F374076

General Info

Members Datasets Scaffolds Average Seq Length
266 177 530 270

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10022173|Ga0157370_100221733
Length 317
Sequence VKSFSLKYQLKDFLVKCFYFEPIRFGYSLPHFGNSCVCSNPELCPIIFKSRKMKTIFITGASTGLGKATAQLFQNKGWKVIATMRNPEAAADLANLENVTVLPLDVTNPEQIQSTVKQALELGDIDVVYNNAGYGLIGPLEAISDDQIVKQLDTNLLGVIRVTQAFIPYFREQKKGMFISTTSIGGLVAFPLGSTYHATKWALEGWSESLAFELNTLGIDIKTVSPGGIKTDFVSRSLDSASSPAYEDMTNSLFSKMEGMMEAASTPEQIAEVVYEAATDGKKQLRYVAGEDAKAIYAQRLELGDEAFREQFGKQFI

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
83 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
84 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
85 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
93 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
94 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
95 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
131 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
138 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
139 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
143 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
144 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
145 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
146 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
147 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
148 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
149 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
150 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
151 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
152 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
153 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
154 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
155 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
156 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
157 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
158 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
159 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
160 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
161 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
162 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
163 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
164 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
165 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
166 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
167 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
168 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
169 2914759650 Rhizosphaericola mali Isolate Rhizosphere
170 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
171 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
172 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
173 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
174 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
175 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
176 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
177 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.83
Metatranscriptomes 0
Isolates 16.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 0.75
Rhizoplane 2.26
Rhizosphere 74.81
Stem 0
Stem Tuber 0
Unclassified 6.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10022173 3300013104 Bacteria 6321
2 SwRhRL2b_contig_1590904 2162886007 Bacteria 5979
3 SwRhRL2b_contig_2390258 2162886007 Bacteria 1215
4 SwRhRL2b_contig_815651 2162886007 Bacteria 1373
5 JGI24741J21665_1002423 3300001915 Bacteria 4844
6 JGI25162J39368_1000145 3300002737 Bacteria 77086
7 rootH1_10184646 3300003316 Bacteria 1710
8 rootH2_10013724 3300003320 Bacteria 9408
9 rootH2_10033173 3300003320 Bacteria 5651
10 rootH2_10079232 3300003320 Bacteria 5667
11 rootH2_10198102 3300003320 Bacteria 2797
12 rootL2_10113050 3300003322 Unclassified 1797
13 rootH1_10324645 3300003323 Bacteria 3303
14 Ga0055529_1005928 3300003763 Bacteria 1738
15 Ga0055534_1006174 3300003784 Bacteria 3067
16 Ga0055531_10000063 3300003794 Bacteria 119938
17 Ga0055531_10000311 3300003794 Bacteria 47873
18 Ga0065714_10030919 3300005288 Bacteria 1311
19 Ga0065714_10091735 3300005288 Bacteria 1900
20 Ga0065704_10071392 3300005289 Bacteria 11347
21 Ga0065704_10078270 3300005289 Bacteria 4477
22 Ga0065704_10185694 3300005289 Bacteria 1214
23 Ga0065707_10111327 3300005295 Bacteria 2398
24 Ga0065707_10277080 3300005295 Bacteria 1050
25 Ga0070682_100000245 3300005337 Bacteria 39270
26 Ga0070660_100044482 3300005339 Bacteria 3397
27 Ga0070687_100002295 3300005343 Bacteria 7103
28 Ga0070668_100128303 3300005347 Bacteria 2033
29 Ga0070668_100311808 3300005347 Bacteria 1322
30 Ga0070705_100022111 3300005440 Bacteria 3393
31 Ga0070694_100160609 3300005444 Bacteria 1648
32 Ga0070708_100485105 3300005445 Unclassified 1166
33 Ga0070706_100131001 3300005467 Unclassified 2340
34 Ga0070706_100165462 3300005467 Bacteria 2065
35 Ga0070706_100532804 3300005467 Bacteria 1092
36 Ga0070707_100002916 3300005468 Bacteria 16239
37 Ga0070707_100019613 3300005468 Bacteria 6373
38 Ga0070707_100038318 3300005468 Bacteria 4578
39 Ga0070707_100755751 3300005468 Bacteria 936
40 Ga0070698_100272007 3300005471 Bacteria 1626
41 Ga0070699_100110269 3300005518 Bacteria 2415
42 Ga0070699_100317504 3300005518 Unclassified 1400
43 Ga0070697_100000735 3300005536 Bacteria 24411
44 Ga0070686_100135736 3300005544 Bacteria 1707
45 Ga0070696_100057352 3300005546 Bacteria 2718
46 Ga0070704_100011434 3300005549 Bacteria 5440
47 Ga0070704_100048897 3300005549 Bacteria 2962
48 Ga0068857_100047917 3300005577 Bacteria 3795
49 Ga0070716_100001938 3300006173 Bacteria 9402
50 Ga0070716_100026970 3300006173 Bacteria 3081
51 Ga0070712_100006270 3300006175 Bacteria 7367
52 Ga0075428_100460466 3300006844 Bacteria 1362
53 Ga0075433_10179528 3300006852 Unclassified 1883
54 Ga0075434_100080062 3300006871 Bacteria 3263
55 Ga0075434_100293176 3300006871 Unclassified 1647
56 Ga0075429_100011631 3300006880 Bacteria 7633
57 Ga0075429_100194368 3300006880 Bacteria 1777
58 Ga0075436_100315826 3300006914 Bacteria 1122
59 Ga0099794_10029215 3300007265 Bacteria 2568
60 Ga0105244_10000244 3300009036 Bacteria 55612
61 Ga0105244_10032351 3300009036 Bacteria 2769
62 Ga0105240_10000098 3300009093 Bacteria 178435
63 Ga0114129_10012303 3300009147 Bacteria 12175
64 Ga0114129_10068332 3300009147 Bacteria 4955
65 Ga0114129_10130842 3300009147 Bacteria 3447
66 Ga0114129_10358010 3300009147 Bacteria 1931
67 Ga0114129_10447672 3300009147 Bacteria 1694
68 Ga0114129_10459901 3300009147 Unclassified 1668
69 Ga0114129_10500841 3300009147 Unclassified 1586
70 Ga0114129_11062648 3300009147 Bacteria 1016
71 Ga0105243_10000127 3300009148 Bacteria 86196
72 Ga0105243_10000408 3300009148 Bacteria 45109
73 Ga0105243_10085427 3300009148 Bacteria 2587
74 Ga0105243_10164679 3300009148 Bacteria 1915
75 Ga0105241_10100933 3300009174 Bacteria 2294
76 Ga0105237_10017970 3300009545 Bacteria 7326
77 Ga0105239_10000038 3300010375 Bacteria 205230
78 Ga0105239_10000193 3300010375 Bacteria 88304
79 Ga0105239_10079922 3300010375 Unclassified 3598
80 Ga0105239_10296018 3300010375 Unclassified 1822
81 Ga0105246_10102034 3300011119 Bacteria 2091
82 Ga0157373_10016509 3300013100 Bacteria 5384
83 Ga0157370_10148151 3300013104 Bacteria 2185
84 Ga0157370_10369100 3300013104 Bacteria 1322
85 Ga0157369_10000046 3300013105 Bacteria 172851
86 Ga0157378_10277937 3300013297 Bacteria 1613
87 Ga0163162_10203754 3300013306 Bacteria 2107
88 Ga0157375_10040571 3300013308 Bacteria 4488
89 Ga0163163_10090004 3300014325 Bacteria 3082
90 Ga0157376_10853290 3300014969 Bacteria 926
91 Ga0182006_1000011 3300015261 Bacteria 408647
92 Ga0182006_1000243 3300015261 Bacteria 50809
93 Ga0182007_10000009 3300015262 Bacteria 316298
94 Ga0163161_10000179 3300017792 Bacteria 57833
95 Ga0163161_10000301 3300017792 Bacteria 42977
96 Ga0163161_10007031 3300017792 Bacteria 7786
97 Ga0209437_100225 3300025233 Bacteria 100605
98 Ga0209129_1006895 3300025258 Unclassified 3530
99 Ga0209455_1006265 3300025272 Bacteria 3541
100 Ga0209675_1000032 3300025291 Bacteria 273013
101 Ga0209257_1000001 3300025304 Bacteria 2274655
102 Ga0209257_1000008 3300025304 Bacteria 1294570
103 Ga0207655_1000702 3300025728 Bacteria 38833
104 Ga0207653_10028116 3300025885 Bacteria 1807
105 Ga0207647_10002872 3300025904 Bacteria 12977
106 Ga0207643_10201270 3300025908 Bacteria 1213
107 Ga0207684_10012650 3300025910 Bacteria 7329
108 Ga0207684_10018550 3300025910 Bacteria 5956
109 Ga0207684_10388597 3300025910 Bacteria 1200
110 Ga0207654_10069067 3300025911 Bacteria 2092
111 Ga0207654_10111183 3300025911 Bacteria 1705
112 Ga0207695_10000041 3300025913 Bacteria 450902
113 Ga0207695_10013161 3300025913 Bacteria 9876
114 Ga0207671_10011162 3300025914 Bacteria 7336
115 Ga0207662_10094395 3300025918 Bacteria 1845
116 Ga0207657_10131850 3300025919 Bacteria 2048
117 Ga0207646_10005421 3300025922 Bacteria 13417
118 Ga0207646_10007087 3300025922 Bacteria 11467
119 Ga0207646_10308783 3300025922 Unclassified 1429
120 Ga0207664_10171567 3300025929 Bacteria 1857
121 Ga0207706_10455014 3300025933 Bacteria 1107
122 Ga0207709_10000176 3300025935 Bacteria 86175
123 Ga0207709_10000458 3300025935 Bacteria 37753
124 Ga0207704_10098698 3300025938 Bacteria 1941
125 Ga0207665_10009157 3300025939 Bacteria 6501
126 Ga0207665_10335300 3300025939 Bacteria 1138
127 Ga0207668_10126999 3300025972 Bacteria 1941
128 Ga0207668_10297708 3300025972 Bacteria 1330
129 Ga0207678_10038399 3300026067 Bacteria 4160
130 Ga0207708_10117937 3300026075 Bacteria 2066
131 Ga0207674_10290190 3300026116 Bacteria 1584
132 Ga0316177_1187600 3300030731 Bacteria 15933
133 Ga0316176_1135095 3300030732 Bacteria 6038
134 Ga0316183_1130548 3300030742 Bacteria 20229
135 Ga0316181_1139466 3300030744 Bacteria 10044
136 Ga0265314_10072977 3300031711 Bacteria 2290
137 Ga0307407_10000001 3300031903 Bacteria 570048
138 Ga0307412_10000012 3300031911 Bacteria 404180
139 Ga0307412_10047875 3300031911 Bacteria 2809
140 Ga0307409_100005777 3300031995 Bacteria 7175
141 Ga0307416_100000008 3300032002 Bacteria 401343
142 Ga0307416_100000010 3300032002 Bacteria 320243
143 Ga0307414_10000503 3300032004 Bacteria 20393
144 Ga0307414_10024147 3300032004 Bacteria 3871
145 Ga0439465_0017203 3300041413 Bacteria 2256
146 Ga0451839_0054704 3300041496 Bacteria 1493
147 Ga0439445_0000039 3300042004 Bacteria 17900
148 Ga0439432_065473 3300042006 Bacteria 1114
149 Ga0466972_0203234 3300044658 Unclassified 928
150 Ga0466957_0071873 3300044842 Unclassified 2141
151 Ga0495627_000003 3300046453 Bacteria 704557
152 Ga0495638_0000015 3300046460 Bacteria 414645
153 Ga0495596_0000771 3300046500 Bacteria 19541
154 Ga0495606_0000002 3300046507 Bacteria 554637
155 Ga0495606_0028165 3300046507 Bacteria 3968
156 Ga0495610_0000001 3300046512 Bacteria 1620061
157 Ga0495610_0001338 3300046512 Bacteria 21856
158 Ga0495610_0036576 3300046512 Unclassified 2507
159 Ga0495632_0008180 3300046519 Bacteria 6459
160 Ga0495637_0003454 3300046520 Bacteria 8397
161 Ga0495654_0000001 3300046530 Bacteria 1513197
162 Ga0495621_0168739 3300046539 Bacteria 869
163 Ga0495633_0000008 3300046558 Bacteria 301830
164 Ga0495633_0001146 3300046558 Bacteria 21264
165 Ga0495633_0001538 3300046558 Bacteria 17716
166 Ga0495633_0002825 3300046558 Bacteria 11971
167 Ga0495625_0001703 3300046660 Bacteria 25608
168 Ga0495661_0005878 3300046665 Bacteria 8672
169 Ga0495661_0009217 3300046665 Bacteria 6782
170 Ga0495613_0079814 3300046689 Bacteria 2379
171 Ga0495687_000739 3300047443 Bacteria 35614
172 Ga0495673_0045941 3300047469 Bacteria 1938
173 Ga0495686_0000040 3300047472 Bacteria 301210
174 Ga0495686_0015778 3300047472 Bacteria 5143
175 Ga0495686_0117234 3300047472 Unclassified 1591
176 Ga0496102_0000534 3300048905 Bacteria 41154
177 Ga0496102_0055747 3300048905 Bacteria 3604
178 Ga0496103_0120449 3300048906 Bacteria 1671
179 Ga0496104_0026788 3300048907 Bacteria 5328
180 Ga0496113_0055286 3300048916 Bacteria 2975
181 Ga0496115_0006636 3300048918 Bacteria 8490
182 Ga0496116_0000012 3300048919 Bacteria 611365
183 Ga0496116_0001564 3300048919 Bacteria 25266
184 Ga0496117_0000050 3300048920 Bacteria 292727
185 Ga0496118_0000044 3300048921 Bacteria 283524
186 Ga0496118_0034838 3300048921 Bacteria 4100
187 Ga0496119_0000002 3300048922 Bacteria 738385
188 Ga0496122_0000090 3300048925 Bacteria 205886
189 Ga0496122_0000465 3300048925 Bacteria 84396
190 Ga0496122_0000658 3300048925 Bacteria 69587
191 Ga0496122_0002721 3300048925 Bacteria 24530
192 Ga0496122_0002758 3300048925 Bacteria 24241
193 Ga0496122_0014407 3300048925 Bacteria 7649
194 Ga0496123_0000856 3300048926 Bacteria 48564
195 Ga0496123_0008334 3300048926 Bacteria 9540
196 Ga0496123_0008808 3300048926 Bacteria 9201
197 Ga0496123_0026427 3300048926 Bacteria 4347
198 Ga0496123_0100792 3300048926 Bacteria 1681
199 Ga0496124_0020102 3300048927 Bacteria 6183
200 Ga0496124_0148002 3300048927 Unclassified 1846
201 Ga0496125_0000349 3300048928 Bacteria 87610
202 Ga0496125_0005317 3300048928 Bacteria 14393
203 Ga0496126_0004122 3300048929 Bacteria 17589
204 Ga0496126_0065412 3300048929 Bacteria 3254
205 Ga0501034_0025469 3300049571 Bacteria 6023
206 Ga0501080_0494079 3300049742 Bacteria 1094
207 Ga0501241_000013 3300049758 Bacteria 104728
208 Ga0501241_000971 3300049758 Bacteria 6058
209 Ga0501269_000241 3300049766 Bacteria 16034
210 nmdc:mga05p37_294771_c1 3300050507 Bacteria 1929
211 nmdc:mga05p37_304356_c2 3300050507 Bacteria 1325
212 nmdc:mga05p37_327868_c1 3300050507 Bacteria 1809
213 nmdc:mga06r32_19895_c1 3300050510 Bacteria 6170
214 nmdc:mga08y16_457362_c1 3300050511 Bacteria 1301
215 nmdc:mga0rr50_146658_c1 3300050513 Bacteria 1903
216 nmdc:mga0a205_134791_c1 3300050515 Unclassified 2370
217 nmdc:mga0a205_608635_c1 3300050515 Bacteria 945
218 Ga0500556_0001275 3300053104 Bacteria 11468
219 Ga0500562_006632 3300053108 Bacteria 2918
220 Ga0500618_021008 3300053125 Bacteria 1596
221 Ga0500616_0035395 3300053153 Bacteria 2715
222 Ga0500645_036857 3300053730 Bacteria 1454
223 2511234721 2511231000 Bacteria 4488346
224 2585144695 2582581278 Bacteria 5296881
225 2585144841 2582581278 Bacteria 5296881
226 2585159384 2582581281 Bacteria 4487904
227 2585163659 2582581282 Bacteria 4495830
228 2587679692 2585428045 Bacteria 5203023
229 2587679724 2585428045 Bacteria 5203023
230 2587747968 2585428060 Bacteria 5304711
231 2587942981 2585428115 Bacteria 4420269
232 2588208444 2585428182 Bacteria 5007281
233 2588213055 2585428183 Bacteria 5166119
234 2588219646 2585428184 Bacteria 4978681
235 2588224043 2585428185 Bacteria 4969476
236 2588233554 2585428187 Bacteria 4629388
237 2588234341 2585428187 Bacteria 4629388
238 2588446340 2588253712 Bacteria 5403181
239 2590600996 2588254255 Bacteria 5014294
240 2590601028 2588254255 Bacteria 5014294
241 2590611630 2588254257 Bacteria 5436094
242 2590612784 2588254257 Bacteria 5436094
243 2644686017 2643221725 Bacteria 5087956
244 2722728885 2721755487 Bacteria 6357185
245 2729201614 2728369107 Bacteria 5082720
246 2740057526 2739367874 Bacteria 4872888
247 2765572431 2765235839 Bacteria 5314748
248 2765573483 2765235839 Bacteria 5314748
249 2775672984 2775506739 Bacteria 3855222
250 2816872716 2816332188 Bacteria 5133218
251 2842084114 2842083920 Bacteria 4857652
252 2842904622 2842903701 Bacteria 6986368
253 2871721691 2871720351 Bacteria 4862476
254 2871721758 2871720351 Bacteria 4862476
255 2889291932 2889290771 Bacteria 5530962
256 2906000883 2905999023 Bacteria 4591259
257 2914760809 2914759650 Bacteria 4701441
258 2919099402 2919097161 Bacteria 3860339
259 2919402812 2919399522 Bacteria 5164947
260 2929180635 2929177148 Bacteria 7883697
261 2929242473 2929239360 Bacteria 7745570
262 2945927425 2945924605 Bacteria 4296724
263 2945983034 2945977869 Bacteria 7777518
264 2946017571 2946013367 Bacteria 7766675
265 2946021309 2946019816 Bacteria 4621265
266 Ga0157370_10022173
267 SwRhRL2b_contig_1590904
268 SwRhRL2b_contig_2390258
269 SwRhRL2b_contig_815651
270 JGI24741J21665_1002423
271 JGI25162J39368_1000145
272 rootH1_10184646
273 rootH2_10013724
274 rootH2_10033173
275 rootH2_10079232
276 rootH2_10198102
277 rootL2_10113050
278 rootH1_10324645
279 Ga0055529_1005928
280 Ga0055534_1006174
281 Ga0055531_10000063
282 Ga0055531_10000311
283 Ga0065714_10030919
284 Ga0065714_10091735
285 Ga0065704_10071392
286 Ga0065704_10078270
287 Ga0065704_10185694
288 Ga0065707_10111327
289 Ga0065707_10277080
290 Ga0070682_100000245
291 Ga0070660_100044482
292 Ga0070687_100002295
293 Ga0070668_100128303
294 Ga0070668_100311808
295 Ga0070705_100022111
296 Ga0070694_100160609
297 Ga0070708_100485105
298 Ga0070706_100131001
299 Ga0070706_100165462
300 Ga0070706_100532804
301 Ga0070707_100002916
302 Ga0070707_100019613
303 Ga0070707_100038318
304 Ga0070707_100755751
305 Ga0070698_100272007
306 Ga0070699_100110269
307 Ga0070699_100317504
308 Ga0070697_100000735
309 Ga0070686_100135736
310 Ga0070696_100057352
311 Ga0070704_100011434
312 Ga0070704_100048897
313 Ga0068857_100047917
314 Ga0070716_100001938
315 Ga0070716_100026970
316 Ga0070712_100006270
317 Ga0075428_100460466
318 Ga0075433_10179528
319 Ga0075434_100080062
320 Ga0075434_100293176
321 Ga0075429_100011631
322 Ga0075429_100194368
323 Ga0075436_100315826
324 Ga0099794_10029215
325 Ga0105244_10000244
326 Ga0105244_10032351
327 Ga0105240_10000098
328 Ga0114129_10012303
329 Ga0114129_10068332
330 Ga0114129_10130842
331 Ga0114129_10358010
332 Ga0114129_10447672
333 Ga0114129_10459901
334 Ga0114129_10500841
335 Ga0114129_11062648
336 Ga0105243_10000127
337 Ga0105243_10000408
338 Ga0105243_10085427
339 Ga0105243_10164679
340 Ga0105241_10100933
341 Ga0105237_10017970
342 Ga0105239_10000038
343 Ga0105239_10000193
344 Ga0105239_10079922
345 Ga0105239_10296018
346 Ga0105246_10102034
347 Ga0157373_10016509
348 Ga0157370_10148151
349 Ga0157370_10369100
350 Ga0157369_10000046
351 Ga0157378_10277937
352 Ga0163162_10203754
353 Ga0157375_10040571
354 Ga0163163_10090004
355 Ga0157376_10853290
356 Ga0182006_1000011
357 Ga0182006_1000243
358 Ga0182007_10000009
359 Ga0163161_10000179
360 Ga0163161_10000301
361 Ga0163161_10007031
362 Ga0209437_100225
363 Ga0209129_1006895
364 Ga0209455_1006265
365 Ga0209675_1000032
366 Ga0209257_1000001
367 Ga0209257_1000008
368 Ga0207655_1000702
369 Ga0207653_10028116
370 Ga0207647_10002872
371 Ga0207643_10201270
372 Ga0207684_10012650
373 Ga0207684_10018550
374 Ga0207684_10388597
375 Ga0207654_10069067
376 Ga0207654_10111183
377 Ga0207695_10000041
378 Ga0207695_10013161
379 Ga0207671_10011162
380 Ga0207662_10094395
381 Ga0207657_10131850
382 Ga0207646_10005421
383 Ga0207646_10007087
384 Ga0207646_10308783
385 Ga0207664_10171567
386 Ga0207706_10455014
387 Ga0207709_10000176
388 Ga0207709_10000458
389 Ga0207704_10098698
390 Ga0207665_10009157
391 Ga0207665_10335300
392 Ga0207668_10126999
393 Ga0207668_10297708
394 Ga0207678_10038399
395 Ga0207708_10117937
396 Ga0207674_10290190
397 Ga0316177_1187600
398 Ga0316176_1135095
399 Ga0316183_1130548
400 Ga0316181_1139466
401 Ga0265314_10072977
402 Ga0307407_10000001
403 Ga0307412_10000012
404 Ga0307412_10047875
405 Ga0307409_100005777
406 Ga0307416_100000008
407 Ga0307416_100000010
408 Ga0307414_10000503
409 Ga0307414_10024147
410 Ga0439465_0017203
411 Ga0451839_0054704
412 Ga0439445_0000039
413 Ga0439432_065473
414 Ga0466972_0203234
415 Ga0466957_0071873
416 Ga0495627_000003
417 Ga0495638_0000015
418 Ga0495596_0000771
419 Ga0495606_0000002
420 Ga0495606_0028165
421 Ga0495610_0000001
422 Ga0495610_0001338
423 Ga0495610_0036576
424 Ga0495632_0008180
425 Ga0495637_0003454
426 Ga0495654_0000001
427 Ga0495621_0168739
428 Ga0495633_0000008
429 Ga0495633_0001146
430 Ga0495633_0001538
431 Ga0495633_0002825
432 Ga0495625_0001703
433 Ga0495661_0005878
434 Ga0495661_0009217
435 Ga0495613_0079814
436 Ga0495687_000739
437 Ga0495673_0045941
438 Ga0495686_0000040
439 Ga0495686_0015778
440 Ga0495686_0117234
441 Ga0496102_0000534
442 Ga0496102_0055747
443 Ga0496103_0120449
444 Ga0496104_0026788
445 Ga0496113_0055286
446 Ga0496115_0006636
447 Ga0496116_0000012
448 Ga0496116_0001564
449 Ga0496117_0000050
450 Ga0496118_0000044
451 Ga0496118_0034838
452 Ga0496119_0000002
453 Ga0496122_0000090
454 Ga0496122_0000465
455 Ga0496122_0000658
456 Ga0496122_0002721
457 Ga0496122_0002758
458 Ga0496122_0014407
459 Ga0496123_0000856
460 Ga0496123_0008334
461 Ga0496123_0008808
462 Ga0496123_0026427
463 Ga0496123_0100792
464 Ga0496124_0020102
465 Ga0496124_0148002
466 Ga0496125_0000349
467 Ga0496125_0005317
468 Ga0496126_0004122
469 Ga0496126_0065412
470 Ga0501034_0025469
471 Ga0501080_0494079
472 Ga0501241_000013
473 Ga0501241_000971
474 Ga0501269_000241
475 nmdc:mga05p37_294771_c1
476 nmdc:mga05p37_304356_c2
477 nmdc:mga05p37_327868_c1
478 nmdc:mga06r32_19895_c1
479 nmdc:mga08y16_457362_c1
480 nmdc:mga0rr50_146658_c1
481 nmdc:mga0a205_134791_c1
482 nmdc:mga0a205_608635_c1
483 Ga0500556_0001275
484 Ga0500562_006632
485 Ga0500618_021008
486 Ga0500616_0035395
487 Ga0500645_036857
488 2511234721
489 2585144695
490 2585144841
491 2585159384
492 2585163659
493 2587679692
494 2587679724
495 2587747968
496 2587942981
497 2588208444
498 2588213055
499 2588219646
500 2588224043
501 2588233554
502 2588234341
503 2588446340
504 2590600996
505 2590601028
506 2590611630
507 2590612784
508 2644686017
509 2722728885
510 2729201614
511 2740057526
512 2765572431
513 2765573483
514 2775672984
515 2816872716
516 2842084114
517 2842904622
518 2871721691
519 2871721758
520 2889291932
521 2906000883
522 2914760809
523 2919099402
524 2919402812
525 2929180635
526 2929242473
527 2945927425
528 2945983034
529 2946017571
530 2946021309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

54

241

0.95

PF08643

DUF1776

Fungal family of unknown function (DUF1776)

58

285

0.91

PF08659

KR

KR domain

54

225

0.88

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

60

293

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

60

232

0.8

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

56

213

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fdu-assembly1.cif.gz_A human 17-beta-hydroxysteroid-dehydrogenase type 1 mutant h221l complexed with estradiol and nadp+ 0.9148 33 296
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9126 33 271
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9121 34 275
4cql-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9084 32 269
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9067 34 268
ID Description Score Start End Superfamily
af_P0CU01_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9512 65 294 3.40.50.720
af_P0CU01_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9392 65 294 3.40.50.720
af_B4FAP3_11_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 33 275 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9226 28 203 3.40.50.720
af_Q54HS2_3_244_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9218 33 264 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A232LMN1-F1-model_v4 Uncharacterized protein 0.9886 64 163 GO:0016491
AF-A0A1A8VD90-F1-model_v4 Retinol dehydrogenase 8b 0.9795 106 203 GO:0004745
GO:0005829
GO:0016020
GO:0042572
AF-A0A232LMN1-F1-model_v4 Uncharacterized protein 0.9694 64 163 GO:0016491
AF-A0A529HNC3-F1-model_v4 SDR family oxidoreductase 0.9692 85 208 GO:0016491
AF-A0A2N7U5K0-F1-model_v4 Short-chain dehydrogenase/reductase 0.964 32 296 GO:0016491

Map