F374147

General Info

Members Datasets Scaffolds Average Seq Length
266 175 532 521

Family's Representative Sequence

Representative Sequence 3300027671|Ga0209588_1000041|Ga0209588_100004134
Length 595
Sequence MRRPVHTTESQSPLKGQGLGAYVSTQSLQQESALDFSGLQLPPPAEVEERGFGALCEQPGNEAMKYRIHNIGLWLDEPQVLLTKRAAEKLRIGAEHLKSVRVVRSVLDARKKGNPRYIYTVEAELASENGKLPSLPPDVSEAPAAAXXXKQVRPPEKRPVIVGTGPSGLFCALGLLESGVTSILVERGKEVVSRRKDVAQLMRDGTLNPESNMNFGEGGAGAYTDGKLSTRINHPLVRKVIETFARFGAPDHILVEGKPHIGSDLLPGAVERLREELTRQGCEVHFGRRVENLLYANGRVAGLVLSDGSKLETDRVVLAPGNSARELFERFAAEGKVSMDPKPFAIGFRAEHPQALINRIQYGAAGEDPKLPPADYKLVNNLEVGGELRGIYTFCMCPGGVVVPTPTEPGLQCTNGMSNSRRNSKFANAGIVVSVSVDDFARAGFQGPLAGLNFQRHWEAQAYQLGGGRYHAPAQSIPDYLAGRTKRPLTDTSYRPGLTPADLNRLFPAELTASLKSALRDFDRRMRGFVSDEGILIGIESRTSSPVRVSRGDDFQSVSVAGLYPSGEGCGYAGGIVSSAIDGLRIAAQIASELA

Samples

Sample ID Description Type Environment
1 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
146 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
147 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
170 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
171 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
172 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
173 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
174 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
175 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.5
Rhizoplane 1.5
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209588_1000041 3300027671 Bacteria 59777
2 MBSR1b_contig_10311604 2162886012 Bacteria 3454
3 Ga0070676_10003889 3300005328 Bacteria 7840
4 Ga0070683_100001378 3300005329 Bacteria 18632
5 Ga0070690_100000812 3300005330 Bacteria 15800
6 Ga0070670_100009671 3300005331 Bacteria 8230
7 Ga0070677_10000526 3300005333 Bacteria 13130
8 Ga0068869_100003132 3300005334 Bacteria 10093
9 Ga0070666_10001337 3300005335 Bacteria 14951
10 Ga0068868_100001472 3300005338 Bacteria 16253
11 Ga0070660_100001829 3300005339 Bacteria 14621
12 Ga0070689_100003426 3300005340 Bacteria 10550
13 Ga0070687_100000129 3300005343 Bacteria 26037
14 Ga0070661_100001499 3300005344 Bacteria 16227
15 Ga0070668_100001092 3300005347 Bacteria 19121
16 Ga0070669_100001544 3300005353 Bacteria 16649
17 Ga0070675_100006134 3300005354 Bacteria 9214
18 Ga0070671_100001853 3300005355 Bacteria 16122
19 Ga0070674_100005218 3300005356 Bacteria 7473
20 Ga0070673_100002410 3300005364 Bacteria 11377
21 Ga0070688_100000657 3300005365 Bacteria 17170
22 Ga0070659_100002328 3300005366 Bacteria 13511
23 Ga0070667_100003253 3300005367 Bacteria 13881
24 Ga0070701_10007306 3300005438 Bacteria 4708
25 Ga0070705_100001751 3300005440 Bacteria 11277
26 Ga0070678_100001372 3300005456 Bacteria 12958
27 Ga0070662_100002469 3300005457 Bacteria 11388
28 Ga0068867_100003525 3300005459 Bacteria 11001
29 Ga0070685_10001416 3300005466 Bacteria 12577
30 Ga0070684_100016670 3300005535 Bacteria 6012
31 Ga0070684_100097062 3300005535 Bacteria 2628
32 Ga0068853_100003943 3300005539 Bacteria 11396
33 Ga0070672_100000867 3300005543 Bacteria 18097
34 Ga0070686_100004310 3300005544 Bacteria 7831
35 Ga0070665_100013457 3300005548 Bacteria 8230
36 Ga0068855_100003374 3300005563 Bacteria 19561
37 Ga0070664_100001934 3300005564 Bacteria 16649
38 Ga0068857_100003654 3300005577 Bacteria 12893
39 Ga0068857_100004680 3300005577 Bacteria 11592
40 Ga0068854_100001002 3300005578 Bacteria 17023
41 Ga0068856_100007018 3300005614 Bacteria 11001
42 Ga0070702_100008760 3300005615 Bacteria 4918
43 Ga0068852_100001511 3300005616 Bacteria 15733
44 Ga0068859_100007619 3300005617 Bacteria 11001
45 Ga0068864_100003320 3300005618 Bacteria 13297
46 Ga0068866_10000167 3300005718 Bacteria 30374
47 Ga0068861_100001113 3300005719 Bacteria 16659
48 Ga0068851_10000382 3300005834 Bacteria 20035
49 Ga0068870_10001033 3300005840 Bacteria 11001
50 Ga0068863_100002882 3300005841 Bacteria 17031
51 Ga0068858_100005307 3300005842 Bacteria 12636
52 Ga0068860_100011324 3300005843 Bacteria 8789
53 Ga0068862_100005140 3300005844 Bacteria 11001
54 Ga0081540_1007200 3300005983 Bacteria 7980
55 Ga0097621_100007121 3300006237 Bacteria 7973
56 Ga0068871_100001759 3300006358 Bacteria 14597
57 Ga0075428_100102805 3300006844 Bacteria 3116
58 Ga0068865_100002359 3300006881 Bacteria 11142
59 Ga0097620_100007618 3300006931 Bacteria 11001
60 Ga0079104_1000050 3300006946 Bacteria 173000
61 Ga0079104_1000773 3300006946 Bacteria 27390
62 Ga0099794_10000203 3300007265 Bacteria 21534
63 Ga0105245_10003941 3300009098 Bacteria 13204
64 Ga0105247_10000680 3300009101 Bacteria 26882
65 Ga0105243_10007357 3300009148 Bacteria 8465
66 Ga0105241_10000690 3300009174 Bacteria 25453
67 Ga0105248_10003364 3300009177 Bacteria 17776
68 Ga0105237_10003821 3300009545 Bacteria 17702
69 Ga0105238_10001511 3300009551 Bacteria 23281
70 Ga0105249_10001767 3300009553 Bacteria 18831
71 Ga0105239_10003469 3300010375 Bacteria 19288
72 Ga0157371_10000858 3300013102 Bacteria 34677
73 Ga0157374_10002021 3300013296 Bacteria 17019
74 Ga0157378_10001435 3300013297 Bacteria 21473
75 Ga0163162_10007853 3300013306 Bacteria 10396
76 Ga0157375_10002065 3300013308 Bacteria 17352
77 Ga0163163_10007702 3300014325 Bacteria 9516
78 Ga0157377_10001078 3300014745 Bacteria 11557
79 Ga0157379_10005975 3300014968 Bacteria 10493
80 Ga0157376_10027924 3300014969 Bacteria 4480
81 Ga0163161_10034799 3300017792 Bacteria 3604
82 Ga0207697_10001372 3300025315 Bacteria 13331
83 Ga0207656_10000298 3300025321 Bacteria 17134
84 Ga0207682_10000214 3300025893 Bacteria 26263
85 Ga0207642_10000260 3300025899 Bacteria 15834
86 Ga0207710_10002316 3300025900 Bacteria 8893
87 Ga0207688_10000836 3300025901 Bacteria 15457
88 Ga0207680_10001615 3300025903 Bacteria 10655
89 Ga0207647_10001682 3300025904 Bacteria 17032
90 Ga0207645_10000251 3300025907 Bacteria 44805
91 Ga0207643_10000176 3300025908 Bacteria 43543
92 Ga0207654_10007271 3300025911 Bacteria 5579
93 Ga0207695_10011746 3300025913 Bacteria 10577
94 Ga0207671_10002285 3300025914 Bacteria 20737
95 Ga0207662_10000146 3300025918 Bacteria 34142
96 Ga0207657_10003084 3300025919 Bacteria 17826
97 Ga0207649_10000907 3300025920 Bacteria 18679
98 Ga0207649_10018041 3300025920 Bacteria 4005
99 Ga0207681_10001125 3300025923 Bacteria 17320
100 Ga0207694_10001152 3300025924 Bacteria 22948
101 Ga0207650_10001243 3300025925 Bacteria 18523
102 Ga0207659_10000831 3300025926 Bacteria 18326
103 Ga0207687_10010230 3300025927 Bacteria 6128
104 Ga0207644_10001068 3300025931 Bacteria 17518
105 Ga0207690_10002228 3300025932 Bacteria 11822
106 Ga0207706_10000745 3300025933 Bacteria 33883
107 Ga0207709_10031786 3300025935 Bacteria 3086
108 Ga0207670_10000695 3300025936 Bacteria 17783
109 Ga0207669_10000390 3300025937 Bacteria 19429
110 Ga0207704_10000842 3300025938 Bacteria 13606
111 Ga0207691_10000371 3300025940 Bacteria 45123
112 Ga0207711_10000513 3300025941 Bacteria 39782
113 Ga0207689_10002310 3300025942 Bacteria 17860
114 Ga0207661_10002789 3300025944 Bacteria 12046
115 Ga0207679_10000102 3300025945 Bacteria 70199
116 Ga0207679_10000425 3300025945 Bacteria 30008
117 Ga0207667_10010676 3300025949 Bacteria 10720
118 Ga0207651_10000093 3300025960 Bacteria 39865
119 Ga0207712_10001464 3300025961 Bacteria 16101
120 Ga0207668_10000798 3300025972 Bacteria 19311
121 Ga0207640_10000598 3300025981 Bacteria 21453
122 Ga0207658_10001648 3300025986 Bacteria 17064
123 Ga0207677_10000456 3300026023 Bacteria 27537
124 Ga0207703_10000384 3300026035 Bacteria 47335
125 Ga0207639_10004761 3300026041 Bacteria 9144
126 Ga0207678_10002390 3300026067 Bacteria 17041
127 Ga0207708_10004338 3300026075 Bacteria 10446
128 Ga0207702_10003152 3300026078 Bacteria 15271
129 Ga0207641_10001449 3300026088 Bacteria 23273
130 Ga0207648_10000874 3300026089 Bacteria 33928
131 Ga0207676_10001221 3300026095 Bacteria 19155
132 Ga0207674_10000671 3300026116 Bacteria 44489
133 Ga0207674_10010648 3300026116 Bacteria 10399
134 Ga0207675_100002014 3300026118 Bacteria 20259
135 Ga0207683_10000375 3300026121 Bacteria 41120
136 Ga0207698_10000755 3300026142 Bacteria 18774
137 Ga0209281_1000059 3300027111 Bacteria 295913
138 Ga0209281_1000420 3300027111 Bacteria 63574
139 Ga0268266_10002601 3300028379 Bacteria 19127
140 Ga0268265_10001155 3300028380 Bacteria 23203
141 Ga0268264_10000938 3300028381 Bacteria 30247
142 Ga0265319_1014689 3300028563 Bacteria 3063
143 Ga0265327_10038490 3300031251 Bacteria 2609
144 Ga0316575_10005408 3300031665 Bacteria 4554
145 Ga0316575_10005691 3300031665 Bacteria 4451
146 Ga0316575_10032302 3300031665 Bacteria 2050
147 Ga0316576_10035840 3300031727 Bacteria 3545
148 Ga0316576_10087087 3300031727 Bacteria 2324
149 Ga0316577_10034027 3300031733 Bacteria 2848
150 Ga0316583_10013631 3300032133 Bacteria 2934
151 Ga0373951_0002118 3300035091 Bacteria 5072
152 Ga0316574_0041085 3300035398 Bacteria 2850
153 Ga0316584_0058994 3300036712 Bacteria 2874
154 Ga0373925_0132041 3300037068 Bacteria 1948
155 Ga0400490_47831 3300038726 Bacteria 50582
156 Ga0400490_48843 3300038726 Bacteria 9081
157 Ga0400491_26212 3300038727 Bacteria 3453
158 Ga0400483_130490 3300039062 Bacteria 16500
159 Ga0436360_0624793 3300039438 Bacteria 6626
160 Ga0436361_0798867 3300039447 Bacteria 5698
161 Ga0436363_0368135 3300039450 Bacteria 1841
162 Ga0439448_0005777 3300042005 Bacteria 3534
163 Ga0451577_0000009 3300042876 Bacteria 646744
164 Ga0451577_0000253 3300042876 Bacteria 105800
165 Ga0451577_0000258 3300042876 Bacteria 104377
166 Ga0451577_0001235 3300042876 Bacteria 35395
167 Ga0451577_0001341 3300042876 Bacteria 33397
168 Ga0451577_0003653 3300042876 Bacteria 16875
169 Ga0451577_0009756 3300042876 Bacteria 9204
170 Ga0451577_0010357 3300042876 Bacteria 8920
171 Ga0451577_0012314 3300042876 Bacteria 8033
172 Ga0451577_0016947 3300042876 Bacteria 6739
173 Ga0451577_0024326 3300042876 Bacteria 5511
174 Ga0451577_0032797 3300042876 Bacteria 4681
175 Ga0451577_0045865 3300042876 Bacteria 3911
176 Ga0451577_0053280 3300042876 Bacteria 3611
177 Ga0451577_0056183 3300042876 Bacteria 3511
178 Ga0451577_0088186 3300042876 Bacteria 2768
179 Ga0451577_0093608 3300042876 Bacteria 2684
180 Ga0453683_0000020 3300044673 Bacteria 286813
181 Ga0453683_0000024 3300044673 Bacteria 263554
182 Ga0453683_0000054 3300044673 Bacteria 194357
183 Ga0453683_0000071 3300044673 Bacteria 158207
184 Ga0453683_0000094 3300044673 Bacteria 134667
185 Ga0453683_0000569 3300044673 Bacteria 40862
186 Ga0453683_0001660 3300044673 Bacteria 18658
187 Ga0453683_0005657 3300044673 Bacteria 8681
188 Ga0453683_0006079 3300044673 Bacteria 8317
189 Ga0453683_0033494 3300044673 Bacteria 3240
190 Ga0453683_0038387 3300044673 Bacteria 3010
191 Ga0453683_0058418 3300044673 Bacteria 2413
192 Ga0453684_0000241 3300044712 Bacteria 235032
193 Ga0453684_0000383 3300044712 Bacteria 181393
194 Ga0453684_0000486 3300044712 Bacteria 156745
195 Ga0453684_0000609 3300044712 Bacteria 131572
196 Ga0453684_0000817 3300044712 Bacteria 105670
197 Ga0453684_0000991 3300044712 Bacteria 92722
198 Ga0453684_0001223 3300044712 Bacteria 78796
199 Ga0453684_0002351 3300044712 Bacteria 46257
200 Ga0453684_0003557 3300044712 Bacteria 34857
201 Ga0453684_0003791 3300044712 Bacteria 33364
202 Ga0453684_0004124 3300044712 Bacteria 31488
203 Ga0453684_0006221 3300044712 Bacteria 22885
204 Ga0453684_0006795 3300044712 Bacteria 21521
205 Ga0453684_0006816 3300044712 Bacteria 21484
206 Ga0453684_0007659 3300044712 Bacteria 19759
207 Ga0453684_0007925 3300044712 Bacteria 19267
208 Ga0453684_0008344 3300044712 Bacteria 18622
209 Ga0453684_0016011 3300044712 Bacteria 11779
210 Ga0453684_0022830 3300044712 Bacteria 9262
211 Ga0453684_0024795 3300044712 Bacteria 8742
212 Ga0453684_0026962 3300044712 Bacteria 8272
213 Ga0453684_0027168 3300044712 Bacteria 8222
214 Ga0453684_0027345 3300044712 Bacteria 8185
215 Ga0453684_0030018 3300044712 Bacteria 7695
216 Ga0453684_0033659 3300044712 Bacteria 7137
217 Ga0453684_0038129 3300044712 Bacteria 6578
218 Ga0453684_0039228 3300044712 Bacteria 6458
219 Ga0453684_0042159 3300044712 Bacteria 6156
220 Ga0453684_0066312 3300044712 Bacteria 4598
221 Ga0453684_0073130 3300044712 Bacteria 4324
222 Ga0453684_0088702 3300044712 Bacteria 3828
223 Ga0453684_0144878 3300044712 Bacteria 2831
224 Ga0453684_0150749 3300044712 Bacteria 2763
225 Ga0453684_0156376 3300044712 Bacteria 2702
226 Ga0453684_0160931 3300044712 Bacteria 2655
227 Ga0453684_0246645 3300044712 Bacteria 2053
228 Ga0451576_0000518 3300045051 Bacteria 84403
229 Ga0451576_0000847 3300045051 Bacteria 59370
230 Ga0451576_0000995 3300045051 Bacteria 52437
231 Ga0451576_0001008 3300045051 Bacteria 52050
232 Ga0451576_0002068 3300045051 Bacteria 31466
233 Ga0451576_0004180 3300045051 Bacteria 18992
234 Ga0451576_0013210 3300045051 Bacteria 9240
235 Ga0451576_0015568 3300045051 Bacteria 8419
236 Ga0451576_0030213 3300045051 Bacteria 5794
237 Ga0451576_0035527 3300045051 Bacteria 5286
238 Ga0451576_0037274 3300045051 Bacteria 5151
239 Ga0451576_0043939 3300045051 Bacteria 4712
240 Ga0451576_0053822 3300045051 Bacteria 4214
241 Ga0451576_0064104 3300045051 Bacteria 3828
242 Ga0451576_0103570 3300045051 Bacteria 2960
243 Ga0451576_0141885 3300045051 Bacteria 2505
244 Ga0451576_0152592 3300045051 Bacteria 2409
245 Ga0451576_0195535 3300045051 Bacteria 2112
246 Ga0495620_0023662 3300046515 Bacteria 2933
247 Ga0495654_0013703 3300046530 Bacteria 4333
248 Ga0495672_0002387 3300047320 Bacteria 17349
249 Ga0496102_0005255 3300048905 Bacteria 10995
250 Ga0496106_0005250 3300048909 Bacteria 9599
251 Ga0496107_0105950 3300048910 Bacteria 2064
252 Ga0496112_0001235 3300048915 Bacteria 19294
253 Ga0496122_0015916 3300048925 Bacteria 7159
254 Ga0496125_0002764 3300048928 Bacteria 22203
255 Ga0496126_0000190 3300048929 Bacteria 137687
256 Ga0496126_0150042 3300048929 Bacteria 1999
257 Ga0501043_0161134 3300049579 Bacteria 1753
258 Ga0501081_0121407 3300049743 Bacteria 1862
259 Ga0501035_0000259 3300049822 Bacteria 62970
260 Ga0530510_0048580 3300061734 Bacteria 3067
261 2688067398 2687453257 Bacteria 6784659
262 2889422178 2889415604 Bacteria 8048700
263 2920115078 2920107658 Bacteria 10042636
264 2929298208 2929297113 Bacteria 3141306
265 8007374536 8007371054 Bacteria 4849201
266 8007379590 8007375930 Bacteria 4080554
267 Ga0209588_1000041
268 MBSR1b_contig_10311604
269 Ga0070676_10003889
270 Ga0070683_100001378
271 Ga0070690_100000812
272 Ga0070670_100009671
273 Ga0070677_10000526
274 Ga0068869_100003132
275 Ga0070666_10001337
276 Ga0068868_100001472
277 Ga0070660_100001829
278 Ga0070689_100003426
279 Ga0070687_100000129
280 Ga0070661_100001499
281 Ga0070668_100001092
282 Ga0070669_100001544
283 Ga0070675_100006134
284 Ga0070671_100001853
285 Ga0070674_100005218
286 Ga0070673_100002410
287 Ga0070688_100000657
288 Ga0070659_100002328
289 Ga0070667_100003253
290 Ga0070701_10007306
291 Ga0070705_100001751
292 Ga0070678_100001372
293 Ga0070662_100002469
294 Ga0068867_100003525
295 Ga0070685_10001416
296 Ga0070684_100016670
297 Ga0070684_100097062
298 Ga0068853_100003943
299 Ga0070672_100000867
300 Ga0070686_100004310
301 Ga0070665_100013457
302 Ga0068855_100003374
303 Ga0070664_100001934
304 Ga0068857_100003654
305 Ga0068857_100004680
306 Ga0068854_100001002
307 Ga0068856_100007018
308 Ga0070702_100008760
309 Ga0068852_100001511
310 Ga0068859_100007619
311 Ga0068864_100003320
312 Ga0068866_10000167
313 Ga0068861_100001113
314 Ga0068851_10000382
315 Ga0068870_10001033
316 Ga0068863_100002882
317 Ga0068858_100005307
318 Ga0068860_100011324
319 Ga0068862_100005140
320 Ga0081540_1007200
321 Ga0097621_100007121
322 Ga0068871_100001759
323 Ga0075428_100102805
324 Ga0068865_100002359
325 Ga0097620_100007618
326 Ga0079104_1000050
327 Ga0079104_1000773
328 Ga0099794_10000203
329 Ga0105245_10003941
330 Ga0105247_10000680
331 Ga0105243_10007357
332 Ga0105241_10000690
333 Ga0105248_10003364
334 Ga0105237_10003821
335 Ga0105238_10001511
336 Ga0105249_10001767
337 Ga0105239_10003469
338 Ga0157371_10000858
339 Ga0157374_10002021
340 Ga0157378_10001435
341 Ga0163162_10007853
342 Ga0157375_10002065
343 Ga0163163_10007702
344 Ga0157377_10001078
345 Ga0157379_10005975
346 Ga0157376_10027924
347 Ga0163161_10034799
348 Ga0207697_10001372
349 Ga0207656_10000298
350 Ga0207682_10000214
351 Ga0207642_10000260
352 Ga0207710_10002316
353 Ga0207688_10000836
354 Ga0207680_10001615
355 Ga0207647_10001682
356 Ga0207645_10000251
357 Ga0207643_10000176
358 Ga0207654_10007271
359 Ga0207695_10011746
360 Ga0207671_10002285
361 Ga0207662_10000146
362 Ga0207657_10003084
363 Ga0207649_10000907
364 Ga0207649_10018041
365 Ga0207681_10001125
366 Ga0207694_10001152
367 Ga0207650_10001243
368 Ga0207659_10000831
369 Ga0207687_10010230
370 Ga0207644_10001068
371 Ga0207690_10002228
372 Ga0207706_10000745
373 Ga0207709_10031786
374 Ga0207670_10000695
375 Ga0207669_10000390
376 Ga0207704_10000842
377 Ga0207691_10000371
378 Ga0207711_10000513
379 Ga0207689_10002310
380 Ga0207661_10002789
381 Ga0207679_10000102
382 Ga0207679_10000425
383 Ga0207667_10010676
384 Ga0207651_10000093
385 Ga0207712_10001464
386 Ga0207668_10000798
387 Ga0207640_10000598
388 Ga0207658_10001648
389 Ga0207677_10000456
390 Ga0207703_10000384
391 Ga0207639_10004761
392 Ga0207678_10002390
393 Ga0207708_10004338
394 Ga0207702_10003152
395 Ga0207641_10001449
396 Ga0207648_10000874
397 Ga0207676_10001221
398 Ga0207674_10000671
399 Ga0207674_10010648
400 Ga0207675_100002014
401 Ga0207683_10000375
402 Ga0207698_10000755
403 Ga0209281_1000059
404 Ga0209281_1000420
405 Ga0268266_10002601
406 Ga0268265_10001155
407 Ga0268264_10000938
408 Ga0265319_1014689
409 Ga0265327_10038490
410 Ga0316575_10005408
411 Ga0316575_10005691
412 Ga0316575_10032302
413 Ga0316576_10035840
414 Ga0316576_10087087
415 Ga0316577_10034027
416 Ga0316583_10013631
417 Ga0373951_0002118
418 Ga0316574_0041085
419 Ga0316584_0058994
420 Ga0373925_0132041
421 Ga0400490_47831
422 Ga0400490_48843
423 Ga0400491_26212
424 Ga0400483_130490
425 Ga0436360_0624793
426 Ga0436361_0798867
427 Ga0436363_0368135
428 Ga0439448_0005777
429 Ga0451577_0000009
430 Ga0451577_0000253
431 Ga0451577_0000258
432 Ga0451577_0001235
433 Ga0451577_0001341
434 Ga0451577_0003653
435 Ga0451577_0009756
436 Ga0451577_0010357
437 Ga0451577_0012314
438 Ga0451577_0016947
439 Ga0451577_0024326
440 Ga0451577_0032797
441 Ga0451577_0045865
442 Ga0451577_0053280
443 Ga0451577_0056183
444 Ga0451577_0088186
445 Ga0451577_0093608
446 Ga0453683_0000020
447 Ga0453683_0000024
448 Ga0453683_0000054
449 Ga0453683_0000071
450 Ga0453683_0000094
451 Ga0453683_0000569
452 Ga0453683_0001660
453 Ga0453683_0005657
454 Ga0453683_0006079
455 Ga0453683_0033494
456 Ga0453683_0038387
457 Ga0453683_0058418
458 Ga0453684_0000241
459 Ga0453684_0000383
460 Ga0453684_0000486
461 Ga0453684_0000609
462 Ga0453684_0000817
463 Ga0453684_0000991
464 Ga0453684_0001223
465 Ga0453684_0002351
466 Ga0453684_0003557
467 Ga0453684_0003791
468 Ga0453684_0004124
469 Ga0453684_0006221
470 Ga0453684_0006795
471 Ga0453684_0006816
472 Ga0453684_0007659
473 Ga0453684_0007925
474 Ga0453684_0008344
475 Ga0453684_0016011
476 Ga0453684_0022830
477 Ga0453684_0024795
478 Ga0453684_0026962
479 Ga0453684_0027168
480 Ga0453684_0027345
481 Ga0453684_0030018
482 Ga0453684_0033659
483 Ga0453684_0038129
484 Ga0453684_0039228
485 Ga0453684_0042159
486 Ga0453684_0066312
487 Ga0453684_0073130
488 Ga0453684_0088702
489 Ga0453684_0144878
490 Ga0453684_0150749
491 Ga0453684_0156376
492 Ga0453684_0160931
493 Ga0453684_0246645
494 Ga0451576_0000518
495 Ga0451576_0000847
496 Ga0451576_0000995
497 Ga0451576_0001008
498 Ga0451576_0002068
499 Ga0451576_0004180
500 Ga0451576_0013210
501 Ga0451576_0015568
502 Ga0451576_0030213
503 Ga0451576_0035527
504 Ga0451576_0037274
505 Ga0451576_0043939
506 Ga0451576_0053822
507 Ga0451576_0064104
508 Ga0451576_0103570
509 Ga0451576_0141885
510 Ga0451576_0152592
511 Ga0451576_0195535
512 Ga0495620_0023662
513 Ga0495654_0013703
514 Ga0495672_0002387
515 Ga0496102_0005255
516 Ga0496106_0005250
517 Ga0496107_0105950
518 Ga0496112_0001235
519 Ga0496122_0015916
520 Ga0496125_0002764
521 Ga0496126_0000190
522 Ga0496126_0150042
523 Ga0501043_0161134
524 Ga0501081_0121407
525 Ga0501035_0000259
526 Ga0530510_0048580
527 2688067398
528 2889422178
529 2920115078
530 2929298208
531 8007374536
532 8007379590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21688

FAD-depend_C

FAD-dependent protein, C-terminal domain-like

343

543

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nlc-assembly1.cif.gz_A crystal structure of the vp0956 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr147 0.9023 2 505
6eod-assembly1.cif.gz_H structure of reductive aminase from aspergillus terreus in complex with nadph 0.9008 68 96
6eoi-assembly1.cif.gz_B reductive aminase from aspergillus terreus in complex with nadph and ethyl-5-oxohexanoate 0.8965 68 96
3nlc-assembly1.cif.gz_A crystal structure of the vp0956 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr147 0.8953 2 505
6eoh-assembly1.cif.gz_A reductive aminase from aspergillus terreus in complex with nadph and ethyl levulinate 0.8929 68 96
ID Description Score Start End Superfamily
af_A0A0P0WM81_180_403_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.951 66 274 3.50.50.60
3nlcA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9138 64 505 3.50.50.60
af_Q687X5_19_201_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.901 67 98 3.40.50.720
af_I1LIA8_18_345_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8949 176 232 3.50.50.60
1id1B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8885 66 98 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1L9BCB0-F1-model_v4 FAD-dependent oxidoreductase 0.9932 2 506 GO:0071949
AF-A0A4Y6CSY5-F1-model_v4 deleted 0.9925 2 506
AF-A0A1L9BCB0-F1-model_v4 FAD-dependent oxidoreductase 0.9893 2 506 GO:0071949
AF-A0A4Y6CSY5-F1-model_v4 deleted 0.9886 2 506
AF-A0A0V0HRY7-F1-model_v4 Putative ovule protein 0.9825 308 464

Map