F374140

General Info

Members Datasets Scaffolds Average Seq Length
266 173 532 135

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10000907|Ga0207648_100009079
Length 150
Sequence MAPFTSDTGRVRAAMVDDPRGLVSHFDALIGTEWLDDDPEHARVRLPMRDDLRQPVGLLHGGVMSSLVESVCSRATALAVLDDGMMAMGQSIGVSFIRPITEGHAEVTARARHRGRTTWVWEAEVRDADERLCALAQMTIAVRPIPRSDS

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.53
Rhizosphere 88.35
Stem 0
Stem Tuber 0
Unclassified 5.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10000907 3300026089 Bacteria 33370
2 JGI24746J21847_1000327 3300001977 Bacteria 6834
3 Ga0070676_10663058 3300005328 Bacteria 758
4 Ga0070683_100011762 3300005329 Bacteria 7578
5 Ga0070683_100030495 3300005329 Bacteria 4897
6 Ga0070683_100432536 3300005329 Bacteria 1256
7 Ga0070689_100245741 3300005340 Bacteria 1475
8 Ga0070689_100459017 3300005340 Bacteria 1085
9 Ga0070692_10609862 3300005345 Bacteria 723
10 Ga0070674_100000005 3300005356 Bacteria 168443
11 Ga0070674_100000023 3300005356 Bacteria 84887
12 Ga0070674_100729147 3300005356 Bacteria 850
13 Ga0070688_100000137 3300005365 Bacteria 39585
14 Ga0070667_100001183 3300005367 Bacteria 23762
15 Ga0070667_100390223 3300005367 Bacteria 1266
16 Ga0070703_10031807 3300005406 Bacteria 1598
17 Ga0070713_100000010 3300005436 Bacteria 151790
18 Ga0070710_10270351 3300005437 Bacteria 1099
19 Ga0070711_100001172 3300005439 Bacteria 14098
20 Ga0070700_101038200 3300005441 Bacteria 676
21 Ga0070681_11561367 3300005458 Bacteria 585
22 Ga0068867_100000226 3300005459 Bacteria 36850
23 Ga0070685_10000118 3300005466 Bacteria 50597
24 Ga0070684_100021679 3300005535 Bacteria 5352
25 Ga0070684_100033094 3300005535 Bacteria 4411
26 Ga0070684_100116113 3300005535 Bacteria 2404
27 Ga0070684_100428648 3300005535 Bacteria 1221
28 Ga0068853_100004255 3300005539 Bacteria 11049
29 Ga0070695_101611664 3300005545 Bacteria 542
30 Ga0070665_100179800 3300005548 Bacteria 2116
31 Ga0070664_100085911 3300005564 Bacteria 2718
32 Ga0068854_100000116 3300005578 Bacteria 54986
33 Ga0068854_100010283 3300005578 Bacteria 6065
34 Ga0068856_100010293 3300005614 Bacteria 9090
35 Ga0068864_100000031 3300005618 Bacteria 215331
36 Ga0068866_10000008 3300005718 Bacteria 117658
37 Ga0068866_10000195 3300005718 Bacteria 28485
38 Ga0068863_100241618 3300005841 Bacteria 1743
39 Ga0068858_100000097 3300005842 Bacteria 91503
40 Ga0068858_100523762 3300005842 Bacteria 1146
41 Ga0068862_100004534 3300005844 Bacteria 11709
42 Ga0081455_10007565 3300005937 Bacteria 11420
43 Ga0081455_10422882 3300005937 Bacteria 918
44 Ga0081455_11055764 3300005937 Bacteria 502
45 Ga0070715_10050425 3300006163 Bacteria 1787
46 Ga0070716_100142664 3300006173 Bacteria 1530
47 Ga0070716_101056252 3300006173 Unclassified 645
48 Ga0070712_101225579 3300006175 Bacteria 653
49 Ga0068871_100304468 3300006358 Bacteria 1400
50 Ga0075434_101320555 3300006871 Bacteria 732
51 Ga0105245_10000130 3300009098 Bacteria 72166
52 Ga0105245_10001228 3300009098 Bacteria 23130
53 Ga0105242_10174590 3300009176 Bacteria 1891
54 Ga0105249_10000332 3300009553 Bacteria 47770
55 Ga0105249_10010112 3300009553 Bacteria 8284
56 Ga0105239_11481911 3300010375 Unclassified 784
57 Ga0157370_10006631 3300013104 Bacteria 12720
58 Ga0163162_10230482 3300013306 Bacteria 1982
59 Ga0157375_10000349 3300013308 Bacteria 41764
60 Ga0157375_10050376 3300013308 Bacteria 4085
61 Ga0163163_10056654 3300014325 Bacteria 3873
62 Ga0163163_10295478 3300014325 Bacteria 1672
63 Ga0163163_10887082 3300014325 Bacteria 955
64 Ga0157380_10000391 3300014326 Bacteria 26465
65 Ga0157379_10034870 3300014968 Bacteria 4487
66 Ga0157379_10129503 3300014968 Bacteria 2271
67 Ga0163161_10000053 3300017792 Bacteria 117408
68 Ga0207642_10000002 3300025899 Bacteria 658166
69 Ga0207642_10001565 3300025899 Bacteria 7040
70 Ga0207685_10043458 3300025905 Bacteria 1693
71 Ga0207707_11149562 3300025912 Bacteria 630
72 Ga0207663_10001408 3300025916 Bacteria 11150
73 Ga0207681_10056015 3300025923 Bacteria 2688
74 Ga0207687_10000032 3300025927 Bacteria 143196
75 Ga0207687_10000073 3300025927 Bacteria 73917
76 Ga0207687_10017110 3300025927 Bacteria 4767
77 Ga0207700_10000007 3300025928 Bacteria 345720
78 Ga0207664_10120265 3300025929 Bacteria 2197
79 Ga0207706_10000250 3300025933 Bacteria 58868
80 Ga0207686_10124980 3300025934 Bacteria 1757
81 Ga0207670_10068968 3300025936 Bacteria 2438
82 Ga0207670_10206279 3300025936 Bacteria 1496
83 Ga0207669_10000006 3300025937 Bacteria 176348
84 Ga0207669_10000026 3300025937 Bacteria 92199
85 Ga0207669_10081998 3300025937 Bacteria 2069
86 Ga0207665_10184379 3300025939 Bacteria 1513
87 Ga0207689_10526583 3300025942 Bacteria 992
88 Ga0207661_10029658 3300025944 Bacteria 4205
89 Ga0207661_10035357 3300025944 Bacteria 3892
90 Ga0207651_10011330 3300025960 Bacteria 4988
91 Ga0207712_10000058 3300025961 Bacteria 140948
92 Ga0207712_10001072 3300025961 Bacteria 19132
93 Ga0207668_10011823 3300025972 Bacteria 5320
94 Ga0207640_10000134 3300025981 Bacteria 54961
95 Ga0207640_10008876 3300025981 Bacteria 5600
96 Ga0207658_10014987 3300025986 Bacteria 5315
97 Ga0207658_10537081 3300025986 Bacteria 1045
98 Ga0207703_10000103 3300026035 Bacteria 99918
99 Ga0207703_10553455 3300026035 Bacteria 1085
100 Ga0207639_10008849 3300026041 Bacteria 6923
101 Ga0207708_10052686 3300026075 Bacteria 3100
102 Ga0207702_10003521 3300026078 Bacteria 14268
103 Ga0207702_10594049 3300026078 Bacteria 1086
104 Ga0207641_10620339 3300026088 Bacteria 1060
105 Ga0207641_10697078 3300026088 Bacteria 1000
106 Ga0207676_10000031 3300026095 Bacteria 215877
107 Ga0268266_10201809 3300028379 Bacteria 1820
108 Ga0268265_10004438 3300028380 Bacteria 9741
109 Ga0268264_10027583 3300028381 Bacteria 4642
110 Ga0373953_0061937 3300035117 Bacteria 1531
111 Ga0373933_0396319 3300035724 Bacteria 900
112 Ga0373937_0009637 3300036401 Bacteria 8411
113 Ga0395898_0814673 3300037466 Bacteria 874
114 Ga0451807_1289616 3300041486 Unclassified 502
115 Ga0451853_1718878 3300041512 Bacteria 642
116 Ga0451853_2576161 3300041512 Bacteria 2517
117 Ga0466963_0000008 3300044694 Bacteria 74916
118 Ga0495592_0000267 3300046454 Bacteria 44729
119 Ga0495629_0023097 3300046459 Bacteria 4432
120 Ga0495641_0212190 3300046461 Bacteria 868
121 Ga0495651_0106832 3300046462 Bacteria 2074
122 Ga0495651_0339537 3300046462 Bacteria 996
123 Ga0495651_0629290 3300046462 Unclassified 674
124 Ga0495653_0049692 3300046463 Bacteria 3229
125 Ga0495662_0000079 3300046476 Bacteria 34644
126 Ga0495662_0229409 3300046476 Bacteria 915
127 Ga0495664_0278322 3300046477 Bacteria 1011
128 Ga0495608_0000007 3300046511 Bacteria 313495
129 Ga0495608_0000641 3300046511 Bacteria 24067
130 Ga0495608_0056409 3300046511 Bacteria 2594
131 Ga0495608_0369664 3300046511 Bacteria 880
132 Ga0495608_0418155 3300046511 Bacteria 818
133 Ga0495620_0000211 3300046515 Bacteria 43874
134 Ga0495628_0001264 3300046516 Bacteria 23154
135 Ga0495628_0001838 3300046516 Bacteria 19271
136 Ga0495628_0260392 3300046516 Bacteria 1293
137 Ga0495628_0444582 3300046516 Bacteria 942
138 Ga0495628_0467406 3300046516 Bacteria 914
139 Ga0495628_0470081 3300046516 Bacteria 911
140 Ga0495630_0007122 3300046517 Bacteria 7970
141 Ga0495644_0048948 3300046523 Bacteria 1587
142 Ga0495652_0210631 3300046529 Unclassified 1468
143 Ga0495665_0630072 3300046531 Bacteria 535
144 Ga0495640_0014515 3300046533 Bacteria 5955
145 Ga0495640_0524944 3300046533 Bacteria 719
146 Ga0495640_0531520 3300046533 Bacteria 714
147 Ga0495586_0032328 3300046535 Bacteria 2805
148 Ga0495586_0197810 3300046535 Bacteria 1139
149 Ga0495586_0319384 3300046535 Bacteria 891
150 Ga0495587_0292732 3300046536 Unclassified 911
151 Ga0495598_0006576 3300046537 Bacteria 2631
152 Ga0495621_0002889 3300046539 Bacteria 4682
153 Ga0495667_0000020 3300046559 Bacteria 180876
154 Ga0495656_0000497 3300046615 Bacteria 12860
155 Ga0495668_0092138 3300046616 Bacteria 1660
156 Ga0495634_0000381 3300046642 Bacteria 43342
157 Ga0495634_0560846 3300046642 Bacteria 665
158 Ga0495635_0000086 3300046663 Bacteria 55020
159 Ga0495657_0000001 3300046675 Bacteria 445641
160 Ga0495657_0173100 3300046675 Bacteria 1328
161 Ga0495599_0047984 3300046678 Bacteria 2677
162 Ga0495646_0355347 3300046680 Unclassified 767
163 Ga0495647_0000330 3300046681 Bacteria 13357
164 Ga0495658_0000002 3300046683 Bacteria 309651
165 Ga0495658_0688197 3300046683 Bacteria 655
166 Ga0495669_0005005 3300046684 Bacteria 5510
167 Ga0495613_0000005 3300046689 Bacteria 222558
168 Ga0495613_1089454 3300046689 Unclassified 510
169 Ga0495624_0009103 3300046690 Bacteria 6887
170 Ga0495649_0002704 3300046694 Bacteria 12351
171 Ga0495600_0182393 3300046809 Bacteria 1352
172 Ga0495672_0037887 3300047320 Bacteria 2947
173 Ga0495676_0000131 3300047321 Bacteria 56689
174 Ga0495676_0793260 3300047321 Bacteria 610
175 Ga0495676_0912540 3300047321 Unclassified 562
176 Ga0495680_0000212 3300047322 Bacteria 63418
177 Ga0495680_0000241 3300047322 Bacteria 60168
178 Ga0495680_0002123 3300047322 Bacteria 20590
179 Ga0495680_0236737 3300047322 Bacteria 1298
180 Ga0495675_0000055 3300047444 Bacteria 77878
181 Ga0495679_013364 3300047446 Bacteria 3087
182 Ga0495685_091043 3300047447 Bacteria 1011
183 Ga0495673_0153678 3300047469 Bacteria 888
184 Ga0495593_0352819 3300047673 Bacteria 735
185 Ga0495602_0000571 3300048088 Bacteria 34252
186 Ga0495614_0015935 3300048089 Bacteria 3274
187 Ga0496100_0000013 3300048903 Bacteria 177476
188 Ga0496101_0000035 3300048904 Bacteria 177237
189 Ga0496104_0272735 3300048907 Bacteria 1604
190 Ga0496106_0000062 3300048909 Bacteria 85769
191 Ga0496106_0000139 3300048909 Bacteria 54238
192 Ga0496107_0000020 3300048910 Bacteria 148990
193 Ga0496107_0234587 3300048910 Bacteria 1365
194 Ga0496107_0593232 3300048910 Bacteria 819
195 Ga0496108_0005051 3300048911 Bacteria 10660
196 Ga0496108_0263568 3300048911 Bacteria 1500
197 Ga0496108_0366627 3300048911 Bacteria 1257
198 Ga0496109_0000218 3300048912 Bacteria 56316
199 Ga0496109_0727294 3300048912 Bacteria 930
200 Ga0496110_0000038 3300048913 Bacteria 64272
201 Ga0496110_0052184 3300048913 Bacteria 3594
202 Ga0496110_0344162 3300048913 Bacteria 1358
203 Ga0496111_0000939 3300048914 Bacteria 15955
204 Ga0496112_0000025 3300048915 Bacteria 146197
205 Ga0496112_0029061 3300048915 Bacteria 5344
206 Ga0496112_0136108 3300048915 Bacteria 2427
207 Ga0496112_0876496 3300048915 Bacteria 820
208 Ga0496113_0000027 3300048916 Bacteria 63463
209 Ga0496113_0035721 3300048916 Bacteria 3636
210 Ga0496113_0118649 3300048916 Bacteria 2066
211 Ga0496113_0903122 3300048916 Bacteria 699
212 Ga0496114_0094442 3300048917 Bacteria 2544
213 Ga0496115_0000162 3300048918 Bacteria 62522
214 Ga0496121_0242950 3300048924 Bacteria 1253
215 Ga0501031_0008813 3300049568 Bacteria 6559
216 Ga0501031_0498151 3300049568 Bacteria 786
217 Ga0501032_0011441 3300049569 Bacteria 6374
218 Ga0501033_0001738 3300049570 Bacteria 19042
219 Ga0501034_0016464 3300049571 Bacteria 7587
220 Ga0501036_0001408 3300049572 Bacteria 18483
221 Ga0501036_0132445 3300049572 Bacteria 2104
222 Ga0501037_0000901 3300049573 Bacteria 22167
223 Ga0501038_0002106 3300049574 Bacteria 18452
224 Ga0501039_0013427 3300049575 Bacteria 6264
225 Ga0501039_1016494 3300049575 Bacteria 644
226 Ga0501040_0172035 3300049576 Bacteria 1534
227 Ga0501040_0184801 3300049576 Unclassified 1478
228 Ga0501042_0022064 3300049578 Bacteria 4444
229 Ga0501042_0039308 3300049578 Bacteria 3361
230 Ga0501042_0635725 3300049578 Bacteria 776
231 Ga0501043_0011297 3300049579 Bacteria 6988
232 Ga0501046_0015188 3300049580 Bacteria 6474
233 Ga0501047_0002109 3300049581 Bacteria 19029
234 Ga0501048_0012235 3300049582 Bacteria 6386
235 Ga0501048_0162478 3300049582 Bacteria 1581
236 Ga0501069_0185055 3300049585 Unclassified 1204
237 Ga0501070_0000592 3300049586 Bacteria 33029
238 Ga0501070_0640265 3300049586 Bacteria 845
239 Ga0501072_0612293 3300049588 Unclassified 858
240 Ga0501072_1317190 3300049588 Unclassified 560
241 Ga0501073_0006491 3300049589 Bacteria 8703
242 Ga0501074_0129050 3300049590 Bacteria 1809
243 Ga0501075_0001791 3300049591 Bacteria 14133
244 Ga0501075_0462044 3300049591 Bacteria 968
245 Ga0501075_0643195 3300049591 Bacteria 809
246 Ga0501077_0888204 3300049593 Bacteria 573
247 Ga0501079_0013016 3300049741 Bacteria 6346
248 Ga0501079_0156753 3300049741 Bacteria 1775
249 Ga0501080_0540124 3300049742 Bacteria 1039
250 Ga0501083_0010981 3300049744 Bacteria 6365
251 Ga0501035_0000368 3300049822 Bacteria 51908
252 Ga0501044_0000684 3300049823 Bacteria 40967
253 Ga0501045_0591868 3300049824 Unclassified 822
254 nmdc:mga0rr50_648500_c1 3300050513 Bacteria 901
255 Ga0495601_0946015 3300053077 Unclassified 543
256 Ga0495612_0000230 3300053078 Bacteria 23681
257 Ga0495612_0001360 3300053078 Bacteria 10074
258 Ga0495595_0000002 3300053084 Bacteria 445641
259 Ga0495595_0000150 3300053084 Bacteria 27718
260 Ga0495619_0000010 3300053085 Bacteria 302390
261 Ga0495619_0000084 3300053085 Bacteria 70164
262 Ga0495619_0000494 3300053085 Bacteria 26437
263 Ga0495619_0002422 3300053085 Bacteria 12247
264 Ga0495619_0005688 3300053085 Bacteria 7904
265 Ga0501082_0023889 3300060353 Bacteria 5271
266 Ga0501082_0655712 3300060353 Bacteria 918
267 Ga0207648_10000907
268 JGI24746J21847_1000327
269 Ga0070676_10663058
270 Ga0070683_100011762
271 Ga0070683_100030495
272 Ga0070683_100432536
273 Ga0070689_100245741
274 Ga0070689_100459017
275 Ga0070692_10609862
276 Ga0070674_100000005
277 Ga0070674_100000023
278 Ga0070674_100729147
279 Ga0070688_100000137
280 Ga0070667_100001183
281 Ga0070667_100390223
282 Ga0070703_10031807
283 Ga0070713_100000010
284 Ga0070710_10270351
285 Ga0070711_100001172
286 Ga0070700_101038200
287 Ga0070681_11561367
288 Ga0068867_100000226
289 Ga0070685_10000118
290 Ga0070684_100021679
291 Ga0070684_100033094
292 Ga0070684_100116113
293 Ga0070684_100428648
294 Ga0068853_100004255
295 Ga0070695_101611664
296 Ga0070665_100179800
297 Ga0070664_100085911
298 Ga0068854_100000116
299 Ga0068854_100010283
300 Ga0068856_100010293
301 Ga0068864_100000031
302 Ga0068866_10000008
303 Ga0068866_10000195
304 Ga0068863_100241618
305 Ga0068858_100000097
306 Ga0068858_100523762
307 Ga0068862_100004534
308 Ga0081455_10007565
309 Ga0081455_10422882
310 Ga0081455_11055764
311 Ga0070715_10050425
312 Ga0070716_100142664
313 Ga0070716_101056252
314 Ga0070712_101225579
315 Ga0068871_100304468
316 Ga0075434_101320555
317 Ga0105245_10000130
318 Ga0105245_10001228
319 Ga0105242_10174590
320 Ga0105249_10000332
321 Ga0105249_10010112
322 Ga0105239_11481911
323 Ga0157370_10006631
324 Ga0163162_10230482
325 Ga0157375_10000349
326 Ga0157375_10050376
327 Ga0163163_10056654
328 Ga0163163_10295478
329 Ga0163163_10887082
330 Ga0157380_10000391
331 Ga0157379_10034870
332 Ga0157379_10129503
333 Ga0163161_10000053
334 Ga0207642_10000002
335 Ga0207642_10001565
336 Ga0207685_10043458
337 Ga0207707_11149562
338 Ga0207663_10001408
339 Ga0207681_10056015
340 Ga0207687_10000032
341 Ga0207687_10000073
342 Ga0207687_10017110
343 Ga0207700_10000007
344 Ga0207664_10120265
345 Ga0207706_10000250
346 Ga0207686_10124980
347 Ga0207670_10068968
348 Ga0207670_10206279
349 Ga0207669_10000006
350 Ga0207669_10000026
351 Ga0207669_10081998
352 Ga0207665_10184379
353 Ga0207689_10526583
354 Ga0207661_10029658
355 Ga0207661_10035357
356 Ga0207651_10011330
357 Ga0207712_10000058
358 Ga0207712_10001072
359 Ga0207668_10011823
360 Ga0207640_10000134
361 Ga0207640_10008876
362 Ga0207658_10014987
363 Ga0207658_10537081
364 Ga0207703_10000103
365 Ga0207703_10553455
366 Ga0207639_10008849
367 Ga0207708_10052686
368 Ga0207702_10003521
369 Ga0207702_10594049
370 Ga0207641_10620339
371 Ga0207641_10697078
372 Ga0207676_10000031
373 Ga0268266_10201809
374 Ga0268265_10004438
375 Ga0268264_10027583
376 Ga0373953_0061937
377 Ga0373933_0396319
378 Ga0373937_0009637
379 Ga0395898_0814673
380 Ga0451807_1289616
381 Ga0451853_1718878
382 Ga0451853_2576161
383 Ga0466963_0000008
384 Ga0495592_0000267
385 Ga0495629_0023097
386 Ga0495641_0212190
387 Ga0495651_0106832
388 Ga0495651_0339537
389 Ga0495651_0629290
390 Ga0495653_0049692
391 Ga0495662_0000079
392 Ga0495662_0229409
393 Ga0495664_0278322
394 Ga0495608_0000007
395 Ga0495608_0000641
396 Ga0495608_0056409
397 Ga0495608_0369664
398 Ga0495608_0418155
399 Ga0495620_0000211
400 Ga0495628_0001264
401 Ga0495628_0001838
402 Ga0495628_0260392
403 Ga0495628_0444582
404 Ga0495628_0467406
405 Ga0495628_0470081
406 Ga0495630_0007122
407 Ga0495644_0048948
408 Ga0495652_0210631
409 Ga0495665_0630072
410 Ga0495640_0014515
411 Ga0495640_0524944
412 Ga0495640_0531520
413 Ga0495586_0032328
414 Ga0495586_0197810
415 Ga0495586_0319384
416 Ga0495587_0292732
417 Ga0495598_0006576
418 Ga0495621_0002889
419 Ga0495667_0000020
420 Ga0495656_0000497
421 Ga0495668_0092138
422 Ga0495634_0000381
423 Ga0495634_0560846
424 Ga0495635_0000086
425 Ga0495657_0000001
426 Ga0495657_0173100
427 Ga0495599_0047984
428 Ga0495646_0355347
429 Ga0495647_0000330
430 Ga0495658_0000002
431 Ga0495658_0688197
432 Ga0495669_0005005
433 Ga0495613_0000005
434 Ga0495613_1089454
435 Ga0495624_0009103
436 Ga0495649_0002704
437 Ga0495600_0182393
438 Ga0495672_0037887
439 Ga0495676_0000131
440 Ga0495676_0793260
441 Ga0495676_0912540
442 Ga0495680_0000212
443 Ga0495680_0000241
444 Ga0495680_0002123
445 Ga0495680_0236737
446 Ga0495675_0000055
447 Ga0495679_013364
448 Ga0495685_091043
449 Ga0495673_0153678
450 Ga0495593_0352819
451 Ga0495602_0000571
452 Ga0495614_0015935
453 Ga0496100_0000013
454 Ga0496101_0000035
455 Ga0496104_0272735
456 Ga0496106_0000062
457 Ga0496106_0000139
458 Ga0496107_0000020
459 Ga0496107_0234587
460 Ga0496107_0593232
461 Ga0496108_0005051
462 Ga0496108_0263568
463 Ga0496108_0366627
464 Ga0496109_0000218
465 Ga0496109_0727294
466 Ga0496110_0000038
467 Ga0496110_0052184
468 Ga0496110_0344162
469 Ga0496111_0000939
470 Ga0496112_0000025
471 Ga0496112_0029061
472 Ga0496112_0136108
473 Ga0496112_0876496
474 Ga0496113_0000027
475 Ga0496113_0035721
476 Ga0496113_0118649
477 Ga0496113_0903122
478 Ga0496114_0094442
479 Ga0496115_0000162
480 Ga0496121_0242950
481 Ga0501031_0008813
482 Ga0501031_0498151
483 Ga0501032_0011441
484 Ga0501033_0001738
485 Ga0501034_0016464
486 Ga0501036_0001408
487 Ga0501036_0132445
488 Ga0501037_0000901
489 Ga0501038_0002106
490 Ga0501039_0013427
491 Ga0501039_1016494
492 Ga0501040_0172035
493 Ga0501040_0184801
494 Ga0501042_0022064
495 Ga0501042_0039308
496 Ga0501042_0635725
497 Ga0501043_0011297
498 Ga0501046_0015188
499 Ga0501047_0002109
500 Ga0501048_0012235
501 Ga0501048_0162478
502 Ga0501069_0185055
503 Ga0501070_0000592
504 Ga0501070_0640265
505 Ga0501072_0612293
506 Ga0501072_1317190
507 Ga0501073_0006491
508 Ga0501074_0129050
509 Ga0501075_0001791
510 Ga0501075_0462044
511 Ga0501075_0643195
512 Ga0501077_0888204
513 Ga0501079_0013016
514 Ga0501079_0156753
515 Ga0501080_0540124
516 Ga0501083_0010981
517 Ga0501035_0000368
518 Ga0501044_0000684
519 Ga0501045_0591868
520 nmdc:mga0rr50_648500_c1
521 Ga0495601_0946015
522 Ga0495612_0000230
523 Ga0495612_0001360
524 Ga0495595_0000002
525 Ga0495595_0000150
526 Ga0495619_0000010
527 Ga0495619_0000084
528 Ga0495619_0000494
529 Ga0495619_0002422
530 Ga0495619_0005688
531 Ga0501082_0023889
532 Ga0501082_0655712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

56

134

0.98

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

50

141

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9372 11 131
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9361 10 130
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9299 11 131
3gek-assembly2.cif.gz_A crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.9293 27 130
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9287 10 130
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9457 10 130 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9382 10 130 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.927 12 133 3.10.129.10
3r32A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9096 1 133 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9059 12 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6J4TQ88-F1-model_v4 Thioesterase domain-containing protein 0.9672 12 129 GO:0005829
GO:0061522
AF-A0A7K0S2A5-F1-model_v4 Hotdog fold thioesterase 0.963 12 133 GO:0005829
GO:0061522
AF-A0A538KF51-F1-model_v4 PaaI family thioesterase 0.9615 10 133 GO:0005829
GO:0061522
AF-A0A538F6D6-F1-model_v4 PaaI family thioesterase 0.9604 13 133 GO:0005829
GO:0061522
AF-A0A660L5K7-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA hydrolase 0.9603 13 130 GO:0005829
GO:0061522

Map