3300050493 nmdc:mga0k408_51763_c1 nmdc:mga0k408_51763_c1_1394_2311 299
266 3300050511 nmdc:mga08y16_11589_c1 nmdc:mga08y16_11589_c1_2733_3659 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

72

311

0.98

PF01745

IPT

Isopentenyl transferase

37

146

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.9288 6 290
3w90-assembly1.cif.gz_A crystal structure of cmp kinase from thermus thermophilus hb8 0.926 8 37
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.9105 6 290
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.8647 6 289
3akd-assembly1.cif.gz_A crystal structure of cmp kinase in complex with cdp from thermus thermophilus hb8 0.8466 8 44
ID Description Score Start End Superfamily
3exaA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.9638 197 269 1.10.287.890
2qgnA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.942 204 269 1.10.287.890
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9275 6 111 3.40.50.300
3w90A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.926 8 37 3.40.50.300
af_P9WJW1_115_180_1.10.20.140 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9098 113 176 1.10.20.140
ID Description Score Start End GO Terms
AF-A0A7X9KPC4-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9837 6 223 GO:0005524
GO:0006400
GO:0052381
AF-A0A4Q6AUH5-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9829 5 256 GO:0005524
GO:0006400
GO:0052381
AF-A0A4R7ELN6-F1-model_v4 deleted 0.982 5 289
AF-A0A2N6A3D7-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9798 5 289 GO:0005524
GO:0006400
GO:0052381
AF-A0A6N6M602-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9778 6 278 GO:0005524
GO:0006400
GO:0052381

Feature Viewer

pLDDT pTM Quality
92.66 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map