F374149

General Info

Members Datasets Scaffolds Average Seq Length
266 161 532 149

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10011025|Ga0209974_100110256
Length 151
Sequence MRRVRLASEAFDPHEELRRFAETRTSAGGIVSFLGQVRQEEGDPVEALELRHYAPLTLPGMDELALRAETRWPLIATLVIHRIGVMVPGDPIVLVACAARHRRDAFEAADFLMDHLKSSAWFWKREKTAEGWRWIEPRGQDYADLARWAED

Samples

Sample ID Description Type Environment
1 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
110 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
111 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
154 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
155 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
157 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
158 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
159 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
160 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
161 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.78
Nodule 0
Rhizoplane 7.14
Rhizosphere 68.8
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209974_10011025 3300027876 Bacteria 3043
2 JGI24748J21848_1002266 3300002074 Bacteria 2158
3 JGI24751J29686_10000070 3300002459 Bacteria 59622
4 Ga0055530_10021415 3300003791 Bacteria 1906
5 Ga0065704_10070490 3300005289 Bacteria 22609
6 Ga0065707_10084843 3300005295 Bacteria 6711
7 Ga0070658_10079120 3300005327 Bacteria 2699
8 Ga0070690_100111694 3300005330 Bacteria 1825
9 Ga0070670_100212286 3300005331 Bacteria 1683
10 Ga0070666_10013849 3300005335 Bacteria 5125
11 Ga0070666_10073352 3300005335 Bacteria 2331
12 Ga0070666_11101893 3300005335 Bacteria 590
13 Ga0070660_100044715 3300005339 Bacteria 3388
14 Ga0070660_101272617 3300005339 Bacteria 624
15 Ga0070668_100367274 3300005347 Bacteria 1222
16 Ga0070668_100958886 3300005347 Bacteria 767
17 Ga0070669_100000492 3300005353 Bacteria 29848
18 Ga0070669_100001266 3300005353 Bacteria 18324
19 Ga0070669_100547789 3300005353 Bacteria 964
20 Ga0070671_100000003 3300005355 Bacteria 270186
21 Ga0070671_100008715 3300005355 Bacteria 8138
22 Ga0070671_100552860 3300005355 Bacteria 993
23 Ga0070667_100000596 3300005367 Bacteria 35305
24 Ga0070667_100001888 3300005367 Bacteria 18600
25 Ga0070667_100388172 3300005367 Bacteria 1269
26 Ga0070667_100418448 3300005367 Bacteria 1221
27 Ga0070667_100618519 3300005367 Bacteria 999
28 Ga0070705_100044034 3300005440 Bacteria 2562
29 Ga0070663_100680152 3300005455 Bacteria 873
30 Ga0070707_100339145 3300005468 Bacteria 1460
31 Ga0070679_100004124 3300005530 Bacteria 13399
32 Ga0070679_100020808 3300005530 Bacteria 6399
33 Ga0070679_100223094 3300005530 Bacteria 1845
34 Ga0070679_100392011 3300005530 Bacteria 1335
35 Ga0070684_101424066 3300005535 Bacteria 653
36 Ga0070665_100004063 3300005548 Bacteria 15396
37 Ga0070665_100321180 3300005548 Bacteria 1552
38 Ga0068855_100003943 3300005563 Bacteria 18111
39 Ga0068855_100044402 3300005563 Bacteria 5259
40 Ga0068855_101187969 3300005563 Bacteria 794
41 Ga0068852_100104768 3300005616 Bacteria 2561
42 Ga0068859_100091034 3300005617 Bacteria 3101
43 Ga0068859_100346406 3300005617 Bacteria 1580
44 Ga0068859_103178335 3300005617 Bacteria 500
45 Ga0068864_100158984 3300005618 Bacteria 2053
46 Ga0068863_100005101 3300005841 Bacteria 12954
47 Ga0068858_100003668 3300005842 Bacteria 15206
48 Ga0068858_100130059 3300005842 Bacteria 2360
49 Ga0068858_100292134 3300005842 Bacteria 1554
50 Ga0068860_100018416 3300005843 Bacteria 6793
51 Ga0068860_100024198 3300005843 Bacteria 5872
52 Ga0068860_100026435 3300005843 Bacteria 5595
53 Ga0068860_100073275 3300005843 Bacteria 3255
54 Ga0068862_100075760 3300005844 Bacteria 2911
55 Ga0068862_100567067 3300005844 Bacteria 1086
56 Ga0075365_10072164 3300006038 Bacteria 2325
57 Ga0075363_100005460 3300006048 Bacteria 5658
58 Ga0075363_100025154 3300006048 Bacteria 3033
59 Ga0075362_10000033 3300006177 Bacteria 50782
60 Ga0075362_10001290 3300006177 Bacteria 7936
61 Ga0075367_10032202 3300006178 Bacteria 3015
62 Ga0075367_10084541 3300006178 Bacteria 1924
63 Ga0075369_10009867 3300006186 Bacteria 3724
64 Ga0075369_10185316 3300006186 Bacteria 958
65 Ga0075366_10000058 3300006195 Bacteria 40618
66 Ga0075366_10112277 3300006195 Unclassified 1640
67 Ga0075370_10000139 3300006353 Bacteria 24533
68 Ga0097620_100091033 3300006931 Bacteria 3101
69 Ga0097620_100346417 3300006931 Bacteria 1580
70 Ga0097620_103176856 3300006931 Bacteria 500
71 Ga0105251_10145566 3300009011 Bacteria 1071
72 Ga0105250_10008207 3300009092 Bacteria 4445
73 Ga0105240_11514592 3300009093 Bacteria 703
74 Ga0105247_10185694 3300009101 Bacteria 1390
75 Ga0105247_10287910 3300009101 Bacteria 1135
76 Ga0105241_11210077 3300009174 Bacteria 716
77 Ga0105248_10035903 3300009177 Bacteria 5544
78 Ga0105248_10060330 3300009177 Bacteria 4258
79 Ga0105248_10226064 3300009177 Bacteria 2106
80 Ga0105248_10254607 3300009177 Bacteria 1976
81 Ga0105248_10909316 3300009177 Bacteria 994
82 Ga0105249_10071480 3300009553 Bacteria 3206
83 Ga0105249_10151237 3300009553 Bacteria 2235
84 Ga0105239_10834503 3300010375 Bacteria 1056
85 Ga0157371_10121245 3300013102 Bacteria 1859
86 Ga0163162_10075148 3300013306 Bacteria 3439
87 Ga0157379_11299013 3300014968 Bacteria 702
88 Ga0209050_1000924 3300025298 Bacteria 38702
89 Ga0207696_1005004 3300025711 Bacteria 5585
90 Ga0207713_1012386 3300025735 Bacteria 4566
91 Ga0207680_10062523 3300025903 Bacteria 2275
92 Ga0207680_10411243 3300025903 Bacteria 957
93 Ga0207705_10001064 3300025909 Bacteria 22327
94 Ga0207705_10096504 3300025909 Bacteria 2170
95 Ga0207705_10667443 3300025909 Bacteria 808
96 Ga0207660_10179171 3300025917 Bacteria 1645
97 Ga0207657_10009136 3300025919 Bacteria 10001
98 Ga0207657_10586726 3300025919 Bacteria 870
99 Ga0207657_10924205 3300025919 Bacteria 672
100 Ga0207657_11125704 3300025919 Bacteria 599
101 Ga0207652_10058594 3300025921 Bacteria 3318
102 Ga0207652_10111475 3300025921 Bacteria 2426
103 Ga0207652_10145297 3300025921 Bacteria 2122
104 Ga0207652_10356442 3300025921 Bacteria 1320
105 Ga0207652_10621645 3300025921 Bacteria 967
106 Ga0207646_10287817 3300025922 Bacteria 1485
107 Ga0207681_10001389 3300025923 Bacteria 15634
108 Ga0207681_10001632 3300025923 Bacteria 14465
109 Ga0207644_10006574 3300025931 Bacteria 7573
110 Ga0207644_10034098 3300025931 Bacteria 3562
111 Ga0207644_10440059 3300025931 Bacteria 1070
112 Ga0207690_10160590 3300025932 Unclassified 1675
113 Ga0207690_10522234 3300025932 Bacteria 962
114 Ga0207711_10109617 3300025941 Bacteria 2453
115 Ga0207711_10137724 3300025941 Bacteria 2194
116 Ga0207711_10272209 3300025941 Bacteria 1558
117 Ga0207711_10398139 3300025941 Bacteria 1279
118 Ga0207711_10724042 3300025941 Bacteria 928
119 Ga0207667_10012325 3300025949 Bacteria 9861
120 Ga0207667_10025766 3300025949 Bacteria 6433
121 Ga0207667_10641704 3300025949 Bacteria 1068
122 Ga0207712_10011598 3300025961 Bacteria 5619
123 Ga0207712_10092955 3300025961 Bacteria 2224
124 Ga0207668_10060962 3300025972 Bacteria 2650
125 Ga0207658_10001159 3300025986 Bacteria 21112
126 Ga0207658_10006559 3300025986 Bacteria 7937
127 Ga0207658_10396067 3300025986 Bacteria 1213
128 Ga0207658_10542279 3300025986 Bacteria 1040
129 Ga0207703_10001372 3300026035 Bacteria 22250
130 Ga0207703_10064656 3300026035 Bacteria 3004
131 Ga0207703_10116409 3300026035 Bacteria 2288
132 Ga0207678_10069155 3300026067 Bacteria 3028
133 Ga0207678_10077426 3300026067 Bacteria 2848
134 Ga0207678_10096627 3300026067 Bacteria 2524
135 Ga0207702_10864501 3300026078 Bacteria 895
136 Ga0207641_10005768 3300026088 Bacteria 10516
137 Ga0207676_10174867 3300026095 Bacteria 1874
138 Ga0207698_10176420 3300026142 Bacteria 1888
139 Ga0209813_10000081 3300027866 Bacteria 35059
140 Ga0268266_10014912 3300028379 Bacteria 6674
141 Ga0268265_10056447 3300028380 Bacteria 2987
142 Ga0268264_10006783 3300028381 Bacteria 9618
143 Ga0268264_10034093 3300028381 Bacteria 4186
144 Ga0268264_10215525 3300028381 Bacteria 1765
145 Ga0307508_10041096 3300031616 Bacteria 4151
146 Ga0307405_10076231 3300031731 Bacteria 2175
147 Ga0307413_10282808 3300031824 Bacteria 1249
148 Ga0307412_10117433 3300031911 Bacteria 1910
149 Ga0307409_100195774 3300031995 Bacteria 1804
150 Ga0373932_0049822 3300035112 Bacteria 1239
151 Ga0373953_0258262 3300035117 Bacteria 758
152 Ga0373946_0072105 3300035171 Bacteria 1494
153 Ga0373931_0020597 3300035691 Bacteria 3301
154 Ga0373927_0073121 3300035695 Bacteria 2220
155 Ga0373947_0038300 3300035725 Bacteria 2848
156 Ga0316582_0509953 3300036647 Bacteria 829
157 Ga0316584_0363417 3300036712 Bacteria 1037
158 Ga0373925_0156912 3300037068 Bacteria 1790
159 Ga0451833_1339892 3300041491 Bacteria 1214
160 Ga0453684_0462864 3300044712 Bacteria 1410
161 Ga0451576_0000007 3300045051 Bacteria 782228
162 Ga0495627_002345 3300046453 Bacteria 9260
163 Ga0495650_0003966 3300046471 Bacteria 10402
164 Ga0495596_0000040 3300046500 Bacteria 93322
165 Ga0495596_0001722 3300046500 Bacteria 12303
166 Ga0495607_0009588 3300046501 Bacteria 6543
167 Ga0495583_0059233 3300046506 Bacteria 1717
168 Ga0495606_0087704 3300046507 Bacteria 1920
169 Ga0495610_0000015 3300046512 Bacteria 391489
170 Ga0495610_0001956 3300046512 Bacteria 17724
171 Ga0495610_0010248 3300046512 Bacteria 5841
172 Ga0495616_0063440 3300046513 Bacteria 1806
173 Ga0495620_0023001 3300046515 Bacteria 2989
174 Ga0495620_0103149 3300046515 Bacteria 1135
175 Ga0495632_0000216 3300046519 Bacteria 58320
176 Ga0495632_0081962 3300046519 Bacteria 1538
177 Ga0495643_0000201 3300046522 Bacteria 93295
178 Ga0495643_0003554 3300046522 Bacteria 11336
179 Ga0495643_0024747 3300046522 Bacteria 3403
180 Ga0495643_0226135 3300046522 Bacteria 885
181 Ga0495609_0009827 3300046538 Bacteria 4614
182 Ga0495633_0117860 3300046558 Bacteria 1230
183 Ga0495668_0300289 3300046616 Bacteria 880
184 Ga0495625_0012709 3300046660 Bacteria 6810
185 Ga0495625_0104416 3300046660 Bacteria 1942
186 Ga0495671_0332043 3300046692 Bacteria 730
187 Ga0495681_0000207 3300047470 Bacteria 48809
188 Ga0495681_0284163 3300047470 Bacteria 644
189 Ga0495615_0000279 3300048090 Bacteria 9418
190 Ga0495626_0000877 3300048091 Bacteria 26762
191 Ga0496100_0247523 3300048903 Bacteria 1317
192 Ga0496101_0136243 3300048904 Bacteria 1868
193 Ga0496102_0001054 3300048905 Bacteria 25520
194 Ga0496103_0000289 3300048906 Bacteria 47033
195 Ga0496104_0000474 3300048907 Bacteria 34558
196 Ga0496105_0442118 3300048908 Bacteria 1027
197 Ga0496107_0095193 3300048910 Bacteria 2179
198 Ga0496108_0097491 3300048911 Bacteria 2505
199 Ga0496109_0895075 3300048912 Bacteria 825
200 Ga0496110_0513381 3300048913 Bacteria 1090
201 Ga0496110_1470357 3300048913 Bacteria 591
202 Ga0496111_0132455 3300048914 Bacteria 1845
203 Ga0496111_0138921 3300048914 Bacteria 1800
204 Ga0496112_0589891 3300048915 Bacteria 1043
205 Ga0496113_0018727 3300048916 Bacteria 4827
206 Ga0496113_0298981 3300048916 Bacteria 1289
207 Ga0496114_0312298 3300048917 Bacteria 1388
208 Ga0496115_0154846 3300048918 Bacteria 1893
209 Ga0496115_0165613 3300048918 Bacteria 1828
210 Ga0496116_0000062 3300048919 Bacteria 271104
211 Ga0496117_0004523 3300048920 Bacteria 15262
212 Ga0496118_0004825 3300048921 Bacteria 15724
213 Ga0496119_0009738 3300048922 Bacteria 8181
214 Ga0496120_0008930 3300048923 Bacteria 7178
215 Ga0496121_0006782 3300048924 Bacteria 14038
216 Ga0496121_0057301 3300048924 Bacteria 3230
217 Ga0496121_0698553 3300048924 Bacteria 611
218 Ga0496122_0002883 3300048925 Bacteria 23539
219 Ga0496122_0005558 3300048925 Bacteria 14935
220 Ga0496122_0033342 3300048925 Bacteria 4237
221 Ga0496122_0160162 3300048925 Bacteria 1374
222 Ga0496122_0379237 3300048925 Bacteria 726
223 Ga0496123_0001993 3300048926 Bacteria 26408
224 Ga0496123_0007196 3300048926 Bacteria 10559
225 Ga0496123_0041482 3300048926 Bacteria 3189
226 Ga0496124_0000441 3300048927 Bacteria 73415
227 Ga0496124_0015561 3300048927 Bacteria 7284
228 Ga0496124_0023902 3300048927 Bacteria 5566
229 Ga0496124_0065910 3300048927 Bacteria 3018
230 Ga0496125_0009916 3300048928 Bacteria 9686
231 Ga0496125_0062486 3300048928 Bacteria 2977
232 Ga0496126_0000637 3300048929 Bacteria 65311
233 Ga0496126_0000802 3300048929 Bacteria 56265
234 Ga0496126_0002207 3300048929 Bacteria 26960
235 Ga0496126_0097975 3300048929 Bacteria 2569
236 Ga0501032_0317602 3300049569 Bacteria 1006
237 Ga0501034_0349586 3300049571 Bacteria 1407
238 Ga0501036_0560372 3300049572 Bacteria 949
239 Ga0501037_0585939 3300049573 Bacteria 750
240 Ga0501039_0205164 3300049575 Bacteria 1550
241 Ga0501047_0207951 3300049581 Bacteria 1816
242 Ga0501044_0110516 3300049823 Bacteria 2757
243 nmdc:mga03683_32_c1 3300050489 Bacteria 68182
244 nmdc:mga03683_41155_c1 3300050489 Bacteria 1898
245 nmdc:mga03683_67348_c1 3300050489 Bacteria 1524
246 nmdc:mga03n38_6055_c1 3300050490 Bacteria 3842
247 nmdc:mga00v17_1556_c1 3300050491 Bacteria 11982
248 nmdc:mga0k408_17456_c1 3300050493 Bacteria 3999
249 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
250 nmdc:mga06z11_904_c1 3300050494 Bacteria 10791
251 nmdc:mga04h51_172_c1 3300050495 Bacteria 18653
252 nmdc:mga07m45_100224_c1 3300050496 Bacteria 1663
253 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
254 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
255 nmdc:mga07m45_41346_c1 3300050496 Bacteria 2581
256 nmdc:mga0sz30_32775_c1 3300050516 Bacteria 2156
257 nmdc:mga0sz30_36047_c1 3300050516 Bacteria 2067
258 Ga0500607_001731 3300053121 Bacteria 18963
259 Ga0500590_067018 3300053148 Bacteria 1791
260 Ga0500636_0369786 3300053177 Unclassified 677
261 Ga0500645_003023 3300053730 Bacteria 7095
262 2511129462 2510917021 Bacteria 5705459
263 2643948661 2643221588 Bacteria 3692460
264 2819554109 2818991438 Bacteria 5793701
265 3000865331 3000865235 Bacteria 3106258
266 8054305369 8054302542 Bacteria 5698134
267 Ga0209974_10011025
268 JGI24748J21848_1002266
269 JGI24751J29686_10000070
270 Ga0055530_10021415
271 Ga0065704_10070490
272 Ga0065707_10084843
273 Ga0070658_10079120
274 Ga0070690_100111694
275 Ga0070670_100212286
276 Ga0070666_10013849
277 Ga0070666_10073352
278 Ga0070666_11101893
279 Ga0070660_100044715
280 Ga0070660_101272617
281 Ga0070668_100367274
282 Ga0070668_100958886
283 Ga0070669_100000492
284 Ga0070669_100001266
285 Ga0070669_100547789
286 Ga0070671_100000003
287 Ga0070671_100008715
288 Ga0070671_100552860
289 Ga0070667_100000596
290 Ga0070667_100001888
291 Ga0070667_100388172
292 Ga0070667_100418448
293 Ga0070667_100618519
294 Ga0070705_100044034
295 Ga0070663_100680152
296 Ga0070707_100339145
297 Ga0070679_100004124
298 Ga0070679_100020808
299 Ga0070679_100223094
300 Ga0070679_100392011
301 Ga0070684_101424066
302 Ga0070665_100004063
303 Ga0070665_100321180
304 Ga0068855_100003943
305 Ga0068855_100044402
306 Ga0068855_101187969
307 Ga0068852_100104768
308 Ga0068859_100091034
309 Ga0068859_100346406
310 Ga0068859_103178335
311 Ga0068864_100158984
312 Ga0068863_100005101
313 Ga0068858_100003668
314 Ga0068858_100130059
315 Ga0068858_100292134
316 Ga0068860_100018416
317 Ga0068860_100024198
318 Ga0068860_100026435
319 Ga0068860_100073275
320 Ga0068862_100075760
321 Ga0068862_100567067
322 Ga0075365_10072164
323 Ga0075363_100005460
324 Ga0075363_100025154
325 Ga0075362_10000033
326 Ga0075362_10001290
327 Ga0075367_10032202
328 Ga0075367_10084541
329 Ga0075369_10009867
330 Ga0075369_10185316
331 Ga0075366_10000058
332 Ga0075366_10112277
333 Ga0075370_10000139
334 Ga0097620_100091033
335 Ga0097620_100346417
336 Ga0097620_103176856
337 Ga0105251_10145566
338 Ga0105250_10008207
339 Ga0105240_11514592
340 Ga0105247_10185694
341 Ga0105247_10287910
342 Ga0105241_11210077
343 Ga0105248_10035903
344 Ga0105248_10060330
345 Ga0105248_10226064
346 Ga0105248_10254607
347 Ga0105248_10909316
348 Ga0105249_10071480
349 Ga0105249_10151237
350 Ga0105239_10834503
351 Ga0157371_10121245
352 Ga0163162_10075148
353 Ga0157379_11299013
354 Ga0209050_1000924
355 Ga0207696_1005004
356 Ga0207713_1012386
357 Ga0207680_10062523
358 Ga0207680_10411243
359 Ga0207705_10001064
360 Ga0207705_10096504
361 Ga0207705_10667443
362 Ga0207660_10179171
363 Ga0207657_10009136
364 Ga0207657_10586726
365 Ga0207657_10924205
366 Ga0207657_11125704
367 Ga0207652_10058594
368 Ga0207652_10111475
369 Ga0207652_10145297
370 Ga0207652_10356442
371 Ga0207652_10621645
372 Ga0207646_10287817
373 Ga0207681_10001389
374 Ga0207681_10001632
375 Ga0207644_10006574
376 Ga0207644_10034098
377 Ga0207644_10440059
378 Ga0207690_10160590
379 Ga0207690_10522234
380 Ga0207711_10109617
381 Ga0207711_10137724
382 Ga0207711_10272209
383 Ga0207711_10398139
384 Ga0207711_10724042
385 Ga0207667_10012325
386 Ga0207667_10025766
387 Ga0207667_10641704
388 Ga0207712_10011598
389 Ga0207712_10092955
390 Ga0207668_10060962
391 Ga0207658_10001159
392 Ga0207658_10006559
393 Ga0207658_10396067
394 Ga0207658_10542279
395 Ga0207703_10001372
396 Ga0207703_10064656
397 Ga0207703_10116409
398 Ga0207678_10069155
399 Ga0207678_10077426
400 Ga0207678_10096627
401 Ga0207702_10864501
402 Ga0207641_10005768
403 Ga0207676_10174867
404 Ga0207698_10176420
405 Ga0209813_10000081
406 Ga0268266_10014912
407 Ga0268265_10056447
408 Ga0268264_10006783
409 Ga0268264_10034093
410 Ga0268264_10215525
411 Ga0307508_10041096
412 Ga0307405_10076231
413 Ga0307413_10282808
414 Ga0307412_10117433
415 Ga0307409_100195774
416 Ga0373932_0049822
417 Ga0373953_0258262
418 Ga0373946_0072105
419 Ga0373931_0020597
420 Ga0373927_0073121
421 Ga0373947_0038300
422 Ga0316582_0509953
423 Ga0316584_0363417
424 Ga0373925_0156912
425 Ga0451833_1339892
426 Ga0453684_0462864
427 Ga0451576_0000007
428 Ga0495627_002345
429 Ga0495650_0003966
430 Ga0495596_0000040
431 Ga0495596_0001722
432 Ga0495607_0009588
433 Ga0495583_0059233
434 Ga0495606_0087704
435 Ga0495610_0000015
436 Ga0495610_0001956
437 Ga0495610_0010248
438 Ga0495616_0063440
439 Ga0495620_0023001
440 Ga0495620_0103149
441 Ga0495632_0000216
442 Ga0495632_0081962
443 Ga0495643_0000201
444 Ga0495643_0003554
445 Ga0495643_0024747
446 Ga0495643_0226135
447 Ga0495609_0009827
448 Ga0495633_0117860
449 Ga0495668_0300289
450 Ga0495625_0012709
451 Ga0495625_0104416
452 Ga0495671_0332043
453 Ga0495681_0000207
454 Ga0495681_0284163
455 Ga0495615_0000279
456 Ga0495626_0000877
457 Ga0496100_0247523
458 Ga0496101_0136243
459 Ga0496102_0001054
460 Ga0496103_0000289
461 Ga0496104_0000474
462 Ga0496105_0442118
463 Ga0496107_0095193
464 Ga0496108_0097491
465 Ga0496109_0895075
466 Ga0496110_0513381
467 Ga0496110_1470357
468 Ga0496111_0132455
469 Ga0496111_0138921
470 Ga0496112_0589891
471 Ga0496113_0018727
472 Ga0496113_0298981
473 Ga0496114_0312298
474 Ga0496115_0154846
475 Ga0496115_0165613
476 Ga0496116_0000062
477 Ga0496117_0004523
478 Ga0496118_0004825
479 Ga0496119_0009738
480 Ga0496120_0008930
481 Ga0496121_0006782
482 Ga0496121_0057301
483 Ga0496121_0698553
484 Ga0496122_0002883
485 Ga0496122_0005558
486 Ga0496122_0033342
487 Ga0496122_0160162
488 Ga0496122_0379237
489 Ga0496123_0001993
490 Ga0496123_0007196
491 Ga0496123_0041482
492 Ga0496124_0000441
493 Ga0496124_0015561
494 Ga0496124_0023902
495 Ga0496124_0065910
496 Ga0496125_0009916
497 Ga0496125_0062486
498 Ga0496126_0000637
499 Ga0496126_0000802
500 Ga0496126_0002207
501 Ga0496126_0097975
502 Ga0501032_0317602
503 Ga0501034_0349586
504 Ga0501036_0560372
505 Ga0501037_0585939
506 Ga0501039_0205164
507 Ga0501047_0207951
508 Ga0501044_0110516
509 nmdc:mga03683_32_c1
510 nmdc:mga03683_41155_c1
511 nmdc:mga03683_67348_c1
512 nmdc:mga03n38_6055_c1
513 nmdc:mga00v17_1556_c1
514 nmdc:mga0k408_17456_c1
515 nmdc:mga0k408_7_c1
516 nmdc:mga06z11_904_c1
517 nmdc:mga04h51_172_c1
518 nmdc:mga07m45_100224_c1
519 nmdc:mga07m45_15_c1
520 nmdc:mga07m45_3_c1
521 nmdc:mga07m45_41346_c1
522 nmdc:mga0sz30_32775_c1
523 nmdc:mga0sz30_36047_c1
524 Ga0500607_001731
525 Ga0500590_067018
526 Ga0500636_0369786
527 Ga0500645_003023
528 2511129462
529 2643948661
530 2819554109
531 3000865331
532 8054305369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

6

119

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.8904 1 145
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.8846 1 145
2omd-assembly1.cif.gz_A crystal structure of molybdopterin converting factor subunit 2 (aq_2181) from aquifex aeolicus vf5 0.8819 28 125
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.8666 1 123
1nvj-assembly1.cif.gz_B deletion mutant (delta 141) of molybdopterin synthase 0.8631 1 122
ID Description Score Start End Superfamily
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8948 1 145 3.90.1170.40
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.889 1 145 3.90.1170.40
2omdA00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8819 28 125 3.90.1170.40
af_P9WJR1_4_141_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8508 7 133 3.90.1170.40
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8443 1 123 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A4Q5SDT8-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9448 2 104 GO:0006777
GO:0030366
AF-A0A437H1P9-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9437 3 145 GO:0006777
GO:0030366
AF-A0A3D1P0E0-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9425 1 145 GO:0006777
GO:0030366
AF-A0A222EWI1-F1-model_v4 deleted 0.9411 4 145
AF-A0A0H0XNW8-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9399 5 145 GO:0006777
GO:0030366

Map