F374167

General Info

Members Datasets Scaffolds Average Seq Length
266 207 246 229

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000669|Ga0265327_1000066931
Length 267
Sequence LTTEFILAIKKCCAAHKVFIDKYFEPVIGIKTCLERIINLEQIINEILEALRKHGSEKNRTGMARFGITTDKAFGVNIPVIRNIAKVYKNEHEIALALWDTGFHEARLLAVFIDNPKLVTKEQANKWVAGFNSWDICDQCCGNLFDKLPFANKLALEWIKDEREYVRRAGFVVFTAQAVHDKKAPNKLFIDFLPYLEKYATDERNFVRKAVNWSLRQIGKRNTTLRIQALECAERISQINSKAARWIAADAIRELNNEKTISRIKIG

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221585 Pelomonas sp. Root662 Isolate Unclassified
4 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
5 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
6 2643221656 Pelomonas sp. Root405 Isolate Unclassified
7 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
8 2738541337 Pelomonas sp. BT06 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
12 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
13 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
17 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
18 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
19 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
20 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
115 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
116 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
117 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
176 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
177 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
178 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
179 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
180 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
181 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
184 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
185 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
186 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
187 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
193 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
194 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 0
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 1.13
Rhizoplane 0.38
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 9.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10010242 3300003316 Bacteria 16207
2 rootH1_10010242 3300003323 Bacteria 4246
3 rootL2_10003693 3300003322 Bacteria 22708
4 rootH1_10088269 3300003323 Bacteria 1585
5 Ga0055531_10000154 3300003794 Bacteria 79686
6 Ga0070682_100006372 3300005337 Bacteria 6626
7 Ga0070661_100234182 3300005344 Bacteria 1412
8 Ga0070669_100047848 3300005353 Bacteria 3120
9 Ga0070675_100042274 3300005354 Bacteria 3724
10 Ga0070711_100214912 3300005439 Unclassified 1491
11 Ga0070694_100645382 3300005444 Unclassified 856
12 Ga0070708_100238993 3300005445 Archaea 1705
13 Ga0070662_100006831 3300005457 Bacteria 7378
14 Ga0070706_100017411 3300005467 Bacteria 6631
15 Ga0070707_100028933 3300005468 Archaea 5274
16 Ga0070707_100131017 3300005468 Bacteria 2438
17 Ga0070707_100241612 3300005468 Bacteria 1757
18 Ga0070707_100434983 3300005468 Unclassified 1272
19 Ga0070697_100002327 3300005536 Archaea 14601
20 Ga0070665_100875079 3300005548 Bacteria 911
21 Ga0068855_100000097 3300005563 Bacteria 106474
22 Ga0068856_100128190 3300005614 Bacteria 2541
23 Ga0068852_100770550 3300005616 Bacteria 975
24 Ga0068863_100420705 3300005841 Bacteria 1309
25 Ga0068862_100125904 3300005844 Bacteria 2262
26 Ga0081455_10023935 3300005937 Bacteria 5670
27 Ga0070715_10090594 3300006163 Bacteria 1406
28 Ga0075366_10050612 3300006195 Bacteria 2468
29 Ga0075370_10001684 3300006353 Bacteria 9799
30 Ga0075370_10055013 3300006353 Bacteria 2261
31 Ga0075370_10091083 3300006353 Bacteria 1759
32 Ga0075428_100205850 3300006844 Bacteria 2126
33 Ga0075429_100141796 3300006880 Bacteria 2104
34 Ga0075435_100225068 3300007076 Bacteria 1593
35 Ga0099794_10028670 3300007265 Bacteria 2590
36 Ga0105240_10028314 3300009093 Bacteria 7320
37 Ga0111539_10014455 3300009094 Bacteria 9851
38 Ga0105241_10266799 3300009174 Bacteria 1457
39 Ga0105242_10019683 3300009176 Bacteria 5290
40 Ga0105248_10043141 3300009177 Bacteria 5058
41 Ga0105248_10861342 3300009177 Unclassified 1023
42 Ga0105237_10001254 3300009545 Bacteria 33897
43 Ga0105237_10135206 3300009545 Unclassified 2460
44 Ga0105238_10728772 3300009551 Bacteria 1004
45 Ga0157371_10315991 3300013102 Bacteria 1133
46 Ga0157369_10000015 3300013105 Bacteria 262917
47 Ga0157369_10680084 3300013105 Unclassified 1060
48 Ga0157369_11139071 3300013105 Unclassified 797
49 Ga0157378_10054412 3300013297 Bacteria 3563
50 Ga0157372_10007317 3300013307 Bacteria 11752
51 Ga0157372_10643115 3300013307 Bacteria 1235
52 Ga0157375_10089312 3300013308 Bacteria 3138
53 Ga0163163_10088110 3300014325 Bacteria 3115
54 Ga0163163_10302224 3300014325 Bacteria 1653
55 Ga0182007_10000010 3300015262 Bacteria 286070
56 Ga0163161_10000206 3300017792 Bacteria 54119
57 Ga0163161_10050486 3300017792 Bacteria 3011
58 Ga0209050_1002439 3300025298 Bacteria 15954
59 Ga0209257_1000016 3300025304 Bacteria 908015
60 Ga0209257_1012688 3300025304 Bacteria 3857
61 Ga0207684_10001415 3300025910 Bacteria 25974
62 Ga0207671_10003534 3300025914 Bacteria 15498
63 Ga0207663_10286391 3300025916 Unclassified 1226
64 Ga0207649_10170685 3300025920 Bacteria 1515
65 Ga0207646_10509345 3300025922 Bacteria 1084
66 Ga0207659_10027776 3300025926 Bacteria 3836
67 Ga0207706_10012274 3300025933 Bacteria 7808
68 Ga0207686_10266819 3300025934 Bacteria 1258
69 Ga0207711_10059647 3300025941 Bacteria 3286
70 Ga0207667_10000190 3300025949 Bacteria 90197
71 Ga0207641_10341089 3300026088 Unclassified 1426
72 Ga0207675_100619662 3300026118 Bacteria 1086
73 Ga0207698_10010995 3300026142 Bacteria 5850
74 Ga0207698_10039613 3300026142 Bacteria 3493
75 Ga0207698_10223403 3300026142 Bacteria 1704
76 Ga0207428_10094651 3300027907 Bacteria 2315
77 Ga0268265_10099011 3300028380 Bacteria 2350
78 Ga0265337_1034740 3300028556 Bacteria 1481
79 Ga0265319_1008983 3300028563 Bacteria 4314
80 Ga0265323_10000279 3300028653 Bacteria 29548
81 Ga0265323_10016186 3300028653 Unclassified 2916
82 Ga0307515_10007614 3300028794 Bacteria 21371
83 Ga0307515_10019507 3300028794 Bacteria 12194
84 Ga0265338_10078877 3300028800 Bacteria 2774
85 Ga0265338_10301976 3300028800 Bacteria 1163
86 Ga0265332_10000003 3300031238 Bacteria 482849
87 Ga0265332_10041249 3300031238 Unclassified 1997
88 Ga0265327_10000669 3300031251 Bacteria 54988
89 Ga0265316_10000021 3300031344 Bacteria 185946
90 Ga0265316_10474297 3300031344 Bacteria 896
91 Ga0307509_10169764 3300031507 Bacteria 2063
92 Ga0307408_100000124 3300031548 Bacteria 85486
93 Ga0307408_100143225 3300031548 Bacteria 1878
94 Ga0265313_10057567 3300031595 Bacteria 1834
95 Ga0265342_10028701 3300031712 Unclassified 3462
96 Ga0307516_10000345 3300031730 Bacteria 60583
97 Ga0307516_10188112 3300031730 Bacteria 1793
98 Ga0307405_10000035 3300031731 Bacteria 92134
99 Ga0307410_10150223 3300031852 Bacteria 1734
100 Ga0307407_10000005 3300031903 Bacteria 233125
101 Ga0307409_100099005 3300031995 Bacteria 2413
102 Ga0307416_100000001 3300032002 Bacteria 515017
103 Ga0307414_10003604 3300032004 Bacteria 8286
104 Ga0307414_10190649 3300032004 Bacteria 1658
105 Ga0307411_10000114 3300032005 Bacteria 25159
106 Ga0373950_0034536 3300034818 Bacteria 948
107 Ga0373940_0030558 3300035088 Bacteria 1433
108 Ga0373932_0078841 3300035112 Bacteria 1036
109 Ga0373939_0000061 3300035114 Bacteria 37278
110 Ga0373945_0180322 3300035116 Bacteria 869
111 Ga0373960_0003211 3300035121 Bacteria 3698
112 Ga0373962_0056064 3300035242 Bacteria 1146
113 Ga0373931_0000100 3300035691 Bacteria 40028
114 Ga0373935_0021964 3300035692 Bacteria 3908
115 Ga0316582_0410273 3300036647 Bacteria 933
116 Ga0395900_0179253 3300037418 Bacteria 2154
117 Ga0395905_0001356 3300037471 Bacteria 29817
118 Ga0395905_0003472 3300037471 Bacteria 16849
119 Ga0395905_0049352 3300037471 Bacteria 3943
120 Ga0400489_30811 3300039093 Bacteria 1989
121 Ga0450888_001097 3300042126 Bacteria 2566
122 Ga0450891_000932 3300042129 Bacteria 3054
123 Ga0450902_004956 3300042137 Bacteria 1998
124 Ga0451577_0005077 3300042876 Bacteria 13582
125 Ga0451577_0015216 3300042876 Bacteria 7158
126 Ga0466972_0008182 3300044658 Bacteria 5244
127 Ga0453683_0059292 3300044673 Bacteria 2393
128 Ga0453683_0148088 3300044673 Bacteria 1483
129 Ga0453683_0251516 3300044673 Unclassified 1126
130 Ga0466965_0136549 3300044683 Bacteria 1274
131 Ga0466965_0331526 3300044683 Bacteria 830
132 Ga0466966_0022988 3300044684 Bacteria 4084
133 Ga0466961_0145296 3300044693 Bacteria 1483
134 Ga0453684_0000173 3300044712 Bacteria 285446
135 Ga0453684_0038325 3300044712 Bacteria 6556
136 Ga0453684_0054330 3300044712 Bacteria 5218
137 Ga0453684_0361530 3300044712 Bacteria 1634
138 Ga0466968_0358593 3300044735 Bacteria 709
139 Ga0466970_0069130 3300044765 Bacteria 1898
140 Ga0466959_0190724 3300045049 Bacteria 1430
141 Ga0451576_0003655 3300045051 Bacteria 20880
142 Ga0451576_0009813 3300045051 Bacteria 11064
143 Ga0451576_0299679 3300045051 Bacteria 1681
144 Ga0466958_0079643 3300045836 Bacteria 2015
145 Ga0495603_0138144 3300046455 Bacteria 1418
146 Ga0495629_0000523 3300046459 Bacteria 32051
147 Ga0495580_0117012 3300046472 Bacteria 1851
148 Ga0495582_0000602 3300046473 Bacteria 19849
149 Ga0495639_0005761 3300046475 Bacteria 5331
150 Ga0495662_0126613 3300046476 Bacteria 1255
151 Ga0495585_0002139 3300046492 Bacteria 14421
152 Ga0495630_0315384 3300046517 Bacteria 1195
153 Ga0495648_0014172 3300046524 Bacteria 5849
154 Ga0495663_0026869 3300046525 Bacteria 1687
155 Ga0495666_0038153 3300046526 Bacteria 2337
156 Ga0495654_0127021 3300046530 Bacteria 1148
157 Ga0495586_0113065 3300046535 Bacteria 1512
158 Ga0495634_0049192 3300046642 Bacteria 2836
159 Ga0495625_0001551 3300046660 Bacteria 27391
160 Ga0495588_0054255 3300046674 Bacteria 2068
161 Ga0495658_0000679 3300046683 Bacteria 18439
162 Ga0495613_0000608 3300046689 Bacteria 28616
163 Ga0495581_0002590 3300047315 Bacteria 10275
164 Ga0495676_0022392 3300047321 Bacteria 5497
165 Ga0496108_0756395 3300048911 Bacteria 840
166 Ga0501031_0019610 3300049568 Bacteria 4404
167 Ga0501031_0272623 3300049568 Bacteria 1098
168 Ga0501032_0003761 3300049569 Bacteria 11515
169 Ga0501033_0037115 3300049570 Bacteria 3648
170 Ga0501034_0126697 3300049571 Bacteria 2538
171 Ga0501036_0331851 3300049572 Unclassified 1270
172 Ga0501036_0336281 3300049572 Unclassified 1261
173 Ga0501037_0020361 3300049573 Bacteria 4897
174 Ga0501039_0296728 3300049575 Unclassified 1270
175 Ga0501040_0009960 3300049576 Bacteria 6207
176 Ga0501041_0107096 3300049577 Bacteria 1733
177 Ga0501041_0121931 3300049577 Unclassified 1620
178 Ga0501042_0007294 3300049578 Bacteria 7233
179 Ga0501043_0231949 3300049579 Unclassified 1425
180 Ga0501046_0003846 3300049580 Bacteria 13738
181 Ga0501046_0144835 3300049580 Unclassified 1795
182 Ga0501047_0311426 3300049581 Bacteria 1415
183 Ga0501048_0204957 3300049582 Unclassified 1398
184 Ga0501068_0001528 3300049584 Bacteria 12299
185 Ga0501069_0012668 3300049585 Bacteria 4487
186 Ga0501070_0009466 3300049586 Bacteria 8235
187 Ga0501070_0159089 3300049586 Bacteria 1863
188 Ga0501071_0064005 3300049587 Bacteria 2667
189 Ga0501072_0051594 3300049588 Bacteria 3238
190 Ga0501072_0076158 3300049588 Bacteria 2654
191 Ga0501072_0158187 3300049588 Unclassified 1807
192 Ga0501073_0001144 3300049589 Bacteria 19318
193 Ga0501073_0004442 3300049589 Bacteria 10539
194 Ga0501074_0036997 3300049590 Bacteria 3537
195 Ga0501074_0157863 3300049590 Unclassified 1620
196 Ga0501075_0280111 3300049591 Unclassified 1270
197 Ga0501075_0286194 3300049591 Bacteria 1256
198 Ga0501076_0081275 3300049592 Bacteria 2601
199 Ga0501077_0002199 3300049593 Bacteria 11767
200 Ga0501077_0131187 3300049593 Bacteria 1589
201 Ga0501077_0271344 3300049593 Bacteria 1079
202 Ga0501077_0387202 3300049593 Bacteria 893
203 Ga0501199_007687 3300049650 Bacteria 1117
204 Ga0501201_012762 3300049651 Bacteria 840
205 Ga0501206_025837 3300049653 Bacteria 856
206 Ga0501211_001003 3300049658 Bacteria 2968
207 Ga0501222_001641 3300049662 Bacteria 3108
208 Ga0501223_026213 3300049663 Bacteria 1134
209 Ga0501227_011239 3300049665 Bacteria 1949
210 Ga0501233_038002 3300049668 Bacteria 1120
211 Ga0501242_019515 3300049674 Bacteria 867
212 Ga0501253_001734 3300049683 Bacteria 2301
213 Ga0501258_001928 3300049687 Bacteria 1768
214 Ga0501221_002102 3300049704 Bacteria 3312
215 Ga0501234_027486 3300049707 Bacteria 915
216 Ga0501079_0156057 3300049741 Bacteria 1779
217 Ga0501079_0303383 3300049741 Bacteria 1249
218 Ga0501080_0004055 3300049742 Bacteria 12973
219 Ga0501080_0241217 3300049742 Bacteria 1650
220 Ga0501081_0163581 3300049743 Bacteria 1604
221 Ga0501083_0001452 3300049744 Bacteria 16184
222 Ga0501083_0102058 3300049744 Bacteria 1891
223 Ga0501262_003962 3300049759 Bacteria 1707
224 Ga0501264_001689 3300049761 Bacteria 2256
225 Ga0501266_009849 3300049763 Bacteria 1212
226 Ga0501035_0008481 3300049822 Bacteria 9571
227 Ga0501044_0002735 3300049823 Bacteria 20051
228 Ga0501045_0005608 3300049824 Bacteria 8685
229 Ga0501045_0101887 3300049824 Bacteria 2126
230 nmdc:mga0k408_47027_c1 3300050493 Bacteria 2493
231 nmdc:mga07m45_39480_c1 3300050496 Bacteria 2637
232 nmdc:mga07m45_397_c1 3300050496 Bacteria 17934
233 nmdc:mga07m45_400842_c1 3300050496 Bacteria 796
234 nmdc:mga07m45_50457_c1 3300050496 Bacteria 2345
235 nmdc:mga09592_164997_c1 3300050508 Bacteria 1914
236 nmdc:mga08y16_65999_c1 3300050511 Bacteria 3777
237 nmdc:mga0n895_286582_c1 3300050512 Bacteria 1670
238 Ga0500627_0081199 3300053158 Bacteria 1446
239 Ga0501084_0302231 3300054114 Unclassified 1351
240 Ga0501084_0425400 3300054114 Bacteria 1123
241 Ga0501082_0008540 3300060353 Bacteria 8834
242 Ga0501082_0064751 3300060353 Bacteria 3148
243 Ga0530510_0009083 3300061734 Bacteria 6965
244 Ga0530510_0012993 3300061734 Bacteria 5854
245 Ga0530510_0181998 3300061734 Bacteria 1559
246 Ga0530510_0401377 3300061734 Bacteria 1033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0387202 Ga0501077_0387202_10_618 181
2 iso_pu_bacteria 2842909656 2842913330 192
3 3300026118 Ga0207675_100619662 Ga0207675_1006196621 194
4 3300005444 Ga0070694_100645382 Ga0070694_1006453822 196
5 3300005536 Ga0070697_100002327 Ga0070697_10000232710 196
6 3300031730 Ga0307516_10000345 Ga0307516_1000034532 196
7 3300044683 Ga0466965_0331526 Ga0466965_0331526_208_801 196
8 3300046455 Ga0495603_0138144 Ga0495603_0138144_740_1405 196
9 3300049650 Ga0501199_007687 Ga0501199_007687_13_609 196
10 3300049707 Ga0501234_027486 Ga0501234_027486_90_758 201
11 3300049761 Ga0501264_001689 Ga0501264_001689_1225_1893 201
12 3300026142 Ga0207698_10010995 Ga0207698_100109951 205
13 3300037418 Ga0395900_0179253 Ga0395900_0179253_62_706 205
14 3300046517 Ga0495630_0315384 Ga0495630_0315384_485_1177 205
15 3300049668 Ga0501233_038002 Ga0501233_038002_261_884 205
16 3300049687 Ga0501258_001928 Ga0501258_001928_841_1464 205
17 3300049704 Ga0501221_002102 Ga0501221_002102_413_1036 205
18 3300005467 Ga0070706_100017411 Ga0070706_1000174112 208
19 3300005468 Ga0070707_100241612 Ga0070707_1002416122 208
20 3300025910 Ga0207684_10001415 Ga0207684_1000141519 208
21 3300049591 Ga0501075_0286194 Ga0501075_0286194_545_1219 211
22 3300054114 Ga0501084_0425400 Ga0501084_0425400_121_792 211
23 3300061734 Ga0530510_0181998 Ga0530510_0181998_201_866 211
24 3300049586 Ga0501070_0159089 Ga0501070_0159089_667_1380 213
25 3300049742 Ga0501080_0241217 Ga0501080_0241217_829_1551 213
26 iso_pu_bacteria 2585427687 2586208507 214
27 iso_pu_bacteria 2739367651 2739590112 214
28 iso_pu_bacteria 2739367663 2739644313 214
29 iso_pu_bacteria 2842722452 2842722927 214
30 iso_pu_bacteria 2954016120 2954016503 214
31 3300042126 Ga0450888_001097 Ga0450888_001097_897_1583 215
32 3300013105 Ga0157369_11139071 Ga0157369_111390711 216
33 3300013307 Ga0157372_10007317 Ga0157372_100073174 216
34 3300049577 Ga0501041_0107096 Ga0501041_0107096_678_1394 216
35 3300049588 Ga0501072_0076158 Ga0501072_0076158_647_1363 216
36 3300049593 Ga0501077_0271344 Ga0501077_0271344_261_977 216
37 3300049743 Ga0501081_0163581 Ga0501081_0163581_708_1424 216
38 3300049824 Ga0501045_0101887 Ga0501045_0101887_508_1224 216
39 3300061734 Ga0530510_0009083 Ga0530510_0009083_4567_5283 216
40 iso_pu_bacteria 2643221639 2644218975 216
41 iso_pu_bacteria 2738541337 2739053962 216
42 3300005439 Ga0070711_100214912 Ga0070711_1002149122 217
43 3300005563 Ga0068855_100000097 Ga0068855_10000009778 217
44 3300005841 Ga0068863_100420705 Ga0068863_1004207052 217
45 3300006844 Ga0075428_100205850 Ga0075428_1002058502 217
46 3300006880 Ga0075429_100141796 Ga0075429_1001417962 217
47 3300009094 Ga0111539_10014455 Ga0111539_100144556 217
48 3300009177 Ga0105248_10861342 Ga0105248_108613422 217
49 3300009545 Ga0105237_10001254 Ga0105237_1000125424 217
50 3300009551 Ga0105238_10728772 Ga0105238_107287721 217
51 3300013308 Ga0157375_10089312 Ga0157375_100893122 217
52 3300014325 Ga0163163_10302224 Ga0163163_103022242 217
53 3300025914 Ga0207671_10003534 Ga0207671_1000353412 217
54 3300025916 Ga0207663_10286391 Ga0207663_102863912 217
55 3300025949 Ga0207667_10000190 Ga0207667_1000019077 217
56 3300026088 Ga0207641_10341089 Ga0207641_103410892 217
57 3300027907 Ga0207428_10094651 Ga0207428_100946512 217
58 3300028800 Ga0265338_10301976 Ga0265338_103019762 217
59 3300031344 Ga0265316_10000021 Ga0265316_1000002130 217
60 3300031852 Ga0307410_10150223 Ga0307410_101502233 217
61 3300037471 Ga0395905_0003472 Ga0395905_0003472_15603_16265 217
62 3300037471 Ga0395905_0049352 Ga0395905_0049352_2486_3148 217
63 3300042876 Ga0451577_0015216 Ga0451577_0015216_5928_6662 217
64 3300044673 Ga0453683_0148088 Ga0453683_0148088_787_1449 217
65 3300044673 Ga0453683_0251516 Ga0453683_0251516_217_882 217
66 3300044683 Ga0466965_0136549 Ga0466965_0136549_188_844 217
67 3300044712 Ga0453684_0000173 Ga0453684_0000173_178918_179652 217
68 3300044712 Ga0453684_0038325 Ga0453684_0038325_162_845 217
69 3300045051 Ga0451576_0003655 Ga0451576_0003655_12137_12850 217
70 3300045051 Ga0451576_0009813 Ga0451576_0009813_4145_4810 217
71 3300046492 Ga0495585_0002139 Ga0495585_0002139_5055_5738 217
72 3300046524 Ga0495648_0014172 Ga0495648_0014172_3161_3844 217
73 3300046525 Ga0495663_0026869 Ga0495663_0026869_36_719 217
74 3300046530 Ga0495654_0127021 Ga0495654_0127021_352_1035 217
75 3300046660 Ga0495625_0001551 Ga0495625_0001551_3174_3857 217
76 3300049568 Ga0501031_0272623 Ga0501031_0272623_233_949 217
77 3300049572 Ga0501036_0336281 Ga0501036_0336281_182_898 217
78 3300049580 Ga0501046_0144835 Ga0501046_0144835_917_1633 217
79 3300049588 Ga0501072_0158187 Ga0501072_0158187_184_900 217
80 3300049590 Ga0501074_0157863 Ga0501074_0157863_286_1002 217
81 3300049741 Ga0501079_0156057 Ga0501079_0156057_874_1590 217
82 3300050508 nmdc:mga09592_164997_c1 nmdc:mga09592_164997_c1_1065_1775 217
83 3300050511 nmdc:mga08y16_65999_c1 nmdc:mga08y16_65999_c1_2787_3497 217
84 3300060353 Ga0501082_0064751 Ga0501082_0064751_1469_2185 217
85 3300061734 Ga0530510_0401377 Ga0530510_0401377_107_823 217
86 iso_pu_bacteria 2643221585 2643934729 217
87 iso_pu_bacteria 2643221646 2644255486 217
88 iso_pu_bacteria 2643221656 2644316215 217
89 iso_pu_bacteria 2657244999 2657685890 217
90 iso_pu_bacteria 2791355082 2792581827 217
91 iso_pu_bacteria 2802429268 2804752338 217
92 iso_pu_bacteria 2838074704 2838078949 217
93 iso_pu_bacteria 2896384573 2896390815 217
94 iso_pu_bacteria 2913295892 2913300886 217
95 iso_pu_bacteria 2920760137 2920766139 217
96 iso_pu_bacteria 2937843397 2937847444 217
97 iso_pu_bacteria 8049293176 8049294898 217
98 3300005616 Ga0068852_100770550 Ga0068852_1007705502 218
99 3300006163 Ga0070715_10090594 Ga0070715_100905942 218
100 3300009093 Ga0105240_10028314 Ga0105240_100283147 218
101 3300009174 Ga0105241_10266799 Ga0105241_102667992 218
102 3300009176 Ga0105242_10019683 Ga0105242_100196833 218
103 3300009545 Ga0105237_10135206 Ga0105237_101352062 218
104 3300013102 Ga0157371_10315991 Ga0157371_103159911 218
105 3300013105 Ga0157369_10000015 Ga0157369_100000158 218
106 3300013307 Ga0157372_10643115 Ga0157372_106431151 218
107 3300015262 Ga0182007_10000010 Ga0182007_10000010207 218
108 3300017792 Ga0163161_10000206 Ga0163161_1000020617 218
109 3300017792 Ga0163161_10050486 Ga0163161_100504864 218
110 3300025934 Ga0207686_10266819 Ga0207686_102668192 218
111 3300028556 Ga0265337_1034740 Ga0265337_10347402 218
112 3300028563 Ga0265319_1008983 Ga0265319_10089832 218
113 3300028800 Ga0265338_10078877 Ga0265338_100788773 218
114 3300031595 Ga0265313_10057567 Ga0265313_100575671 218
115 3300031731 Ga0307405_10000035 Ga0307405_1000003517 218
116 3300031903 Ga0307407_10000005 Ga0307407_1000000553 218
117 3300031995 Ga0307409_100099005 Ga0307409_1000990053 218
118 3300032002 Ga0307416_100000001 Ga0307416_100000001395 218
119 3300032004 Ga0307414_10190649 Ga0307414_101906492 218
120 3300044735 Ga0466968_0358593 Ga0466968_0358593_36_692 218
121 3300049568 Ga0501031_0019610 Ga0501031_0019610_559_1248 218
122 3300049569 Ga0501032_0003761 Ga0501032_0003761_5686_6375 218
123 3300049570 Ga0501033_0037115 Ga0501033_0037115_781_1470 218
124 3300049571 Ga0501034_0126697 Ga0501034_0126697_793_1482 218
125 3300049572 Ga0501036_0331851 Ga0501036_0331851_23_712 218
126 3300049573 Ga0501037_0020361 Ga0501037_0020361_640_1329 218
127 3300049575 Ga0501039_0296728 Ga0501039_0296728_559_1248 218
128 3300049576 Ga0501040_0009960 Ga0501040_0009960_378_1067 218
129 3300049577 Ga0501041_0121931 Ga0501041_0121931_151_840 218
130 3300049578 Ga0501042_0007294 Ga0501042_0007294_5986_6675 218
131 3300049579 Ga0501043_0231949 Ga0501043_0231949_151_840 218
132 3300049580 Ga0501046_0003846 Ga0501046_0003846_3585_4274 218
133 3300049581 Ga0501047_0311426 Ga0501047_0311426_280_969 218
134 3300049582 Ga0501048_0204957 Ga0501048_0204957_559_1248 218
135 3300049584 Ga0501068_0001528 Ga0501068_0001528_6109_6798 218
136 3300049585 Ga0501069_0012668 Ga0501069_0012668_3157_3846 218
137 3300049586 Ga0501070_0009466 Ga0501070_0009466_4328_5017 218
138 3300049587 Ga0501071_0064005 Ga0501071_0064005_559_1248 218
139 3300049588 Ga0501072_0051594 Ga0501072_0051594_23_712 218
140 3300049589 Ga0501073_0004442 Ga0501073_0004442_4232_4921 218
141 3300049590 Ga0501074_0036997 Ga0501074_0036997_1811_2500 218
142 3300049591 Ga0501075_0280111 Ga0501075_0280111_23_712 218
143 3300049592 Ga0501076_0081275 Ga0501076_0081275_781_1470 218
144 3300049593 Ga0501077_0002199 Ga0501077_0002199_4258_4947 218
145 3300049741 Ga0501079_0303383 Ga0501079_0303383_140_829 218
146 3300049742 Ga0501080_0004055 Ga0501080_0004055_5685_6374 218
147 3300049744 Ga0501083_0001452 Ga0501083_0001452_10459_11148 218
148 3300049822 Ga0501035_0008481 Ga0501035_0008481_6577_7266 218
149 3300049823 Ga0501044_0002735 Ga0501044_0002735_6130_6819 218
150 3300049824 Ga0501045_0005608 Ga0501045_0005608_1420_2109 218
151 3300054114 Ga0501084_0302231 Ga0501084_0302231_640_1329 218
152 3300060353 Ga0501082_0008540 Ga0501082_0008540_6335_7024 218
153 3300061734 Ga0530510_0012993 Ga0530510_0012993_5143_5832 218
154 3300005937 Ga0081455_10023935 Ga0081455_100239352 219
155 3300013105 Ga0157369_10680084 Ga0157369_106800842 219
156 3300028653 Ga0265323_10000279 Ga0265323_1000027918 219
157 3300028653 Ga0265323_10016186 Ga0265323_100161863 219
158 3300044658 Ga0466972_0008182 Ga0466972_0008182_677_1363 219
159 3300044684 Ga0466966_0022988 Ga0466966_0022988_933_1598 219
160 3300044693 Ga0466961_0145296 Ga0466961_0145296_168_836 219
161 3300044765 Ga0466970_0069130 Ga0466970_0069130_639_1304 219
162 3300045049 Ga0466959_0190724 Ga0466959_0190724_545_1213 219
163 3300045836 Ga0466958_0079643 Ga0466958_0079643_66_734 219
164 3300046674 Ga0495588_0054255 Ga0495588_0054255_1035_1724 219
165 3300049763 Ga0501266_009849 Ga0501266_009849_476_1141 219
166 iso_pu_bacteria 2643221544 2643744718 219
167 3300003794 Ga0055531_10000154 Ga0055531_100001542 220
168 3300005337 Ga0070682_100006372 Ga0070682_1000063724 220
169 3300005457 Ga0070662_100006831 Ga0070662_1000068313 220
170 3300005468 Ga0070707_100131017 Ga0070707_1001310172 220
171 3300025298 Ga0209050_1002439 Ga0209050_10024399 220
172 3300025304 Ga0209257_1000016 Ga0209257_1000016808 220
173 3300025922 Ga0207646_10509345 Ga0207646_105093451 220
174 3300025933 Ga0207706_10012274 Ga0207706_100122743 220
175 3300026142 Ga0207698_10223403 Ga0207698_102234032 220
176 3300031238 Ga0265332_10000003 Ga0265332_10000003367 220
177 3300031238 Ga0265332_10041249 Ga0265332_100412492 220
178 3300031344 Ga0265316_10474297 Ga0265316_104742971 220
179 3300031712 Ga0265342_10028701 Ga0265342_100287013 220
180 3300032004 Ga0307414_10003604 Ga0307414_100036045 220
181 3300032005 Ga0307411_10000114 Ga0307411_1000011418 220
182 3300035116 Ga0373945_0180322 Ga0373945_0180322_12_749 220
183 3300035692 Ga0373935_0021964 Ga0373935_0021964_1030_1767 220
184 3300036647 Ga0316582_0410273 Ga0316582_0410273_195_905 220
185 3300039093 Ga0400489_30811 Ga0400489_30811_1105_1815 220
186 3300044673 Ga0453683_0059292 Ga0453683_0059292_28_735 220
187 3300044712 Ga0453684_0054330 Ga0453684_0054330_2541_3248 220
188 3300046459 Ga0495629_0000523 Ga0495629_0000523_3227_3964 220
189 3300046472 Ga0495580_0117012 Ga0495580_0117012_840_1577 220
190 3300046473 Ga0495582_0000602 Ga0495582_0000602_13978_14715 220
191 3300046475 Ga0495639_0005761 Ga0495639_0005761_1227_1964 220
192 3300046526 Ga0495666_0038153 Ga0495666_0038153_659_1396 220
193 3300046535 Ga0495586_0113065 Ga0495586_0113065_419_1156 220
194 3300046683 Ga0495658_0000679 Ga0495658_0000679_1143_1880 220
195 3300046689 Ga0495613_0000608 Ga0495613_0000608_18217_18954 220
196 3300047315 Ga0495581_0002590 Ga0495581_0002590_2440_3177 220
197 3300047321 Ga0495676_0022392 Ga0495676_0022392_4558_5295 220
198 3300049651 Ga0501201_012762 Ga0501201_012762_133_804 220
199 3300049653 Ga0501206_025837 Ga0501206_025837_150_818 220
200 3300049658 Ga0501211_001003 Ga0501211_001003_1288_1959 220
201 3300049662 Ga0501222_001641 Ga0501222_001641_2251_2922 220
202 3300049663 Ga0501223_026213 Ga0501223_026213_216_884 220
203 3300049665 Ga0501227_011239 Ga0501227_011239_1186_1875 220
204 3300049674 Ga0501242_019515 Ga0501242_019515_76_747 220
205 3300049683 Ga0501253_001734 Ga0501253_001734_276_947 220
206 3300049759 Ga0501262_003962 Ga0501262_003962_759_1430 220
207 3300031548 Ga0307408_100143225 Ga0307408_1001432251 221
208 3300005344 Ga0070661_100234182 Ga0070661_1002341822 222
209 3300005548 Ga0070665_100875079 Ga0070665_1008750791 222
210 3300013297 Ga0157378_10054412 Ga0157378_100544122 222
211 3300025920 Ga0207649_10170685 Ga0207649_101706852 222
212 3300050496 nmdc:mga07m45_400842_c1 nmdc:mga07m45_400842_c1_62_733 222
213 3300053158 Ga0500627_0081199 Ga0500627_0081199_559_1260 222
214 3300003316 rootH1_10010242 rootH1_1001024218 223
215 3300003322 rootL2_10003693 rootL2_100036938 223
216 3300003323 rootH1_10088269 rootH1_100882692 223
217 3300005353 Ga0070669_100047848 Ga0070669_1000478484 223
218 3300005354 Ga0070675_100042274 Ga0070675_1000422742 223
219 3300005445 Ga0070708_100238993 Ga0070708_1002389933 223
220 3300005468 Ga0070707_100028933 Ga0070707_1000289332 223
221 3300005468 Ga0070707_100434983 Ga0070707_1004349832 223
222 3300005614 Ga0068856_100128190 Ga0068856_1001281902 223
223 3300005844 Ga0068862_100125904 Ga0068862_1001259042 223
224 3300006195 Ga0075366_10050612 Ga0075366_100506123 223
225 3300006353 Ga0075370_10001684 Ga0075370_100016846 223
226 3300006353 Ga0075370_10055013 Ga0075370_100550132 223
227 3300006353 Ga0075370_10091083 Ga0075370_100910832 223
228 3300007076 Ga0075435_100225068 Ga0075435_1002250682 223
229 3300007265 Ga0099794_10028670 Ga0099794_100286702 223
230 3300009177 Ga0105248_10043141 Ga0105248_100431416 223
231 3300014325 Ga0163163_10088110 Ga0163163_100881103 223
232 3300025304 Ga0209257_1012688 Ga0209257_10126883 223
233 3300025926 Ga0207659_10027776 Ga0207659_100277764 223
234 3300025941 Ga0207711_10059647 Ga0207711_100596472 223
235 3300026142 Ga0207698_10039613 Ga0207698_100396134 223
236 3300028380 Ga0268265_10099011 Ga0268265_100990112 223
237 3300028794 Ga0307515_10007614 Ga0307515_100076144 223
238 3300028794 Ga0307515_10019507 Ga0307515_100195072 223
239 3300031251 Ga0265327_10000669 Ga0265327_1000066931 223
240 3300031507 Ga0307509_10169764 Ga0307509_101697643 223
241 3300031548 Ga0307408_100000124 Ga0307408_10000012423 223
242 3300031730 Ga0307516_10188112 Ga0307516_101881122 223
243 3300034818 Ga0373950_0034536 Ga0373950_0034536_18_704 223
244 3300035088 Ga0373940_0030558 Ga0373940_0030558_277_963 223
245 3300035112 Ga0373932_0078841 Ga0373932_0078841_320_1006 223
246 3300035114 Ga0373939_0000061 Ga0373939_0000061_19521_20207 223
247 3300035121 Ga0373960_0003211 Ga0373960_0003211_2515_3201 223
248 3300035242 Ga0373962_0056064 Ga0373962_0056064_296_982 223
249 3300035691 Ga0373931_0000100 Ga0373931_0000100_28067_28753 223
250 3300037471 Ga0395905_0001356 Ga0395905_0001356_18724_19398 223
251 3300042129 Ga0450891_000932 Ga0450891_000932_708_1418 223
252 3300042137 Ga0450902_004956 Ga0450902_004956_470_1147 223
253 3300042876 Ga0451577_0005077 Ga0451577_0005077_11649_12380 223
254 3300044712 Ga0453684_0361530 Ga0453684_0361530_786_1517 223
255 3300045051 Ga0451576_0299679 Ga0451576_0299679_838_1593 223
256 3300046476 Ga0495662_0126613 Ga0495662_0126613_455_1198 223
257 3300046642 Ga0495634_0049192 Ga0495634_0049192_1288_2031 223
258 3300048911 Ga0496108_0756395 Ga0496108_0756395_14_769 223
259 3300049589 Ga0501073_0001144 Ga0501073_0001144_3903_4625 223
260 3300049593 Ga0501077_0131187 Ga0501077_0131187_757_1491 223
261 3300049744 Ga0501083_0102058 Ga0501083_0102058_485_1198 223
262 3300050493 nmdc:mga0k408_47027_c1 nmdc:mga0k408_47027_c1_452_1138 223
263 3300050496 nmdc:mga07m45_39480_c1 nmdc:mga07m45_39480_c1_1302_1979 223
264 3300050496 nmdc:mga07m45_397_c1 nmdc:mga07m45_397_c1_12722_13417 223
265 3300050496 nmdc:mga07m45_50457_c1 nmdc:mga07m45_50457_c1_705_1391 223
266 3300050512 nmdc:mga0n895_286582_c1 nmdc:mga0n895_286582_c1_212_940 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08713

DNA_alkylation

DNA alkylation repair enzyme

47

255

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zbo-assembly2.cif.gz_B a new family of proteins related to the heat-like repeat dna glycosylases with affinity for branched dna structures 0.8312 9 218
3zbo-assembly2.cif.gz_B a new family of proteins related to the heat-like repeat dna glycosylases with affinity for branched dna structures 0.7827 9 218
8fl4-assembly1.cif.gz_NU human nuclear pre-60s ribosomal subunit (state i3) 0.7523 118 213
8aw4-assembly1.cif.gz_B structure of a complex of biosynthetic proteins bb-e3 and bgfpd-yy 0.7103 116 220
6tbl-assembly1.cif.gz_A crystal structure of mms19(ctd)-ciao1-ciao2b cia targeting complex 0.6968 115 221
ID Description Score Start End Superfamily
af_Q5AFD2_791_919_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8545 117 223 1.25.10.10
af_O77327_1091_1211_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8476 118 222 1.25.10.10
af_Q54WR2_1690_1853_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8323 97 221 1.25.10.10
af_Q9VJ29_648_757_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8239 118 222 1.25.10.10
af_Q10178_911_1031_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8101 113 223 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A254N139-F1-model_v4 DNA alkylation repair protein 1 5 222
AF-A0A3S0CYL9-F1-model_v4 DNA alkylation repair protein 0.9996 7 222
AF-A0A2R7RUX6-F1-model_v4 DNA alkylation repair protein 0.9981 1 206
AF-A0A530AKR3-F1-model_v4 DNA alkylation repair protein 0.9956 138 220
AF-A0A2N8KZP3-F1-model_v4 DNA alkylation repair protein 0.9948 5 223

Feature Viewer

pLDDT pTM Quality
96.89 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map