F374098

General Info

Members Datasets Scaffolds Average Seq Length
266 169 532 267

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10136232|Ga0157380_101362323
Length 280
Sequence LDGEFGELTSEQADILQRIESYKREEIAAAKTLRPWNEVVAEAHDAPPVRRFLSALKKKRDSGDFALIAEVKKASPSKGLIRPDFNPSEIARAYELGGAACLSVLTDRPSFQGAPNYLIEARAATGLPVLRKDFMFETYQVAEARAWGADCILIILAAVGDDTARYLLDAAEEWRMDALVEVHDQIELDRALALDAEFIGINNRNLRTFETTLQTSVDLALGIPRNVHLVAESGIANYADVTKLHDTAGIGTFLVGESLMRQADVTKATQLLLWGDKGRP

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
152 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
153 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
156 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 2643221580 Devosia sp. Root635 Isolate Unclassified
159 2643221591 Devosia sp. Root685 Isolate Unclassified
160 2643221629 Devosia sp. Root105 Isolate Unclassified
161 2643221662 Devosia sp. Root413D1 Isolate Unclassified
162 2643221674 Devosia sp. Root436 Isolate Unclassified
163 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
164 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
165 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
166 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
167 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
168 2932401849 Devosia sp. 2618 Isolate Rhizosphere
169 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0.38
Isolates 4.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0.75
Rhizoplane 3.76
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10136232 3300014326 Bacteria 2102
2 rootH2_10022614 3300003320 Bacteria 18271
3 rootH1_10052655 3300003323 Bacteria 2604
4 Ga0070658_10082588 3300005327 Bacteria 2640
5 Ga0070658_10103713 3300005327 Bacteria 2352
6 Ga0070670_100441093 3300005331 Bacteria 1153
7 Ga0068869_100057534 3300005334 Bacteria 2839
8 Ga0070680_100068517 3300005336 Bacteria 2913
9 Ga0070682_100004622 3300005337 Bacteria 7649
10 Ga0070660_100002968 3300005339 Bacteria 11672
11 Ga0070660_100052066 3300005339 Bacteria 3155
12 Ga0070660_100053205 3300005339 Bacteria 3122
13 Ga0070661_100012312 3300005344 Bacteria 5982
14 Ga0070661_100031635 3300005344 Bacteria 3827
15 Ga0070661_100054787 3300005344 Bacteria 2921
16 Ga0070661_100068284 3300005344 Bacteria 2612
17 Ga0070692_10189095 3300005345 Bacteria 1198
18 Ga0070674_100004416 3300005356 Bacteria 8018
19 Ga0070673_100211124 3300005364 Bacteria 1676
20 Ga0070659_100055487 3300005366 Bacteria 3123
21 Ga0070659_100276970 3300005366 Bacteria 1395
22 Ga0070659_100382216 3300005366 Bacteria 1186
23 Ga0070659_100449780 3300005366 Bacteria 1092
24 Ga0070667_100114131 3300005367 Bacteria 2345
25 Ga0070667_100721766 3300005367 Bacteria 923
26 Ga0070705_100012284 3300005440 Bacteria 4350
27 Ga0070663_100010838 3300005455 Bacteria 5695
28 Ga0070678_100121018 3300005456 Bacteria 2064
29 Ga0070681_10246537 3300005458 Bacteria 1699
30 Ga0068853_100020831 3300005539 Bacteria 5455
31 Ga0068853_100021007 3300005539 Bacteria 5435
32 Ga0068853_100056516 3300005539 Bacteria 3384
33 Ga0068853_100113097 3300005539 Bacteria 2413
34 Ga0068853_100207522 3300005539 Bacteria 1785
35 Ga0070695_100008996 3300005545 Bacteria 5935
36 Ga0070696_100022622 3300005546 Bacteria 4272
37 Ga0070693_100034509 3300005547 Bacteria 2799
38 Ga0070693_100197264 3300005547 Bacteria 1305
39 Ga0070665_100074548 3300005548 Bacteria 3399
40 Ga0070704_100103592 3300005549 Bacteria 2150
41 Ga0068855_100127544 3300005563 Bacteria 2908
42 Ga0068855_100139516 3300005563 Bacteria 2765
43 Ga0068855_100213599 3300005563 Bacteria 2167
44 Ga0068855_100267926 3300005563 Bacteria 1900
45 Ga0070664_100073809 3300005564 Bacteria 2928
46 Ga0068854_100011271 3300005578 Bacteria 5813
47 Ga0068854_100021101 3300005578 Bacteria 4417
48 Ga0068854_100088365 3300005578 Bacteria 2301
49 Ga0068856_100082111 3300005614 Bacteria 3198
50 Ga0068856_100084801 3300005614 Bacteria 3147
51 Ga0068856_100413408 3300005614 Bacteria 1369
52 Ga0068852_100003997 3300005616 Bacteria 10368
53 Ga0068852_100015070 3300005616 Bacteria 5980
54 Ga0068852_100136214 3300005616 Bacteria 2267
55 Ga0068852_100239922 3300005616 Bacteria 1732
56 Ga0068851_10004462 3300005834 Bacteria 6314
57 Ga0068851_10053981 3300005834 Bacteria 2046
58 Ga0081455_10024174 3300005937 Bacteria 5635
59 Ga0075365_10037642 3300006038 Bacteria 3141
60 Ga0075362_10006745 3300006177 Bacteria 4291
61 Ga0075367_10063303 3300006178 Bacteria 2211
62 Ga0075370_10033198 3300006353 Bacteria 2888
63 Ga0075428_100241356 3300006844 Bacteria 1949
64 Ga0075428_100788265 3300006844 Bacteria 1010
65 Ga0075431_100208081 3300006847 Bacteria 1999
66 Ga0075434_100268009 3300006871 Bacteria 1727
67 Ga0075434_100601349 3300006871 Bacteria 1119
68 Ga0075429_100077534 3300006880 Bacteria 2895
69 Ga0079104_1000209 3300006946 Bacteria 81844
70 Ga0105240_10032467 3300009093 Bacteria 6759
71 Ga0114129_10000549 3300009147 Bacteria 45986
72 Ga0114129_10036520 3300009147 Bacteria 6937
73 Ga0114129_10128017 3300009147 Bacteria 3490
74 Ga0114129_10316924 3300009147 Bacteria 2074
75 Ga0105241_10235582 3300009174 Bacteria 1545
76 Ga0105241_10320095 3300009174 Bacteria 1337
77 Ga0105241_10417043 3300009174 Bacteria 1181
78 Ga0105237_10000301 3300009545 Bacteria 68372
79 Ga0105238_10137529 3300009551 Bacteria 2420
80 Ga0105239_10001991 3300010375 Bacteria 26554
81 Ga0105239_10006926 3300010375 Bacteria 13076
82 Ga0105239_10050725 3300010375 Bacteria 4550
83 Ga0105239_10074143 3300010375 Bacteria 3742
84 Ga0105246_10357383 3300011119 Bacteria 1199
85 Ga0157373_10013660 3300013100 Bacteria 5954
86 Ga0157373_10102268 3300013100 Bacteria 2016
87 Ga0157371_10228976 3300013102 Bacteria 1336
88 Ga0157370_10182314 3300013104 Bacteria 1951
89 Ga0157369_10084592 3300013105 Bacteria 3391
90 Ga0157374_10297908 3300013296 Bacteria 1595
91 Ga0157372_10451132 3300013307 Bacteria 1499
92 Ga0163163_10129639 3300014325 Bacteria 2562
93 Ga0163163_10178898 3300014325 Bacteria 2168
94 Ga0206356_11812984 3300020070 Bacteria 1881
95 Ga0207427_107497 3300025231 Bacteria 1276
96 Ga0209233_1000639 3300025261 Bacteria 17464
97 Ga0209758_1041629 3300025297 Bacteria 1715
98 Ga0207656_10023639 3300025321 Bacteria 2477
99 Ga0207656_10051077 3300025321 Bacteria 1787
100 Ga0207647_10105001 3300025904 Bacteria 1674
101 Ga0207643_10130695 3300025908 Bacteria 1494
102 Ga0207705_10030745 3300025909 Bacteria 3832
103 Ga0207705_10054246 3300025909 Bacteria 2889
104 Ga0207654_10095828 3300025911 Bacteria 1818
105 Ga0207654_10100749 3300025911 Bacteria 1779
106 Ga0207654_10156085 3300025911 Bacteria 1470
107 Ga0207707_10200390 3300025912 Bacteria 1740
108 Ga0207695_10053895 3300025913 Bacteria 4204
109 Ga0207671_10000227 3300025914 Bacteria 84794
110 Ga0207660_10122018 3300025917 Bacteria 1974
111 Ga0207657_10000991 3300025919 Bacteria 30156
112 Ga0207657_10006142 3300025919 Bacteria 12485
113 Ga0207657_10059028 3300025919 Bacteria 3299
114 Ga0207657_10092444 3300025919 Bacteria 2521
115 Ga0207649_10004184 3300025920 Bacteria 7858
116 Ga0207649_10019344 3300025920 Bacteria 3890
117 Ga0207652_10113829 3300025921 Bacteria 2401
118 Ga0207694_10241536 3300025924 Bacteria 1476
119 Ga0207690_10061409 3300025932 Bacteria 2555
120 Ga0207669_10123612 3300025937 Bacteria 1762
121 Ga0207691_10018213 3300025940 Bacteria 6652
122 Ga0207689_10044638 3300025942 Bacteria 3665
123 Ga0207667_10002734 3300025949 Bacteria 21808
124 Ga0207667_10018876 3300025949 Bacteria 7716
125 Ga0207667_10193027 3300025949 Bacteria 2089
126 Ga0207667_10205122 3300025949 Bacteria 2022
127 Ga0207668_10259260 3300025972 Bacteria 1416
128 Ga0207640_10017718 3300025981 Bacteria 4173
129 Ga0207640_10157085 3300025981 Bacteria 1678
130 Ga0207640_10208567 3300025981 Bacteria 1487
131 Ga0207639_10000957 3300026041 Bacteria 19589
132 Ga0207639_10015119 3300026041 Bacteria 5438
133 Ga0207639_10137375 3300026041 Bacteria 2032
134 Ga0207639_10534240 3300026041 Bacteria 1075
135 Ga0207678_10000100 3300026067 Bacteria 70537
136 Ga0207678_10423439 3300026067 Bacteria 1155
137 Ga0207702_10016053 3300026078 Bacteria 6201
138 Ga0207702_10056102 3300026078 Bacteria 3343
139 Ga0207702_10143068 3300026078 Bacteria 2167
140 Ga0207702_10363753 3300026078 Bacteria 1387
141 Ga0207648_10017394 3300026089 Bacteria 6541
142 Ga0207676_10151313 3300026095 Bacteria 1999
143 Ga0207674_10027209 3300026116 Bacteria 6055
144 Ga0207674_10038100 3300026116 Bacteria 4995
145 Ga0207683_10085077 3300026121 Bacteria 2811
146 Ga0207698_10024853 3300026142 Bacteria 4210
147 Ga0207698_10460936 3300026142 Bacteria 1229
148 Ga0209281_1000374 3300027111 Bacteria 71684
149 Ga0209974_10079997 3300027876 Bacteria 1123
150 Ga0268266_10001992 3300028379 Bacteria 22881
151 Ga0268266_10077196 3300028379 Bacteria 2896
152 Ga0268266_10224779 3300028379 Bacteria 1727
153 Ga0265334_10105275 3300028573 Bacteria 1018
154 Ga0265338_10016042 3300028800 Bacteria 8183
155 Ga0265332_10087543 3300031238 Bacteria 1319
156 Ga0265325_10007193 3300031241 Bacteria 6695
157 Ga0265325_10015955 3300031241 Bacteria 4208
158 Ga0265340_10101413 3300031247 Bacteria 1337
159 Ga0265340_10135632 3300031247 Bacteria 1127
160 Ga0265339_10005568 3300031249 Bacteria 8373
161 Ga0265339_10006469 3300031249 Bacteria 7681
162 Ga0265331_10102455 3300031250 Bacteria 1316
163 Ga0265313_10000121 3300031595 Bacteria 78280
164 Ga0265314_10077124 3300031711 Bacteria 2212
165 Ga0265314_10104281 3300031711 Bacteria 1816
166 Ga0316578_10092039 3300031728 Bacteria 1812
167 Ga0307414_10109037 3300032004 Bacteria 2102
168 Ga0373931_0034148 3300035691 Bacteria 2639
169 Ga0373931_0147184 3300035691 Unclassified 1370
170 Ga0395899_0036205 3300037312 Bacteria 3702
171 Ga0395899_0060604 3300037312 Bacteria 2788
172 Ga0395900_0031520 3300037418 Bacteria 5448
173 Ga0395900_0169476 3300037418 Bacteria 2223
174 Ga0395898_0173556 3300037466 Bacteria 2060
175 Ga0395898_0331542 3300037466 Bacteria 1451
176 Ga0395898_0427156 3300037466 Bacteria 1262
177 Ga0395905_0195034 3300037471 Bacteria 1899
178 Ga0395901_0105911 3300038443 Bacteria 2951
179 Ga0436363_0818450 3300039450 Bacteria 2850
180 Ga0439465_0092665 3300041413 Bacteria 1035
181 Ga0439432_084479 3300042006 Bacteria 959
182 Ga0451577_0732439 3300042876 Bacteria 895
183 Ga0495654_0004235 3300046530 Bacteria 8574
184 Ga0495686_0175270 3300047472 Bacteria 1245
185 Ga0496100_0050719 3300048903 Bacteria 2690
186 Ga0496102_0046856 3300048905 Bacteria 3927
187 Ga0496103_0002057 3300048906 Bacteria 12872
188 Ga0496104_0182285 3300048907 Bacteria 2010
189 Ga0496105_0035176 3300048908 Bacteria 4122
190 Ga0496106_0016953 3300048909 Bacteria 5391
191 Ga0496107_0015395 3300048910 Bacteria 5359
192 Ga0496108_0260347 3300048911 Bacteria 1510
193 Ga0496114_0023607 3300048917 Bacteria 5020
194 Ga0496115_0061807 3300048918 Bacteria 3021
195 Ga0496121_0121812 3300048924 Bacteria 1969
196 Ga0496121_0169900 3300048924 Bacteria 1585
197 Ga0496124_0045346 3300048927 Bacteria 3769
198 Ga0496125_0051478 3300048928 Bacteria 3396
199 Ga0496126_0067318 3300048929 Bacteria 3200
200 Ga0501032_0002955 3300049569 Bacteria 13201
201 Ga0501033_0051092 3300049570 Bacteria 3064
202 Ga0501034_0000077 3300049571 Bacteria 173873
203 Ga0501034_0003327 3300049571 Bacteria 18346
204 Ga0501034_0137530 3300049571 Bacteria 2423
205 Ga0501034_0167645 3300049571 Bacteria 2164
206 Ga0501034_0492749 3300049571 Bacteria 1140
207 Ga0501034_0854349 3300049571 Bacteria 800
208 Ga0501036_0013442 3300049572 Bacteria 6803
209 Ga0501036_0030097 3300049572 Bacteria 4586
210 Ga0501037_0001058 3300049573 Bacteria 20382
211 Ga0501037_0027557 3300049573 Bacteria 4198
212 Ga0501038_0015626 3300049574 Bacteria 6899
213 Ga0501038_0190227 3300049574 Bacteria 1652
214 Ga0501039_0000131 3300049575 Bacteria 52205
215 Ga0501039_0246651 3300049575 Bacteria 1404
216 Ga0501046_0001156 3300049580 Bacteria 25669
217 Ga0501046_0053418 3300049580 Bacteria 3182
218 Ga0501047_0000129 3300049581 Bacteria 91572
219 Ga0501047_0021343 3300049581 Bacteria 6216
220 Ga0501047_0034059 3300049581 Bacteria 4917
221 Ga0501047_0275688 3300049581 Bacteria 1527
222 Ga0501067_0000213 3300049583 Bacteria 32191
223 Ga0501067_0093565 3300049583 Bacteria 1669
224 Ga0501070_0007025 3300049586 Bacteria 9577
225 Ga0501070_0210855 3300049586 Bacteria 1594
226 Ga0501070_0377336 3300049586 Bacteria 1149
227 Ga0501070_0626009 3300049586 Bacteria 856
228 Ga0501073_0020183 3300049589 Bacteria 4806
229 Ga0501073_0115794 3300049589 Bacteria 1858
230 Ga0501073_0380409 3300049589 Bacteria 975
231 Ga0501074_0030372 3300049590 Bacteria 3916
232 Ga0501080_0000053 3300049742 Bacteria 74409
233 Ga0501080_0110497 3300049742 Bacteria 2548
234 Ga0501080_0371029 3300049742 Bacteria 1290
235 Ga0501280_000153 3300049776 Bacteria 17816
236 Ga0501035_0000010 3300049822 Bacteria 309349
237 Ga0501044_0000006 3300049823 Bacteria 291413
238 Ga0501044_0077312 3300049823 Bacteria 3376
239 Ga0501044_0228654 3300049823 Bacteria 1808
240 Ga0501045_0009226 3300049824 Bacteria 6897
241 nmdc:mga03683_82988_c1 3300050489 Bacteria 1387
242 nmdc:mga05p37_2727_c1 3300050507 Bacteria 20518
243 nmdc:mga06r32_372598_c1 3300050510 Bacteria 1411
244 nmdc:mga0n895_46771_c1 3300050512 Bacteria 4229
245 nmdc:mga0n895_54130_c1 3300050512 Bacteria 3945
246 nmdc:mga0n895_66663_c1 3300050512 Bacteria 3564
247 nmdc:mga0a205_5929_c1 3300050515 Bacteria 11013
248 Ga0500572_077346 3300053111 Bacteria 1038
249 Ga0500618_000917 3300053125 Bacteria 15292
250 Ga0500604_0000091 3300053151 Bacteria 29061
251 Ga0500616_0042844 3300053153 Bacteria 2422
252 Ga0500624_005320 3300053157 Bacteria 1710
253 Ga0500634_0000058 3300053161 Bacteria 47751
254 Ga0501082_0022263 3300060353 Bacteria 5461
255 2643910647 2643221580 Bacteria 3816678
256 2643963525 2643221591 Bacteria 4397626
257 2644167440 2643221629 Bacteria 5850260
258 2644347203 2643221662 Bacteria 5851492
259 2644410467 2643221674 Bacteria 3919126
260 2671694095 2671180139 Bacteria 4196045
261 2821127805 2821123053 Bacteria 7836056
262 2857534454 2857531043 Bacteria 6754041
263 2889792197 2889790730 Bacteria 5689708
264 2889917057 2889914905 Bacteria 5702301
265 2932403175 2932401849 Bacteria 4262978
266 3000018005 3000017691 Bacteria 3772574
267 Ga0157380_10136232
268 rootH2_10022614
269 rootH1_10052655
270 Ga0070658_10082588
271 Ga0070658_10103713
272 Ga0070670_100441093
273 Ga0068869_100057534
274 Ga0070680_100068517
275 Ga0070682_100004622
276 Ga0070660_100002968
277 Ga0070660_100052066
278 Ga0070660_100053205
279 Ga0070661_100012312
280 Ga0070661_100031635
281 Ga0070661_100054787
282 Ga0070661_100068284
283 Ga0070692_10189095
284 Ga0070674_100004416
285 Ga0070673_100211124
286 Ga0070659_100055487
287 Ga0070659_100276970
288 Ga0070659_100382216
289 Ga0070659_100449780
290 Ga0070667_100114131
291 Ga0070667_100721766
292 Ga0070705_100012284
293 Ga0070663_100010838
294 Ga0070678_100121018
295 Ga0070681_10246537
296 Ga0068853_100020831
297 Ga0068853_100021007
298 Ga0068853_100056516
299 Ga0068853_100113097
300 Ga0068853_100207522
301 Ga0070695_100008996
302 Ga0070696_100022622
303 Ga0070693_100034509
304 Ga0070693_100197264
305 Ga0070665_100074548
306 Ga0070704_100103592
307 Ga0068855_100127544
308 Ga0068855_100139516
309 Ga0068855_100213599
310 Ga0068855_100267926
311 Ga0070664_100073809
312 Ga0068854_100011271
313 Ga0068854_100021101
314 Ga0068854_100088365
315 Ga0068856_100082111
316 Ga0068856_100084801
317 Ga0068856_100413408
318 Ga0068852_100003997
319 Ga0068852_100015070
320 Ga0068852_100136214
321 Ga0068852_100239922
322 Ga0068851_10004462
323 Ga0068851_10053981
324 Ga0081455_10024174
325 Ga0075365_10037642
326 Ga0075362_10006745
327 Ga0075367_10063303
328 Ga0075370_10033198
329 Ga0075428_100241356
330 Ga0075428_100788265
331 Ga0075431_100208081
332 Ga0075434_100268009
333 Ga0075434_100601349
334 Ga0075429_100077534
335 Ga0079104_1000209
336 Ga0105240_10032467
337 Ga0114129_10000549
338 Ga0114129_10036520
339 Ga0114129_10128017
340 Ga0114129_10316924
341 Ga0105241_10235582
342 Ga0105241_10320095
343 Ga0105241_10417043
344 Ga0105237_10000301
345 Ga0105238_10137529
346 Ga0105239_10001991
347 Ga0105239_10006926
348 Ga0105239_10050725
349 Ga0105239_10074143
350 Ga0105246_10357383
351 Ga0157373_10013660
352 Ga0157373_10102268
353 Ga0157371_10228976
354 Ga0157370_10182314
355 Ga0157369_10084592
356 Ga0157374_10297908
357 Ga0157372_10451132
358 Ga0163163_10129639
359 Ga0163163_10178898
360 Ga0206356_11812984
361 Ga0207427_107497
362 Ga0209233_1000639
363 Ga0209758_1041629
364 Ga0207656_10023639
365 Ga0207656_10051077
366 Ga0207647_10105001
367 Ga0207643_10130695
368 Ga0207705_10030745
369 Ga0207705_10054246
370 Ga0207654_10095828
371 Ga0207654_10100749
372 Ga0207654_10156085
373 Ga0207707_10200390
374 Ga0207695_10053895
375 Ga0207671_10000227
376 Ga0207660_10122018
377 Ga0207657_10000991
378 Ga0207657_10006142
379 Ga0207657_10059028
380 Ga0207657_10092444
381 Ga0207649_10004184
382 Ga0207649_10019344
383 Ga0207652_10113829
384 Ga0207694_10241536
385 Ga0207690_10061409
386 Ga0207669_10123612
387 Ga0207691_10018213
388 Ga0207689_10044638
389 Ga0207667_10002734
390 Ga0207667_10018876
391 Ga0207667_10193027
392 Ga0207667_10205122
393 Ga0207668_10259260
394 Ga0207640_10017718
395 Ga0207640_10157085
396 Ga0207640_10208567
397 Ga0207639_10000957
398 Ga0207639_10015119
399 Ga0207639_10137375
400 Ga0207639_10534240
401 Ga0207678_10000100
402 Ga0207678_10423439
403 Ga0207702_10016053
404 Ga0207702_10056102
405 Ga0207702_10143068
406 Ga0207702_10363753
407 Ga0207648_10017394
408 Ga0207676_10151313
409 Ga0207674_10027209
410 Ga0207674_10038100
411 Ga0207683_10085077
412 Ga0207698_10024853
413 Ga0207698_10460936
414 Ga0209281_1000374
415 Ga0209974_10079997
416 Ga0268266_10001992
417 Ga0268266_10077196
418 Ga0268266_10224779
419 Ga0265334_10105275
420 Ga0265338_10016042
421 Ga0265332_10087543
422 Ga0265325_10007193
423 Ga0265325_10015955
424 Ga0265340_10101413
425 Ga0265340_10135632
426 Ga0265339_10005568
427 Ga0265339_10006469
428 Ga0265331_10102455
429 Ga0265313_10000121
430 Ga0265314_10077124
431 Ga0265314_10104281
432 Ga0316578_10092039
433 Ga0307414_10109037
434 Ga0373931_0034148
435 Ga0373931_0147184
436 Ga0395899_0036205
437 Ga0395899_0060604
438 Ga0395900_0031520
439 Ga0395900_0169476
440 Ga0395898_0173556
441 Ga0395898_0331542
442 Ga0395898_0427156
443 Ga0395905_0195034
444 Ga0395901_0105911
445 Ga0436363_0818450
446 Ga0439465_0092665
447 Ga0439432_084479
448 Ga0451577_0732439
449 Ga0495654_0004235
450 Ga0495686_0175270
451 Ga0496100_0050719
452 Ga0496102_0046856
453 Ga0496103_0002057
454 Ga0496104_0182285
455 Ga0496105_0035176
456 Ga0496106_0016953
457 Ga0496107_0015395
458 Ga0496108_0260347
459 Ga0496114_0023607
460 Ga0496115_0061807
461 Ga0496121_0121812
462 Ga0496121_0169900
463 Ga0496124_0045346
464 Ga0496125_0051478
465 Ga0496126_0067318
466 Ga0501032_0002955
467 Ga0501033_0051092
468 Ga0501034_0000077
469 Ga0501034_0003327
470 Ga0501034_0137530
471 Ga0501034_0167645
472 Ga0501034_0492749
473 Ga0501034_0854349
474 Ga0501036_0013442
475 Ga0501036_0030097
476 Ga0501037_0001058
477 Ga0501037_0027557
478 Ga0501038_0015626
479 Ga0501038_0190227
480 Ga0501039_0000131
481 Ga0501039_0246651
482 Ga0501046_0001156
483 Ga0501046_0053418
484 Ga0501047_0000129
485 Ga0501047_0021343
486 Ga0501047_0034059
487 Ga0501047_0275688
488 Ga0501067_0000213
489 Ga0501067_0093565
490 Ga0501070_0007025
491 Ga0501070_0210855
492 Ga0501070_0377336
493 Ga0501070_0626009
494 Ga0501073_0020183
495 Ga0501073_0115794
496 Ga0501073_0380409
497 Ga0501074_0030372
498 Ga0501080_0000053
499 Ga0501080_0110497
500 Ga0501080_0371029
501 Ga0501280_000153
502 Ga0501035_0000010
503 Ga0501044_0000006
504 Ga0501044_0077312
505 Ga0501044_0228654
506 Ga0501045_0009226
507 nmdc:mga03683_82988_c1
508 nmdc:mga05p37_2727_c1
509 nmdc:mga06r32_372598_c1
510 nmdc:mga0n895_46771_c1
511 nmdc:mga0n895_54130_c1
512 nmdc:mga0n895_66663_c1
513 nmdc:mga0a205_5929_c1
514 Ga0500572_077346
515 Ga0500618_000917
516 Ga0500604_0000091
517 Ga0500616_0042844
518 Ga0500624_005320
519 Ga0500634_0000058
520 Ga0501082_0022263
521 2643910647
522 2643963525
523 2644167440
524 2644347203
525 2644410467
526 2671694095
527 2821127805
528 2857534454
529 2889792197
530 2889917057
531 2932403175
532 3000018005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00218

IGPS

Indole-3-glycerol phosphate synthase

16

272

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9799 3 263
3t55-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) 0.9662 4 264
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9652 3 263
3t78-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate 0.9609 4 266
1lbf-assembly1.cif.gz_A crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9591 36 263
ID Description Score Start End Superfamily
af_Q0JCI6_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9653 35 261 3.20.20.70
3t40A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9588 4 266 3.20.20.70
af_P00909_2_259_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9565 4 264 3.20.20.70
af_B4FS35_106_381_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9563 4 263 3.20.20.70
2c3zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9497 37 263 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A436E409-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9939 68 264 GO:0000162
GO:0004425
GO:0004640
AF-A0A023XAN1-F1-model_v4 deleted 0.9928 3 262
AF-A0A3M5WGY6-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9928 28 264 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A529ZQ95-F1-model_v4 deleted 0.9921 67 264
AF-A0A528BEV0-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9916 45 263 GO:0000162
GO:0004425
GO:0004640
GO:0006568

Map