F373908
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 160 | 259 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300005459|Ga0068867_100338415|Ga0068867_1003384151 |
| Length | 331 |
| Sequence | VRRNNVHSSRYSRVQNIVIFKNPCDSLYNYYMSKYQNTVIVIAGPTASGKTALAIKLAQHLNTVIISADSRQCFRELNIGVAKPSVEELNTVKHYFISSHSIHDKVTAQVFEEYAVNITNEIFKQNRFIVMAGGTGLYIKAFCEGLDLIPEVDASIRKKVSNEYAAYGMQWLQEQVQQHDYKFWQIAEQQNPRRLMRALEVKLSTGRSILQFRKGTQKVRSFNIIKFGIDISKDELYNNIDTRTNNMINAGLVEEVSSLFSYRNINALQTVGYKEIFEYMGGHDSLNLTIEKIKRNTRQYAKRQLTWFKKDQHIKWVNPDKFSLNFDEHLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 2 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 3 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 4 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 5 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 6 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 7 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 126 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 127 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 128 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 134 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 135 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 136 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 137 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 138 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 139 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 151 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 152 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 153 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 154 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 158 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 159 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 160 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.37 |
| Metatranscriptomes | 0 |
| Isolates | 2.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.01 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 92.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10032089 | 3300003203 | Bacteria | 1956 |
| 2 | rootH2_10003831 | 3300003320 | Bacteria | 43674 |
| 3 | rootH2_10019063 | 3300003320 | Bacteria | 8406 |
| 4 | rootH2_10071298 | 3300003320 | Bacteria | 1593 |
| 5 | rootH2_10136644 | 3300003320 | Bacteria | 2572 |
| 6 | rootH1_10131023 | 3300003323 | Bacteria | 5823 |
| 7 | Ga0065712_10004487 | 3300005290 | Bacteria | 4074 |
| 8 | Ga0070658_10163141 | 3300005327 | Unclassified | 1870 |
| 9 | Ga0070658_10205395 | 3300005327 | Bacteria | 1663 |
| 10 | Ga0070683_100000369 | 3300005329 | Bacteria | 31172 |
| 11 | Ga0070683_100005913 | 3300005329 | Bacteria | 10239 |
| 12 | Ga0070683_100067693 | 3300005329 | Bacteria | 3326 |
| 13 | Ga0070690_100232980 | 3300005330 | Bacteria | 1296 |
| 14 | Ga0070670_100072920 | 3300005331 | Bacteria | 2949 |
| 15 | Ga0068869_100048337 | 3300005334 | Bacteria | 3075 |
| 16 | Ga0068869_100064099 | 3300005334 | Unclassified | 2702 |
| 17 | Ga0068869_100091335 | 3300005334 | Bacteria | 2290 |
| 18 | Ga0070680_100034293 | 3300005336 | Bacteria | 4092 |
| 19 | Ga0070682_100002086 | 3300005337 | Bacteria | 11122 |
| 20 | Ga0070682_100006929 | 3300005337 | Bacteria | 6370 |
| 21 | Ga0070682_100011786 | 3300005337 | Bacteria | 5001 |
| 22 | Ga0070682_100046082 | 3300005337 | Bacteria | 2705 |
| 23 | Ga0068868_100006675 | 3300005338 | Bacteria | 8189 |
| 24 | Ga0068868_100043006 | 3300005338 | Bacteria | 3528 |
| 25 | Ga0068868_100054845 | 3300005338 | Bacteria | 3143 |
| 26 | Ga0070660_100010504 | 3300005339 | Bacteria | 6541 |
| 27 | Ga0070660_100054473 | 3300005339 | Unclassified | 3089 |
| 28 | Ga0070689_100166634 | 3300005340 | Bacteria | 1783 |
| 29 | Ga0070691_10004496 | 3300005341 | Bacteria | 6328 |
| 30 | Ga0070691_10010493 | 3300005341 | Bacteria | 4227 |
| 31 | Ga0070687_100091315 | 3300005343 | Bacteria | 1685 |
| 32 | Ga0070661_100002729 | 3300005344 | Bacteria | 12103 |
| 33 | Ga0070661_100104860 | 3300005344 | Bacteria | 2106 |
| 34 | Ga0070668_100022048 | 3300005347 | Bacteria | 4814 |
| 35 | Ga0070669_100003999 | 3300005353 | Bacteria | 10653 |
| 36 | Ga0070675_100014040 | 3300005354 | Bacteria | 6308 |
| 37 | Ga0070675_100019224 | 3300005354 | Bacteria | 5442 |
| 38 | Ga0070675_100042611 | 3300005354 | Bacteria | 3709 |
| 39 | Ga0070674_100043035 | 3300005356 | Bacteria | 3070 |
| 40 | Ga0070673_100010083 | 3300005364 | Bacteria | 6377 |
| 41 | Ga0070673_100077659 | 3300005364 | Bacteria | 2684 |
| 42 | Ga0070688_100006097 | 3300005365 | Bacteria | 6406 |
| 43 | Ga0070659_100005516 | 3300005366 | Bacteria | 9086 |
| 44 | Ga0070659_100006421 | 3300005366 | Bacteria | 8490 |
| 45 | Ga0070667_100205731 | 3300005367 | Bacteria | 1748 |
| 46 | Ga0070667_100376821 | 3300005367 | Bacteria | 1288 |
| 47 | Ga0070663_100078856 | 3300005455 | Bacteria | 2415 |
| 48 | Ga0070678_100101386 | 3300005456 | Bacteria | 2232 |
| 49 | Ga0070662_100019988 | 3300005457 | Bacteria | 4558 |
| 50 | Ga0070681_10004039 | 3300005458 | Bacteria | 13846 |
| 51 | Ga0068867_100338415 | 3300005459 | Unclassified | 1252 |
| 52 | Ga0070685_10031507 | 3300005466 | Bacteria | 2963 |
| 53 | Ga0070698_100268973 | 3300005471 | Bacteria | 1636 |
| 54 | Ga0070679_100002167 | 3300005530 | Bacteria | 17712 |
| 55 | Ga0070679_100095007 | 3300005530 | Bacteria | 2969 |
| 56 | Ga0070684_100009153 | 3300005535 | Bacteria | 7787 |
| 57 | Ga0070684_100010447 | 3300005535 | Bacteria | 7356 |
| 58 | Ga0068853_100008084 | 3300005539 | Bacteria | 8440 |
| 59 | Ga0068853_100009576 | 3300005539 | Bacteria | 7808 |
| 60 | Ga0068853_100013550 | 3300005539 | Bacteria | 6663 |
| 61 | Ga0068853_100013723 | 3300005539 | Bacteria | 6618 |
| 62 | Ga0068853_100058020 | 3300005539 | Bacteria | 3342 |
| 63 | Ga0070672_100089934 | 3300005543 | Bacteria | 2475 |
| 64 | Ga0070693_100015415 | 3300005547 | Bacteria | 3934 |
| 65 | Ga0070665_100005715 | 3300005548 | Bacteria | 12766 |
| 66 | Ga0068855_100012719 | 3300005563 | Bacteria | 10149 |
| 67 | Ga0068855_100021586 | 3300005563 | Bacteria | 7722 |
| 68 | Ga0068855_100062715 | 3300005563 | Bacteria | 4339 |
| 69 | Ga0070664_100010950 | 3300005564 | Bacteria | 7356 |
| 70 | Ga0070664_100013962 | 3300005564 | Bacteria | 6549 |
| 71 | Ga0070664_100155354 | 3300005564 | Bacteria | 2022 |
| 72 | Ga0068857_100001073 | 3300005577 | Bacteria | 21162 |
| 73 | Ga0068857_100048276 | 3300005577 | Bacteria | 3780 |
| 74 | Ga0068857_100050161 | 3300005577 | Bacteria | 3703 |
| 75 | Ga0068857_100168863 | 3300005577 | Bacteria | 1988 |
| 76 | Ga0068854_100035233 | 3300005578 | Unclassified | 3502 |
| 77 | Ga0068856_100073515 | 3300005614 | Bacteria | 3385 |
| 78 | Ga0068852_100064605 | 3300005616 | Bacteria | 3191 |
| 79 | Ga0068852_100096553 | 3300005616 | Bacteria | 2657 |
| 80 | Ga0068852_100151463 | 3300005616 | Unclassified | 2157 |
| 81 | Ga0068864_100056669 | 3300005618 | Bacteria | 3386 |
| 82 | Ga0068864_100295539 | 3300005618 | Bacteria | 1515 |
| 83 | Ga0068866_10191938 | 3300005718 | Bacteria | 1214 |
| 84 | Ga0068861_100014462 | 3300005719 | Bacteria | 5540 |
| 85 | Ga0068861_100015292 | 3300005719 | Bacteria | 5405 |
| 86 | Ga0068851_10089793 | 3300005834 | Bacteria | 1616 |
| 87 | Ga0068870_10031399 | 3300005840 | Bacteria | 2692 |
| 88 | Ga0068863_100014788 | 3300005841 | Bacteria | 7504 |
| 89 | Ga0068863_100408151 | 3300005841 | Bacteria | 1329 |
| 90 | Ga0068860_100001144 | 3300005843 | Bacteria | 29103 |
| 91 | Ga0081539_10000284 | 3300005985 | Bacteria | 114545 |
| 92 | Ga0075366_10036958 | 3300006195 | Bacteria | 2880 |
| 93 | Ga0075366_10059262 | 3300006195 | Bacteria | 2274 |
| 94 | Ga0097621_100065368 | 3300006237 | Bacteria | 2993 |
| 95 | Ga0097621_100078264 | 3300006237 | Bacteria | 2747 |
| 96 | Ga0068871_100004890 | 3300006358 | Bacteria | 9357 |
| 97 | Ga0068871_100055504 | 3300006358 | Bacteria | 3216 |
| 98 | Ga0068871_100412364 | 3300006358 | Bacteria | 1205 |
| 99 | Ga0105240_10000059 | 3300009093 | Bacteria | 219860 |
| 100 | Ga0105240_10001595 | 3300009093 | Bacteria | 38516 |
| 101 | Ga0105240_10044347 | 3300009093 | Bacteria | 5651 |
| 102 | Ga0105240_10521780 | 3300009093 | Bacteria | 1318 |
| 103 | Ga0111539_10006460 | 3300009094 | Bacteria | 15103 |
| 104 | Ga0111539_10404620 | 3300009094 | Unclassified | 1590 |
| 105 | Ga0105241_10000537 | 3300009174 | Bacteria | 28565 |
| 106 | Ga0105237_10075930 | 3300009545 | Bacteria | 3351 |
| 107 | Ga0105249_10018954 | 3300009553 | Bacteria | 6133 |
| 108 | Ga0105239_10067435 | 3300010375 | Bacteria | 3930 |
| 109 | Ga0105239_10083774 | 3300010375 | Bacteria | 3512 |
| 110 | Ga0105246_10006371 | 3300011119 | Bacteria | 7202 |
| 111 | Ga0157373_10015575 | 3300013100 | Bacteria | 5557 |
| 112 | Ga0157373_10060552 | 3300013100 | Bacteria | 2682 |
| 113 | Ga0157373_10273568 | 3300013100 | Bacteria | 1196 |
| 114 | Ga0157371_10040080 | 3300013102 | Bacteria | 3347 |
| 115 | Ga0157370_10002300 | 3300013104 | Bacteria | 23142 |
| 116 | Ga0157370_10070449 | 3300013104 | Bacteria | 3300 |
| 117 | Ga0157369_10006225 | 3300013105 | Bacteria | 13848 |
| 118 | Ga0157369_10150144 | 3300013105 | Bacteria | 2463 |
| 119 | Ga0157369_10243708 | 3300013105 | Bacteria | 1877 |
| 120 | Ga0157374_10105570 | 3300013296 | Bacteria | 2705 |
| 121 | Ga0157374_10116436 | 3300013296 | Bacteria | 2575 |
| 122 | Ga0157378_10004603 | 3300013297 | Bacteria | 12099 |
| 123 | Ga0163162_10001991 | 3300013306 | Bacteria | 19207 |
| 124 | Ga0163162_10033927 | 3300013306 | Bacteria | 5075 |
| 125 | Ga0163162_10036616 | 3300013306 | Bacteria | 4892 |
| 126 | Ga0163162_10439105 | 3300013306 | Bacteria | 1437 |
| 127 | Ga0163162_10533069 | 3300013306 | Unclassified | 1303 |
| 128 | Ga0157372_10017547 | 3300013307 | Bacteria | 7679 |
| 129 | Ga0157372_10046713 | 3300013307 | Bacteria | 4807 |
| 130 | Ga0157372_10151821 | 3300013307 | Bacteria | 2674 |
| 131 | Ga0157372_10554802 | 3300013307 | Unclassified | 1339 |
| 132 | Ga0157375_10015758 | 3300013308 | Bacteria | 6772 |
| 133 | Ga0157375_10038190 | 3300013308 | Bacteria | 4608 |
| 134 | Ga0157375_10208486 | 3300013308 | Bacteria | 2111 |
| 135 | Ga0163163_10237288 | 3300014325 | Bacteria | 1873 |
| 136 | Ga0163163_10419223 | 3300014325 | Bacteria | 1397 |
| 137 | Ga0157380_10000293 | 3300014326 | Bacteria | 30049 |
| 138 | Ga0157380_10065403 | 3300014326 | Bacteria | 2922 |
| 139 | Ga0157380_10167575 | 3300014326 | Unclassified | 1916 |
| 140 | Ga0157377_10018817 | 3300014745 | Bacteria | 3596 |
| 141 | Ga0157376_10061558 | 3300014969 | Bacteria | 3156 |
| 142 | Ga0157376_10072378 | 3300014969 | Bacteria | 2932 |
| 143 | Ga0157376_10109402 | 3300014969 | Bacteria | 2429 |
| 144 | Ga0209646_1000045 | 3300025246 | Bacteria | 333765 |
| 145 | Ga0209026_1000075 | 3300025250 | Bacteria | 202874 |
| 146 | Ga0209130_1000915 | 3300025284 | Bacteria | 23743 |
| 147 | Ga0207426_1000073 | 3300025302 | Bacteria | 323756 |
| 148 | Ga0207682_10184394 | 3300025893 | Unclassified | 954 |
| 149 | Ga0207642_10093830 | 3300025899 | Bacteria | 1489 |
| 150 | Ga0207688_10033799 | 3300025901 | Bacteria | 2829 |
| 151 | Ga0207647_10011231 | 3300025904 | Bacteria | 6289 |
| 152 | Ga0207647_10022578 | 3300025904 | Bacteria | 4176 |
| 153 | Ga0207647_10124392 | 3300025904 | Bacteria | 1519 |
| 154 | Ga0207645_10002879 | 3300025907 | Bacteria | 13311 |
| 155 | Ga0207643_10004330 | 3300025908 | Bacteria | 7632 |
| 156 | Ga0207654_10002512 | 3300025911 | Bacteria | 9323 |
| 157 | Ga0207707_10000051 | 3300025912 | Bacteria | 117204 |
| 158 | Ga0207695_10000073 | 3300025913 | Bacteria | 312565 |
| 159 | Ga0207695_10025675 | 3300025913 | Bacteria | 6590 |
| 160 | Ga0207660_10002571 | 3300025917 | Bacteria | 11922 |
| 161 | Ga0207660_10075247 | 3300025917 | Bacteria | 2466 |
| 162 | Ga0207657_10014992 | 3300025919 | Bacteria | 7528 |
| 163 | Ga0207649_10005554 | 3300025920 | Bacteria | 6821 |
| 164 | Ga0207652_10000384 | 3300025921 | Bacteria | 46082 |
| 165 | Ga0207652_10000831 | 3300025921 | Bacteria | 29402 |
| 166 | Ga0207681_10036739 | 3300025923 | Bacteria | 3233 |
| 167 | Ga0207681_10107286 | 3300025923 | Bacteria | 2025 |
| 168 | Ga0207659_10071806 | 3300025926 | Bacteria | 2528 |
| 169 | Ga0207659_10091426 | 3300025926 | Bacteria | 2273 |
| 170 | Ga0207690_10005267 | 3300025932 | Bacteria | 7622 |
| 171 | Ga0207706_10014523 | 3300025933 | Bacteria | 7138 |
| 172 | Ga0207706_10353954 | 3300025933 | Bacteria | 1276 |
| 173 | Ga0207691_10007459 | 3300025940 | Bacteria | 10530 |
| 174 | Ga0207691_10010295 | 3300025940 | Bacteria | 8970 |
| 175 | Ga0207691_10096425 | 3300025940 | Bacteria | 2644 |
| 176 | Ga0207689_10003798 | 3300025942 | Bacteria | 13769 |
| 177 | Ga0207689_10253658 | 3300025942 | Bacteria | 1455 |
| 178 | Ga0207661_10001165 | 3300025944 | Bacteria | 17552 |
| 179 | Ga0207661_10071553 | 3300025944 | Bacteria | 2834 |
| 180 | Ga0207661_10079527 | 3300025944 | Bacteria | 2702 |
| 181 | Ga0207679_10000182 | 3300025945 | Bacteria | 51887 |
| 182 | Ga0207679_10052643 | 3300025945 | Bacteria | 2986 |
| 183 | Ga0207679_10169717 | 3300025945 | Bacteria | 1795 |
| 184 | Ga0207667_10004126 | 3300025949 | Bacteria | 17853 |
| 185 | Ga0207667_10042538 | 3300025949 | Bacteria | 4828 |
| 186 | Ga0207667_10126221 | 3300025949 | Bacteria | 2635 |
| 187 | Ga0207651_10141308 | 3300025960 | Unclassified | 1860 |
| 188 | Ga0207651_10218853 | 3300025960 | Bacteria | 1538 |
| 189 | Ga0207712_10130436 | 3300025961 | Bacteria | 1915 |
| 190 | Ga0207658_10144134 | 3300025986 | Unclassified | 1932 |
| 191 | Ga0207658_10453778 | 3300025986 | Bacteria | 1135 |
| 192 | Ga0207677_10032666 | 3300026023 | Bacteria | 3348 |
| 193 | Ga0207677_10072563 | 3300026023 | Unclassified | 2434 |
| 194 | Ga0207639_10001509 | 3300026041 | Bacteria | 15642 |
| 195 | Ga0207639_10007164 | 3300026041 | Bacteria | 7597 |
| 196 | Ga0207639_10012851 | 3300026041 | Bacteria | 5841 |
| 197 | Ga0207639_10094719 | 3300026041 | Bacteria | 2398 |
| 198 | Ga0207678_10120069 | 3300026067 | Unclassified | 2243 |
| 199 | Ga0207641_10102541 | 3300026088 | Bacteria | 2523 |
| 200 | Ga0207648_10039657 | 3300026089 | Bacteria | 4140 |
| 201 | Ga0207648_10092667 | 3300026089 | Bacteria | 2642 |
| 202 | Ga0207648_10137493 | 3300026089 | Viruses | 2152 |
| 203 | Ga0207648_10155724 | 3300026089 | Unclassified | 2017 |
| 204 | Ga0207676_10050877 | 3300026095 | Bacteria | 3233 |
| 205 | Ga0207674_10003912 | 3300026116 | Bacteria | 18125 |
| 206 | Ga0207674_10018544 | 3300026116 | Bacteria | 7560 |
| 207 | Ga0207674_10028521 | 3300026116 | Bacteria | 5890 |
| 208 | Ga0207675_100007524 | 3300026118 | Bacteria | 10291 |
| 209 | Ga0207675_100012344 | 3300026118 | Bacteria | 7980 |
| 210 | Ga0207675_100616493 | 3300026118 | Bacteria | 1089 |
| 211 | Ga0207683_10003728 | 3300026121 | Bacteria | 13219 |
| 212 | Ga0207698_10057057 | 3300026142 | Bacteria | 3018 |
| 213 | Ga0207698_10060795 | 3300026142 | Bacteria | 2940 |
| 214 | Ga0207698_10064305 | 3300026142 | Bacteria | 2875 |
| 215 | Ga0207698_10558424 | 3300026142 | Bacteria | 1123 |
| 216 | Ga0268266_10005697 | 3300028379 | Bacteria | 11550 |
| 217 | Ga0268265_10196248 | 3300028380 | Bacteria | 1747 |
| 218 | Ga0268264_10001914 | 3300028381 | Bacteria | 18811 |
| 219 | Ga0268264_10203579 | 3300028381 | Bacteria | 1812 |
| 220 | Ga0307516_10001143 | 3300031730 | Bacteria | 37055 |
| 221 | Ga0307414_10024097 | 3300032004 | Bacteria | 3874 |
| 222 | Ga0307411_10059310 | 3300032005 | Bacteria | 2537 |
| 223 | Ga0316574_0052576 | 3300035398 | Bacteria | 2541 |
| 224 | Ga0395900_0265056 | 3300037418 | Unclassified | 1714 |
| 225 | Ga0395898_0099293 | 3300037466 | Bacteria | 2796 |
| 226 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 227 | Ga0395901_0273670 | 3300038443 | Bacteria | 1756 |
| 228 | Ga0436365_1684950 | 3300039437 | Bacteria | 9224 |
| 229 | Ga0466972_0023474 | 3300044658 | Bacteria | 3067 |
| 230 | Ga0453683_0111466 | 3300044673 | Bacteria | 1720 |
| 231 | Ga0466965_0024902 | 3300044683 | Bacteria | 2896 |
| 232 | Ga0466964_0159795 | 3300044706 | Unclassified | 1052 |
| 233 | Ga0453684_0030904 | 3300044712 | Bacteria | 7551 |
| 234 | Ga0453684_0902133 | 3300044712 | Bacteria | 946 |
| 235 | Ga0466971_0032740 | 3300044719 | Bacteria | 2329 |
| 236 | Ga0466970_0252291 | 3300044765 | Bacteria | 989 |
| 237 | Ga0495638_0073243 | 3300046460 | Bacteria | 2091 |
| 238 | Ga0495665_0175862 | 3300046531 | Unclassified | 1113 |
| 239 | Ga0495668_0000449 | 3300046616 | Bacteria | 52562 |
| 240 | Ga0495668_0003890 | 3300046616 | Bacteria | 10901 |
| 241 | Ga0495635_0270755 | 3300046663 | Bacteria | 1142 |
| 242 | Ga0495647_0004160 | 3300046681 | Bacteria | 4688 |
| 243 | Ga0495613_0115072 | 3300046689 | Unclassified | 1936 |
| 244 | Ga0495674_0006964 | 3300047319 | Bacteria | 10816 |
| 245 | Ga0495686_0000046 | 3300047472 | Bacteria | 281963 |
| 246 | Ga0495686_0090814 | 3300047472 | Bacteria | 1854 |
| 247 | Ga0501034_0012182 | 3300049571 | Bacteria | 8894 |
| 248 | Ga0501227_015293 | 3300049665 | Unclassified | 1713 |
| 249 | Ga0501239_005321 | 3300049672 | Bacteria | 1294 |
| 250 | Ga0501241_002792 | 3300049758 | Bacteria | 3355 |
| 251 | Ga0501269_003229 | 3300049766 | Unclassified | 1974 |
| 252 | Ga0501044_0498519 | 3300049823 | Bacteria | 1119 |
| 253 | nmdc:mga0k408_51763_c1 | 3300050493 | Bacteria | 2379 |
| 254 | nmdc:mga08y16_11589_c1 | 3300050511 | Bacteria | 9265 |
| 255 | nmdc:mga08y16_304070_c1 | 3300050511 | Unclassified | 1643 |
| 256 | Ga0500578_0000462 | 3300053086 | Bacteria | 49481 |
| 257 | Ga0500556_0079721 | 3300053104 | Bacteria | 1236 |
| 258 | Ga0500642_0001786 | 3300053130 | Bacteria | 6209 |
| 259 | Ga0466962_0004158 | 3300061719 | Bacteria | 6939 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0902133 | Ga0453684_0902133_139_918 | 246 |
| 2 | 3300005616 | Ga0068852_100096553 | Ga0068852_1000965533 | 262 |
| 3 | 3300010375 | Ga0105239_10083774 | Ga0105239_100837742 | 262 |
| 4 | 3300026142 | Ga0207698_10064305 | Ga0207698_100643053 | 262 |
| 5 | iso_pu_bacteria | 2884791551 | 2884791739 | 270 |
| 6 | 3300013100 | Ga0157373_10060552 | Ga0157373_100605523 | 273 |
| 7 | 3300013308 | Ga0157375_10038190 | Ga0157375_100381904 | 276 |
| 8 | 3300005327 | Ga0070658_10163141 | Ga0070658_101631412 | 278 |
| 9 | 3300025921 | Ga0207652_10000831 | Ga0207652_1000083126 | 278 |
| 10 | 3300037418 | Ga0395900_0265056 | Ga0395900_0265056_659_1513 | 278 |
| 11 | 3300037466 | Ga0395898_0099293 | Ga0395898_0099293_608_1462 | 278 |
| 12 | 3300049571 | Ga0501034_0012182 | Ga0501034_0012182_7997_8857 | 278 |
| 13 | 3300031730 | Ga0307516_10001143 | Ga0307516_100011439 | 280 |
| 14 | 3300046460 | Ga0495638_0073243 | Ga0495638_0073243_179_1030 | 281 |
| 15 | 3300049672 | Ga0501239_005321 | Ga0501239_005321_11_898 | 283 |
| 16 | 3300049758 | Ga0501241_002792 | Ga0501241_002792_2093_3004 | 283 |
| 17 | 3300025899 | Ga0207642_10093830 | Ga0207642_100938301 | 285 |
| 18 | 3300047472 | Ga0495686_0090814 | Ga0495686_0090814_280_1221 | 287 |
| 19 | 3300049823 | Ga0501044_0498519 | Ga0501044_0498519_70_933 | 287 |
| 20 | 3300009545 | Ga0105237_10075930 | Ga0105237_100759302 | 291 |
| 21 | 3300014325 | Ga0163163_10237288 | Ga0163163_102372883 | 291 |
| 22 | 3300053086 | Ga0500578_0000462 | Ga0500578_0000462_35085_35975 | 291 |
| 23 | 3300009093 | Ga0105240_10521780 | Ga0105240_105217802 | 292 |
| 24 | 3300026089 | Ga0207648_10137493 | Ga0207648_101374932 | 292 |
| 25 | 3300044719 | Ga0466971_0032740 | Ga0466971_0032740_1277_2158 | 292 |
| 26 | 3300061719 | Ga0466962_0004158 | Ga0466962_0004158_5567_6448 | 292 |
| 27 | iso_pu_bacteria | 2818991460 | 2819678664 | 292 |
| 28 | iso_pu_bacteria | 2833640130 | 2833644150 | 292 |
| 29 | iso_pu_bacteria | 2929177148 | 2929182437 | 292 |
| 30 | iso_pu_bacteria | 2945977869 | 2945978362 | 292 |
| 31 | iso_pu_bacteria | 2946013367 | 2946015784 | 292 |
| 32 | 3300003320 | rootH2_10003831 | rootH2_1000383131 | 293 |
| 33 | 3300003323 | rootH1_10131023 | rootH1_101310233 | 293 |
| 34 | 3300005329 | Ga0070683_100005913 | Ga0070683_1000059134 | 293 |
| 35 | 3300005341 | Ga0070691_10004496 | Ga0070691_100044966 | 293 |
| 36 | 3300005341 | Ga0070691_10010493 | Ga0070691_100104932 | 293 |
| 37 | 3300005535 | Ga0070684_100010447 | Ga0070684_1000104473 | 293 |
| 38 | 3300005563 | Ga0068855_100012719 | Ga0068855_1000127194 | 293 |
| 39 | 3300005616 | Ga0068852_100151463 | Ga0068852_1001514632 | 293 |
| 40 | 3300009093 | Ga0105240_10044347 | Ga0105240_100443473 | 293 |
| 41 | 3300010375 | Ga0105239_10067435 | Ga0105239_100674351 | 293 |
| 42 | 3300013105 | Ga0157369_10243708 | Ga0157369_102437081 | 293 |
| 43 | 3300013307 | Ga0157372_10151821 | Ga0157372_101518212 | 293 |
| 44 | 3300025913 | Ga0207695_10000073 | Ga0207695_10000073142 | 293 |
| 45 | 3300025944 | Ga0207661_10079527 | Ga0207661_100795272 | 293 |
| 46 | 3300025949 | Ga0207667_10004126 | Ga0207667_100041267 | 293 |
| 47 | 3300026142 | Ga0207698_10558424 | Ga0207698_105584242 | 293 |
| 48 | 3300009093 | Ga0105240_10000059 | Ga0105240_10000059177 | 294 |
| 49 | 3300026089 | Ga0207648_10039657 | Ga0207648_100396572 | 294 |
| 50 | 3300037471 | Ga0395905_0000003 | Ga0395905_0000003_122927_123835 | 294 |
| 51 | 3300044658 | Ga0466972_0023474 | Ga0466972_0023474_767_1708 | 294 |
| 52 | 3300044683 | Ga0466965_0024902 | Ga0466965_0024902_1880_2782 | 294 |
| 53 | 3300044706 | Ga0466964_0159795 | Ga0466964_0159795_21_923 | 294 |
| 54 | 3300044765 | Ga0466970_0252291 | Ga0466970_0252291_58_960 | 294 |
| 55 | 3300047472 | Ga0495686_0000046 | Ga0495686_0000046_115020_116045 | 294 |
| 56 | 3300003320 | rootH2_10019063 | rootH2_100190637 | 295 |
| 57 | 3300005334 | Ga0068869_100091335 | Ga0068869_1000913351 | 295 |
| 58 | 3300005347 | Ga0070668_100022048 | Ga0070668_1000220485 | 295 |
| 59 | 3300005539 | Ga0068853_100058020 | Ga0068853_1000580203 | 295 |
| 60 | 3300005719 | Ga0068861_100014462 | Ga0068861_1000144622 | 295 |
| 61 | 3300013307 | Ga0157372_10017547 | Ga0157372_100175474 | 295 |
| 62 | 3300025904 | Ga0207647_10022578 | Ga0207647_100225783 | 295 |
| 63 | 3300026041 | Ga0207639_10094719 | Ga0207639_100947193 | 295 |
| 64 | 3300026118 | Ga0207675_100012344 | Ga0207675_1000123447 | 295 |
| 65 | 3300039437 | Ga0436365_1684950 | Ga0436365_1684950_6935_7825 | 295 |
| 66 | 3300046616 | Ga0495668_0003890 | Ga0495668_0003890_2335_3246 | 295 |
| 67 | iso_pu_bacteria | 2881955468 | 2881957939 | 295 |
| 68 | 3300003320 | rootH2_10071298 | rootH2_100712982 | 296 |
| 69 | 3300005456 | Ga0070678_100101386 | Ga0070678_1001013863 | 296 |
| 70 | 3300005471 | Ga0070698_100268973 | Ga0070698_1002689732 | 296 |
| 71 | 3300006237 | Ga0097621_100078264 | Ga0097621_1000782643 | 296 |
| 72 | 3300006358 | Ga0068871_100412364 | Ga0068871_1004123641 | 296 |
| 73 | 3300009094 | Ga0111539_10404620 | Ga0111539_104046202 | 296 |
| 74 | 3300013307 | Ga0157372_10046713 | Ga0157372_100467131 | 296 |
| 75 | 3300014326 | Ga0157380_10065403 | Ga0157380_100654033 | 296 |
| 76 | 3300014326 | Ga0157380_10167575 | Ga0157380_101675752 | 296 |
| 77 | 3300025246 | Ga0209646_1000045 | Ga0209646_1000045223 | 296 |
| 78 | 3300025250 | Ga0209026_1000075 | Ga0209026_100007510 | 296 |
| 79 | 3300025284 | Ga0209130_1000915 | Ga0209130_100091516 | 296 |
| 80 | 3300025302 | Ga0207426_1000073 | Ga0207426_1000073272 | 296 |
| 81 | 3300025940 | Ga0207691_10007459 | Ga0207691_100074596 | 296 |
| 82 | 3300026118 | Ga0207675_100616493 | Ga0207675_1006164932 | 296 |
| 83 | 3300032004 | Ga0307414_10024097 | Ga0307414_100240972 | 296 |
| 84 | 3300035398 | Ga0316574_0052576 | Ga0316574_0052576_471_1379 | 296 |
| 85 | 3300046616 | Ga0495668_0000449 | Ga0495668_0000449_32165_33067 | 296 |
| 86 | 3300049766 | Ga0501269_003229 | Ga0501269_003229_842_1747 | 296 |
| 87 | 3300050511 | nmdc:mga08y16_304070_c1 | nmdc:mga08y16_304070_c1_496_1407 | 296 |
| 88 | 3300053104 | Ga0500556_0079721 | Ga0500556_0079721_254_1156 | 296 |
| 89 | 3300053130 | Ga0500642_0001786 | Ga0500642_0001786_4047_4949 | 296 |
| 90 | 3300005337 | Ga0070682_100002086 | Ga0070682_1000020862 | 297 |
| 91 | 3300005337 | Ga0070682_100046082 | Ga0070682_1000460823 | 297 |
| 92 | 3300005339 | Ga0070660_100054473 | Ga0070660_1000544733 | 297 |
| 93 | 3300005458 | Ga0070681_10004039 | Ga0070681_100040398 | 297 |
| 94 | 3300005530 | Ga0070679_100002167 | Ga0070679_1000021677 | 297 |
| 95 | 3300005539 | Ga0068853_100009576 | Ga0068853_1000095763 | 297 |
| 96 | 3300005547 | Ga0070693_100015415 | Ga0070693_1000154153 | 297 |
| 97 | 3300005563 | Ga0068855_100021586 | Ga0068855_1000215864 | 297 |
| 98 | 3300005834 | Ga0068851_10089793 | Ga0068851_100897932 | 297 |
| 99 | 3300005843 | Ga0068860_100001144 | Ga0068860_10000114412 | 297 |
| 100 | 3300006358 | Ga0068871_100004890 | Ga0068871_1000048902 | 297 |
| 101 | 3300009093 | Ga0105240_10001595 | Ga0105240_1000159533 | 297 |
| 102 | 3300009174 | Ga0105241_10000537 | Ga0105241_100005378 | 297 |
| 103 | 3300013104 | Ga0157370_10002300 | Ga0157370_100023008 | 297 |
| 104 | 3300013306 | Ga0163162_10001991 | Ga0163162_1000199112 | 297 |
| 105 | 3300013306 | Ga0163162_10033927 | Ga0163162_100339272 | 297 |
| 106 | 3300013307 | Ga0157372_10554802 | Ga0157372_105548022 | 297 |
| 107 | 3300014325 | Ga0163163_10419223 | Ga0163163_104192232 | 297 |
| 108 | 3300014969 | Ga0157376_10061558 | Ga0157376_100615583 | 297 |
| 109 | 3300014969 | Ga0157376_10109402 | Ga0157376_101094022 | 297 |
| 110 | 3300025911 | Ga0207654_10002512 | Ga0207654_100025123 | 297 |
| 111 | 3300025912 | Ga0207707_10000051 | Ga0207707_1000005179 | 297 |
| 112 | 3300025913 | Ga0207695_10025675 | Ga0207695_100256757 | 297 |
| 113 | 3300025917 | Ga0207660_10002571 | Ga0207660_100025713 | 297 |
| 114 | 3300025921 | Ga0207652_10000384 | Ga0207652_100003843 | 297 |
| 115 | 3300025949 | Ga0207667_10042538 | Ga0207667_100425384 | 297 |
| 116 | 3300026041 | Ga0207639_10001509 | Ga0207639_100015096 | 297 |
| 117 | 3300028381 | Ga0268264_10001914 | Ga0268264_1000191411 | 297 |
| 118 | 3300038443 | Ga0395901_0273670 | Ga0395901_0273670_364_1272 | 297 |
| 119 | 3300044673 | Ga0453683_0111466 | Ga0453683_0111466_11_910 | 297 |
| 120 | 3300044712 | Ga0453684_0030904 | Ga0453684_0030904_4430_5329 | 297 |
| 121 | 3300046531 | Ga0495665_0175862 | Ga0495665_0175862_17_922 | 297 |
| 122 | 3300046663 | Ga0495635_0270755 | Ga0495635_0270755_104_1009 | 297 |
| 123 | 3300046681 | Ga0495647_0004160 | Ga0495647_0004160_2823_3728 | 297 |
| 124 | 3300046689 | Ga0495613_0115072 | Ga0495613_0115072_455_1360 | 297 |
| 125 | 3300047319 | Ga0495674_0006964 | Ga0495674_0006964_6670_7575 | 297 |
| 126 | 3300005327 | Ga0070658_10205395 | Ga0070658_102053952 | 298 |
| 127 | 3300005330 | Ga0070690_100232980 | Ga0070690_1002329802 | 298 |
| 128 | 3300005340 | Ga0070689_100166634 | Ga0070689_1001666342 | 298 |
| 129 | 3300005367 | Ga0070667_100205731 | Ga0070667_1002057311 | 298 |
| 130 | 3300005466 | Ga0070685_10031507 | Ga0070685_100315073 | 298 |
| 131 | 3300005577 | Ga0068857_100050161 | Ga0068857_1000501612 | 298 |
| 132 | 3300005577 | Ga0068857_100168863 | Ga0068857_1001688632 | 298 |
| 133 | 3300005841 | Ga0068863_100408151 | Ga0068863_1004081512 | 298 |
| 134 | 3300006195 | Ga0075366_10059262 | Ga0075366_100592621 | 298 |
| 135 | 3300013105 | Ga0157369_10006225 | Ga0157369_1000622513 | 298 |
| 136 | 3300013105 | Ga0157369_10150144 | Ga0157369_101501443 | 298 |
| 137 | 3300013296 | Ga0157374_10116436 | Ga0157374_101164361 | 298 |
| 138 | 3300013306 | Ga0163162_10439105 | Ga0163162_104391052 | 298 |
| 139 | 3300013306 | Ga0163162_10533069 | Ga0163162_105330692 | 298 |
| 140 | 3300014745 | Ga0157377_10018817 | Ga0157377_100188173 | 298 |
| 141 | 3300025923 | Ga0207681_10107286 | Ga0207681_101072863 | 298 |
| 142 | 3300026116 | Ga0207674_10028521 | Ga0207674_100285213 | 298 |
| 143 | 3300049665 | Ga0501227_015293 | Ga0501227_015293_720_1652 | 298 |
| 144 | 3300003203 | JGI25406J46586_10032089 | JGI25406J46586_100320892 | 299 |
| 145 | 3300003320 | rootH2_10136644 | rootH2_101366442 | 299 |
| 146 | 3300005290 | Ga0065712_10004487 | Ga0065712_100044873 | 299 |
| 147 | 3300005329 | Ga0070683_100000369 | Ga0070683_10000036928 | 299 |
| 148 | 3300005329 | Ga0070683_100067693 | Ga0070683_1000676933 | 299 |
| 149 | 3300005331 | Ga0070670_100072920 | Ga0070670_1000729201 | 299 |
| 150 | 3300005334 | Ga0068869_100048337 | Ga0068869_1000483372 | 299 |
| 151 | 3300005334 | Ga0068869_100064099 | Ga0068869_1000640992 | 299 |
| 152 | 3300005336 | Ga0070680_100034293 | Ga0070680_1000342932 | 299 |
| 153 | 3300005337 | Ga0070682_100006929 | Ga0070682_1000069293 | 299 |
| 154 | 3300005337 | Ga0070682_100011786 | Ga0070682_1000117862 | 299 |
| 155 | 3300005338 | Ga0068868_100006675 | Ga0068868_1000066755 | 299 |
| 156 | 3300005338 | Ga0068868_100043006 | Ga0068868_1000430061 | 299 |
| 157 | 3300005338 | Ga0068868_100054845 | Ga0068868_1000548452 | 299 |
| 158 | 3300005339 | Ga0070660_100010504 | Ga0070660_1000105042 | 299 |
| 159 | 3300005343 | Ga0070687_100091315 | Ga0070687_1000913152 | 299 |
| 160 | 3300005344 | Ga0070661_100002729 | Ga0070661_1000027294 | 299 |
| 161 | 3300005344 | Ga0070661_100104860 | Ga0070661_1001048602 | 299 |
| 162 | 3300005353 | Ga0070669_100003999 | Ga0070669_1000039997 | 299 |
| 163 | 3300005354 | Ga0070675_100014040 | Ga0070675_1000140407 | 299 |
| 164 | 3300005354 | Ga0070675_100019224 | Ga0070675_1000192244 | 299 |
| 165 | 3300005354 | Ga0070675_100042611 | Ga0070675_1000426112 | 299 |
| 166 | 3300005356 | Ga0070674_100043035 | Ga0070674_1000430352 | 299 |
| 167 | 3300005364 | Ga0070673_100010083 | Ga0070673_1000100835 | 299 |
| 168 | 3300005364 | Ga0070673_100077659 | Ga0070673_1000776591 | 299 |
| 169 | 3300005365 | Ga0070688_100006097 | Ga0070688_1000060977 | 299 |
| 170 | 3300005366 | Ga0070659_100005516 | Ga0070659_1000055167 | 299 |
| 171 | 3300005366 | Ga0070659_100006421 | Ga0070659_1000064212 | 299 |
| 172 | 3300005367 | Ga0070667_100376821 | Ga0070667_1003768211 | 299 |
| 173 | 3300005455 | Ga0070663_100078856 | Ga0070663_1000788562 | 299 |
| 174 | 3300005457 | Ga0070662_100019988 | Ga0070662_1000199882 | 299 |
| 175 | 3300005459 | Ga0068867_100338415 | Ga0068867_1003384151 | 299 |
| 176 | 3300005530 | Ga0070679_100095007 | Ga0070679_1000950072 | 299 |
| 177 | 3300005535 | Ga0070684_100009153 | Ga0070684_1000091534 | 299 |
| 178 | 3300005539 | Ga0068853_100008084 | Ga0068853_1000080844 | 299 |
| 179 | 3300005539 | Ga0068853_100013550 | Ga0068853_1000135501 | 299 |
| 180 | 3300005539 | Ga0068853_100013723 | Ga0068853_1000137233 | 299 |
| 181 | 3300005543 | Ga0070672_100089934 | Ga0070672_1000899343 | 299 |
| 182 | 3300005548 | Ga0070665_100005715 | Ga0070665_1000057157 | 299 |
| 183 | 3300005563 | Ga0068855_100062715 | Ga0068855_1000627153 | 299 |
| 184 | 3300005564 | Ga0070664_100010950 | Ga0070664_1000109504 | 299 |
| 185 | 3300005564 | Ga0070664_100013962 | Ga0070664_1000139625 | 299 |
| 186 | 3300005564 | Ga0070664_100155354 | Ga0070664_1001553542 | 299 |
| 187 | 3300005577 | Ga0068857_100001073 | Ga0068857_10000107321 | 299 |
| 188 | 3300005577 | Ga0068857_100048276 | Ga0068857_1000482763 | 299 |
| 189 | 3300005578 | Ga0068854_100035233 | Ga0068854_1000352332 | 299 |
| 190 | 3300005614 | Ga0068856_100073515 | Ga0068856_1000735153 | 299 |
| 191 | 3300005616 | Ga0068852_100064605 | Ga0068852_1000646052 | 299 |
| 192 | 3300005618 | Ga0068864_100056669 | Ga0068864_1000566692 | 299 |
| 193 | 3300005618 | Ga0068864_100295539 | Ga0068864_1002955391 | 299 |
| 194 | 3300005718 | Ga0068866_10191938 | Ga0068866_101919381 | 299 |
| 195 | 3300005719 | Ga0068861_100015292 | Ga0068861_1000152925 | 299 |
| 196 | 3300005840 | Ga0068870_10031399 | Ga0068870_100313993 | 299 |
| 197 | 3300005841 | Ga0068863_100014788 | Ga0068863_1000147883 | 299 |
| 198 | 3300005985 | Ga0081539_10000284 | Ga0081539_1000028429 | 299 |
| 199 | 3300006195 | Ga0075366_10036958 | Ga0075366_100369583 | 299 |
| 200 | 3300006237 | Ga0097621_100065368 | Ga0097621_1000653682 | 299 |
| 201 | 3300006358 | Ga0068871_100055504 | Ga0068871_1000555042 | 299 |
| 202 | 3300009094 | Ga0111539_10006460 | Ga0111539_1000646011 | 299 |
| 203 | 3300009553 | Ga0105249_10018954 | Ga0105249_100189543 | 299 |
| 204 | 3300011119 | Ga0105246_10006371 | Ga0105246_100063713 | 299 |
| 205 | 3300013100 | Ga0157373_10015575 | Ga0157373_100155752 | 299 |
| 206 | 3300013100 | Ga0157373_10273568 | Ga0157373_102735681 | 299 |
| 207 | 3300013102 | Ga0157371_10040080 | Ga0157371_100400802 | 299 |
| 208 | 3300013104 | Ga0157370_10070449 | Ga0157370_100704492 | 299 |
| 209 | 3300013296 | Ga0157374_10105570 | Ga0157374_101055702 | 299 |
| 210 | 3300013297 | Ga0157378_10004603 | Ga0157378_100046037 | 299 |
| 211 | 3300013306 | Ga0163162_10036616 | Ga0163162_100366162 | 299 |
| 212 | 3300013308 | Ga0157375_10015758 | Ga0157375_100157588 | 299 |
| 213 | 3300013308 | Ga0157375_10208486 | Ga0157375_102084862 | 299 |
| 214 | 3300014326 | Ga0157380_10000293 | Ga0157380_100002934 | 299 |
| 215 | 3300014969 | Ga0157376_10072378 | Ga0157376_100723782 | 299 |
| 216 | 3300025893 | Ga0207682_10184394 | Ga0207682_101843941 | 299 |
| 217 | 3300025901 | Ga0207688_10033799 | Ga0207688_100337992 | 299 |
| 218 | 3300025904 | Ga0207647_10011231 | Ga0207647_100112318 | 299 |
| 219 | 3300025904 | Ga0207647_10124392 | Ga0207647_101243921 | 299 |
| 220 | 3300025907 | Ga0207645_10002879 | Ga0207645_100028794 | 299 |
| 221 | 3300025908 | Ga0207643_10004330 | Ga0207643_100043303 | 299 |
| 222 | 3300025917 | Ga0207660_10075247 | Ga0207660_100752472 | 299 |
| 223 | 3300025919 | Ga0207657_10014992 | Ga0207657_100149922 | 299 |
| 224 | 3300025920 | Ga0207649_10005554 | Ga0207649_100055544 | 299 |
| 225 | 3300025923 | Ga0207681_10036739 | Ga0207681_100367393 | 299 |
| 226 | 3300025926 | Ga0207659_10071806 | Ga0207659_100718062 | 299 |
| 227 | 3300025926 | Ga0207659_10091426 | Ga0207659_100914262 | 299 |
| 228 | 3300025932 | Ga0207690_10005267 | Ga0207690_100052675 | 299 |
| 229 | 3300025933 | Ga0207706_10014523 | Ga0207706_100145233 | 299 |
| 230 | 3300025933 | Ga0207706_10353954 | Ga0207706_103539542 | 299 |
| 231 | 3300025940 | Ga0207691_10010295 | Ga0207691_100102959 | 299 |
| 232 | 3300025940 | Ga0207691_10096425 | Ga0207691_100964253 | 299 |
| 233 | 3300025942 | Ga0207689_10003798 | Ga0207689_1000379810 | 299 |
| 234 | 3300025942 | Ga0207689_10253658 | Ga0207689_102536582 | 299 |
| 235 | 3300025944 | Ga0207661_10001165 | Ga0207661_1000116514 | 299 |
| 236 | 3300025944 | Ga0207661_10071553 | Ga0207661_100715532 | 299 |
| 237 | 3300025945 | Ga0207679_10000182 | Ga0207679_1000018230 | 299 |
| 238 | 3300025945 | Ga0207679_10052643 | Ga0207679_100526432 | 299 |
| 239 | 3300025945 | Ga0207679_10169717 | Ga0207679_101697172 | 299 |
| 240 | 3300025949 | Ga0207667_10126221 | Ga0207667_101262212 | 299 |
| 241 | 3300025960 | Ga0207651_10141308 | Ga0207651_101413082 | 299 |
| 242 | 3300025960 | Ga0207651_10218853 | Ga0207651_102188532 | 299 |
| 243 | 3300025961 | Ga0207712_10130436 | Ga0207712_101304362 | 299 |
| 244 | 3300025986 | Ga0207658_10144134 | Ga0207658_101441342 | 299 |
| 245 | 3300025986 | Ga0207658_10453778 | Ga0207658_104537781 | 299 |
| 246 | 3300026023 | Ga0207677_10032666 | Ga0207677_100326663 | 299 |
| 247 | 3300026023 | Ga0207677_10072563 | Ga0207677_100725632 | 299 |
| 248 | 3300026041 | Ga0207639_10007164 | Ga0207639_100071644 | 299 |
| 249 | 3300026041 | Ga0207639_10012851 | Ga0207639_100128512 | 299 |
| 250 | 3300026067 | Ga0207678_10120069 | Ga0207678_101200691 | 299 |
| 251 | 3300026088 | Ga0207641_10102541 | Ga0207641_101025412 | 299 |
| 252 | 3300026089 | Ga0207648_10092667 | Ga0207648_100926673 | 299 |
| 253 | 3300026089 | Ga0207648_10155724 | Ga0207648_101557242 | 299 |
| 254 | 3300026095 | Ga0207676_10050877 | Ga0207676_100508771 | 299 |
| 255 | 3300026116 | Ga0207674_10003912 | Ga0207674_1000391214 | 299 |
| 256 | 3300026116 | Ga0207674_10018544 | Ga0207674_100185444 | 299 |
| 257 | 3300026118 | Ga0207675_100007524 | Ga0207675_1000075247 | 299 |
| 258 | 3300026121 | Ga0207683_10003728 | Ga0207683_100037288 | 299 |
| 259 | 3300026142 | Ga0207698_10057057 | Ga0207698_100570573 | 299 |
| 260 | 3300026142 | Ga0207698_10060795 | Ga0207698_100607952 | 299 |
| 261 | 3300028379 | Ga0268266_10005697 | Ga0268266_100056976 | 299 |
| 262 | 3300028380 | Ga0268265_10196248 | Ga0268265_101962481 | 299 |
| 263 | 3300028381 | Ga0268264_10203579 | Ga0268264_102035792 | 299 |
| 264 | 3300032005 | Ga0307411_10059310 | Ga0307411_100593102 | 299 |
| 265 | 3300050493 | nmdc:mga0k408_51763_c1 | nmdc:mga0k408_51763_c1_1394_2311 | 299 |
| 266 | 3300050511 | nmdc:mga08y16_11589_c1 | nmdc:mga08y16_11589_c1_2733_3659 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zm5-assembly1.cif.gz_A | crystal structure of trna modification enzyme miaa in the complex with trna(phe) | 0.9288 | 6 | 290 |
| 3w90-assembly1.cif.gz_A | crystal structure of cmp kinase from thermus thermophilus hb8 | 0.926 | 8 | 37 |
| 2zm5-assembly1.cif.gz_A | crystal structure of trna modification enzyme miaa in the complex with trna(phe) | 0.9105 | 6 | 290 |
| 3crr-assembly1.cif.gz_A | structure of trna dimethylallyltransferase: rna modification through a channel | 0.8647 | 6 | 289 |
| 3akd-assembly1.cif.gz_A | crystal structure of cmp kinase in complex with cdp from thermus thermophilus hb8 | 0.8466 | 8 | 44 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3exaA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain | 0.9638 | 197 | 269 | 1.10.287.890 |
| 2qgnA02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain | 0.942 | 204 | 269 | 1.10.287.890 |
| 3crrA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9275 | 6 | 111 | 3.40.50.300 |
| 3w90A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.926 | 8 | 37 | 3.40.50.300 |
| af_P9WJW1_115_180_1.10.20.140 | Mainly Alpha;Orthogonal Bundle;Histone, subunit A; | 0.9098 | 113 | 176 | 1.10.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9KPC4-F1-model_v4 | tRNA dimethylallyltransferase (EC 2.5.1.75) | 0.9837 | 6 | 223 |
GO:0005524
GO:0006400 GO:0052381 |
| AF-A0A4Q6AUH5-F1-model_v4 | tRNA dimethylallyltransferase (EC 2.5.1.75) | 0.9829 | 5 | 256 |
GO:0005524
GO:0006400 GO:0052381 |
| AF-A0A4R7ELN6-F1-model_v4 | deleted | 0.982 | 5 | 289 |
|
| AF-A0A2N6A3D7-F1-model_v4 | tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) | 0.9798 | 5 | 289 |
GO:0005524
GO:0006400 GO:0052381 |
| AF-A0A6N6M602-F1-model_v4 | tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) | 0.9778 | 6 | 278 |
GO:0005524
GO:0006400 GO:0052381 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar